F409296

General Info

Members Datasets Scaffolds Average Seq Length
328 213 656 454

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10002450|Ga0265327_100024504
Length 468
Sequence MNNLLTPIITLRHSALALGAAAGLLALATAGRAGVSQADADRLGKDLTPLGAEKAGNADGSIPAWDGGITTPPAGYKPGDHHPDPFPGEQPLFVITAANAGQYGDKVSPGHQALLKAYPDYSLPVYASHRTASNPQRVYDATKRYATTAHLTEGGNGVGGVVIGVPFPLPQNGLEVIWNHLTRYRGIAAERWIGQAAPQRDGSYNLVQFDDEFLFNYYRDDVPEAELIKQLVSSNVLIYFKQSTTAPARFAGSILVVHETMDQVKEPRAAWVYNTGRRRVSRAPNVAYDNPGTNADGMRTSDQFDMFNGAPDRYDWKLVGKKEMYVPYNSYRLHSDKVKVADILKPLHINQDLARYELHRVWVVDATLKPGASHLYSRRTFYIDEDSWQILDVDQYDGRGQLWRVSEAHCINYYDALTFWSTLEVHTDLFAGRYLVIGLDNENKMYDFTIKRTPQDYTPSTLRQEGVR

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
205 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.3
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 4.57
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10002450 3300031251 Bacteria 19572
2 JGI25406J46586_10011654 3300003203 Bacteria 3848
3 rootL2_10089547 3300003322 Bacteria 4665
4 Ga0070683_100003828 3300005329 Bacteria 12295
5 Ga0070690_100001913 3300005330 Bacteria 11054
6 Ga0068869_100068967 3300005334 Bacteria 2613
7 Ga0068869_100090093 3300005334 Bacteria 2304
8 Ga0070666_10006213 3300005335 Bacteria 7349
9 Ga0070680_100001502 3300005336 Bacteria 16987
10 Ga0068868_100005200 3300005338 Bacteria 9136
11 Ga0068868_100128428 3300005338 Bacteria 2072
12 Ga0070689_100040922 3300005340 Bacteria 3554
13 Ga0070689_100184148 3300005340 Bacteria 1698
14 Ga0070671_100005973 3300005355 Bacteria 9701
15 Ga0070671_100021456 3300005355 Bacteria 5274
16 Ga0070673_100018747 3300005364 Bacteria 4954
17 Ga0070667_100000395 3300005367 Bacteria 47219
18 Ga0070709_10003390 3300005434 Bacteria 8560
19 Ga0070714_100001781 3300005435 Bacteria 15692
20 Ga0070713_100000417 3300005436 Bacteria 27109
21 Ga0070713_100006572 3300005436 Bacteria 8078
22 Ga0070701_10006344 3300005438 Bacteria 4973
23 Ga0070711_100001331 3300005439 Bacteria 13494
24 Ga0070705_100062838 3300005440 Bacteria 2213
25 Ga0070700_100036794 3300005441 Bacteria 2972
26 Ga0070694_100078513 3300005444 Bacteria 2290
27 Ga0070678_100009566 3300005456 Bacteria 5881
28 Ga0070678_100010187 3300005456 Bacteria 5730
29 Ga0070662_100223118 3300005457 Bacteria 1505
30 Ga0070681_10001579 3300005458 Bacteria 20232
31 Ga0070681_10003874 3300005458 Bacteria 14079
32 Ga0070681_10006900 3300005458 Bacteria 11055
33 Ga0070681_10088501 3300005458 Bacteria 3048
34 Ga0070699_100140289 3300005518 Bacteria 2134
35 Ga0070679_100002348 3300005530 Bacteria 17133
36 Ga0070672_100023856 3300005543 Bacteria 4513
37 Ga0070686_100029301 3300005544 Bacteria 3347
38 Ga0070686_100034972 3300005544 Bacteria 3100
39 Ga0070695_100038568 3300005545 Bacteria 3016
40 Ga0070695_100039117 3300005545 Bacteria 2996
41 Ga0070665_100008883 3300005548 Bacteria 10177
42 Ga0070665_100008956 3300005548 Bacteria 10142
43 Ga0070665_100008975 3300005548 Bacteria 10131
44 Ga0070665_100166211 3300005548 Bacteria 2208
45 Ga0068855_100016154 3300005563 Bacteria 8975
46 Ga0068857_100207332 3300005577 Bacteria 1788
47 Ga0068856_100001707 3300005614 Bacteria 22944
48 Ga0068856_100023680 3300005614 Bacteria 5970
49 Ga0070702_100004117 3300005615 Bacteria 6602
50 Ga0070702_100083103 3300005615 Bacteria 1923
51 Ga0068859_100001110 3300005617 Bacteria 27468
52 Ga0068859_100029113 3300005617 Bacteria 5542
53 Ga0068859_100144454 3300005617 Bacteria 2454
54 Ga0068866_10014304 3300005718 Bacteria 3501
55 Ga0068861_100005755 3300005719 Bacteria 8407
56 Ga0068861_100017583 3300005719 Bacteria 5079
57 Ga0068861_100073445 3300005719 Bacteria 2657
58 Ga0068870_10012517 3300005840 Bacteria 3967
59 Ga0068863_100024407 3300005841 Bacteria 5767
60 Ga0068858_100000426 3300005842 Bacteria 43886
61 Ga0068860_100009903 3300005843 Bacteria 9450
62 Ga0068860_100037117 3300005843 Bacteria 4665
63 Ga0068862_100021616 3300005844 Bacteria 5380
64 Ga0081455_10000098 3300005937 Bacteria 95177
65 Ga0081455_10086025 3300005937 Bacteria 2561
66 Ga0081539_10000006 3300005985 Bacteria 534555
67 Ga0070717_10009358 3300006028 Bacteria 7358
68 Ga0070717_10031826 3300006028 Bacteria 4246
69 Ga0070715_10014982 3300006163 Bacteria 2883
70 Ga0070712_100013227 3300006175 Bacteria 5267
71 Ga0070712_100072642 3300006175 Bacteria 2465
72 Ga0097621_100027098 3300006237 Bacteria 4503
73 Ga0097621_100042203 3300006237 Bacteria 3674
74 Ga0068871_100011427 3300006358 Bacteria 6513
75 Ga0068865_100005510 3300006881 Bacteria 7683
76 Ga0068865_100036637 3300006881 Bacteria 3308
77 Ga0097620_100001110 3300006931 Bacteria 27468
78 Ga0097620_100029115 3300006931 Bacteria 5542
79 Ga0097620_100144449 3300006931 Bacteria 2454
80 Ga0099795_10029424 3300007788 Bacteria 1877
81 Ga0105240_10004207 3300009093 Bacteria 22002
82 Ga0111539_10248208 3300009094 Bacteria 2072
83 Ga0105245_10018181 3300009098 Bacteria 6146
84 Ga0105247_10000150 3300009101 Bacteria 68542
85 Ga0105247_10018245 3300009101 Bacteria 4209
86 Ga0105247_10032692 3300009101 Bacteria 3161
87 Ga0105242_10003269 3300009176 Bacteria 12633
88 Ga0105248_10015412 3300009177 Bacteria 8428
89 Ga0105248_10086906 3300009177 Bacteria 3519
90 Ga0105237_10009514 3300009545 Bacteria 10406
91 Ga0105237_10301567 3300009545 Bacteria 1605
92 Ga0105238_10003719 3300009551 Bacteria 15177
93 Ga0105238_10153556 3300009551 Bacteria 2277
94 Ga0105249_10005018 3300009553 Bacteria 11418
95 Ga0105249_10118741 3300009553 Bacteria 2510
96 Ga0105249_10291624 3300009553 Bacteria 1633
97 Ga0105239_10020978 3300010375 Bacteria 7209
98 Ga0157370_10010434 3300013104 Bacteria 9792
99 Ga0157369_10064463 3300013105 Bacteria 3946
100 Ga0157369_10154844 3300013105 Bacteria 2421
101 Ga0157374_10004470 3300013296 Bacteria 11740
102 Ga0163162_10010018 3300013306 Bacteria 9214
103 Ga0163163_10035026 3300014325 Bacteria 4867
104 Ga0163163_10118218 3300014325 Bacteria 2683
105 Ga0163163_10142457 3300014325 Bacteria 2440
106 Ga0157380_10070668 3300014326 Bacteria 2821
107 Ga0157379_10008766 3300014968 Bacteria 8819
108 Ga0157379_10039837 3300014968 Bacteria 4193
109 Ga0157376_10021200 3300014969 Bacteria 5045
110 Ga0213876_10013222 3300021384 Bacteria 4387
111 Ga0207692_10017781 3300025898 Bacteria 3177
112 Ga0207642_10033591 3300025899 Bacteria 2172
113 Ga0207710_10000181 3300025900 Bacteria 63816
114 Ga0207680_10032652 3300025903 Bacteria 2961
115 Ga0207685_10026084 3300025905 Bacteria 2027
116 Ga0207699_10004393 3300025906 Bacteria 6745
117 Ga0207699_10019065 3300025906 Bacteria 3650
118 Ga0207643_10085069 3300025908 Bacteria 1836
119 Ga0207707_10003445 3300025912 Bacteria 14028
120 Ga0207707_10004544 3300025912 Bacteria 12201
121 Ga0207707_10014092 3300025912 Bacteria 6968
122 Ga0207707_10017487 3300025912 Bacteria 6250
123 Ga0207707_10017793 3300025912 Bacteria 6198
124 Ga0207695_10009686 3300025913 Bacteria 11861
125 Ga0207695_10245010 3300025913 Bacteria 1693
126 Ga0207671_10071661 3300025914 Bacteria 2585
127 Ga0207693_10000211 3300025915 Bacteria 53479
128 Ga0207663_10040320 3300025916 Bacteria 2837
129 Ga0207663_10041926 3300025916 Bacteria 2793
130 Ga0207660_10001402 3300025917 Bacteria 16193
131 Ga0207660_10130737 3300025917 Bacteria 1911
132 Ga0207652_10004040 3300025921 Bacteria 11980
133 Ga0207652_10191116 3300025921 Bacteria 1841
134 Ga0207694_10055674 3300025924 Bacteria 3070
135 Ga0207650_10206111 3300025925 Bacteria 1577
136 Ga0207687_10016581 3300025927 Bacteria 4839
137 Ga0207700_10002585 3300025928 Bacteria 10404
138 Ga0207664_10004852 3300025929 Bacteria 9146
139 Ga0207644_10006472 3300025931 Bacteria 7636
140 Ga0207644_10093726 3300025931 Bacteria 2242
141 Ga0207670_10007602 3300025936 Bacteria 6060
142 Ga0207670_10164542 3300025936 Bacteria 1659
143 Ga0207665_10003585 3300025939 Bacteria 10374
144 Ga0207665_10012236 3300025939 Bacteria 5636
145 Ga0207665_10046997 3300025939 Bacteria 2893
146 Ga0207689_10081089 3300025942 Bacteria 2667
147 Ga0207661_10001137 3300025944 Bacteria 17736
148 Ga0207661_10027286 3300025944 Bacteria 4361
149 Ga0207679_10038723 3300025945 Bacteria 3399
150 Ga0207667_10107344 3300025949 Bacteria 2880
151 Ga0207667_10116481 3300025949 Bacteria 2753
152 Ga0207668_10045232 3300025972 Bacteria 3001
153 Ga0207703_10000627 3300026035 Bacteria 35546
154 Ga0207678_10114360 3300026067 Bacteria 2302
155 Ga0207708_10040039 3300026075 Bacteria 3572
156 Ga0207708_10098933 3300026075 Bacteria 2255
157 Ga0207648_10154042 3300026089 Bacteria 2028
158 Ga0207648_10243586 3300026089 Bacteria 1601
159 Ga0207675_100001255 3300026118 Bacteria 25307
160 Ga0207675_100047625 3300026118 Bacteria 4002
161 Ga0207675_100082482 3300026118 Bacteria 3015
162 Ga0207683_10002256 3300026121 Bacteria 16911
163 Ga0268266_10069537 3300028379 Bacteria 3050
164 Ga0268266_10219099 3300028379 Bacteria 1748
165 Ga0268265_10008065 3300028380 Bacteria 7115
166 Ga0268264_10030800 3300028381 Bacteria 4397
167 Ga0268264_10039258 3300028381 Bacteria 3911
168 Ga0265337_1029352 3300028556 Bacteria 1645
169 Ga0265319_1008857 3300028563 Bacteria 4361
170 Ga0265318_10000075 3300028577 Bacteria 94310
171 Ga0265318_10003137 3300028577 Bacteria 8455
172 Ga0265323_10000011 3300028653 Bacteria 109381
173 Ga0265323_10005128 3300028653 Bacteria 5581
174 Ga0265323_10011518 3300028653 Bacteria 3568
175 Ga0265322_10000671 3300028654 Bacteria 12742
176 Ga0265322_10001768 3300028654 Bacteria 6861
177 Ga0307515_10016790 3300028794 Bacteria 13385
178 Ga0265338_10018477 3300028800 Bacteria 7462
179 Ga0307511_10000310 3300030521 Bacteria 51837
180 Ga0307511_10006286 3300030521 Bacteria 11980
181 Ga0265760_10014876 3300031090 Bacteria 2231
182 Ga0265330_10013514 3300031235 Bacteria 3804
183 Ga0265320_10001363 3300031240 Bacteria 17819
184 Ga0265320_10002577 3300031240 Bacteria 12595
185 Ga0265320_10007089 3300031240 Bacteria 6990
186 Ga0265320_10023593 3300031240 Bacteria 3271
187 Ga0265327_10000016 3300031251 Bacteria 467439
188 Ga0265327_10007363 3300031251 Bacteria 8518
189 Ga0265327_10009586 3300031251 Bacteria 6958
190 Ga0265316_10000635 3300031344 Bacteria 39111
191 Ga0265316_10020530 3300031344 Bacteria 5621
192 Ga0307513_10011787 3300031456 Bacteria 10840
193 Ga0307513_10026109 3300031456 Bacteria 6743
194 Ga0307513_10104421 3300031456 Bacteria 2847
195 Ga0307509_10000017 3300031507 Bacteria 265012
196 Ga0307509_10203611 3300031507 Bacteria 1813
197 Ga0307509_10224600 3300031507 Bacteria 1687
198 Ga0265313_10004080 3300031595 Bacteria 11376
199 Ga0307508_10000022 3300031616 Bacteria 180417
200 Ga0316575_10017646 3300031665 Bacteria 2712
201 Ga0265314_10002815 3300031711 Bacteria 17348
202 Ga0265314_10007000 3300031711 Bacteria 9863
203 Ga0316576_10000085 3300031727 Bacteria 32485
204 Ga0316576_10000234 3300031727 Bacteria 23737
205 Ga0316576_10001383 3300031727 Bacteria 12956
206 Ga0316576_10048641 3300031727 Bacteria 3076
207 Ga0316577_10051071 3300031733 Bacteria 2308
208 Ga0307410_10001385 3300031852 Bacteria 10901
209 Ga0307412_10087872 3300031911 Bacteria 2167
210 Ga0307510_10048832 3300033180 Bacteria 4509
211 Ga0373951_0009484 3300035091 Bacteria 2191
212 Ga0373936_0012456 3300035113 Bacteria 3235
213 Ga0316574_0016718 3300035398 Bacteria 4279
214 Ga0316574_0073572 3300035398 Bacteria 2161
215 Ga0373937_0000692 3300036401 Bacteria 29375
216 Ga0373937_0204313 3300036401 Bacteria 1858
217 Ga0316582_0181304 3300036647 Bacteria 1433
218 Ga0316584_0015010 3300036712 Bacteria 5532
219 Ga0436365_1058487 3300039437 Bacteria 8655
220 Ga0436360_1226117 3300039438 Bacteria 7787
221 Ga0436361_1174016 3300039447 Bacteria 3012
222 Ga0436363_1684241 3300039450 Bacteria 7559
223 Ga0451807_0851828 3300041486 Bacteria 2711
224 Ga0439445_0011695 3300042004 Bacteria 2096
225 Ga0451577_0000012 3300042876 Bacteria 575467
226 Ga0451577_0015022 3300042876 Bacteria 7205
227 Ga0451577_0086060 3300042876 Bacteria 2804
228 Ga0466969_0002197 3300044656 Bacteria 10426
229 Ga0466972_0040635 3300044658 Bacteria 2265
230 Ga0466966_0001763 3300044684 Bacteria 14025
231 Ga0466961_0002432 3300044693 Bacteria 11553
232 Ga0453684_0039634 3300044712 Bacteria 6415
233 Ga0453684_0040627 3300044712 Bacteria 6312
234 Ga0453684_0041987 3300044712 Bacteria 6173
235 Ga0453684_0061467 3300044712 Bacteria 4822
236 Ga0466971_0004830 3300044719 Bacteria 5831
237 Ga0466970_0000209 3300044765 Bacteria 28546
238 Ga0451576_0000708 3300045051 Bacteria 67318
239 Ga0451576_0000742 3300045051 Bacteria 65038
240 Ga0451576_0004937 3300045051 Bacteria 16984
241 Ga0451576_0033629 3300045051 Bacteria 5450
242 Ga0451576_0164493 3300045051 Bacteria 2315
243 Ga0495590_0005993 3300046457 Bacteria 4767
244 Ga0495638_0008485 3300046460 Bacteria 7282
245 Ga0495580_0048304 3300046472 Bacteria 3014
246 Ga0495584_0026688 3300046491 Bacteria 2927
247 Ga0495616_0004552 3300046513 Bacteria 8727
248 Ga0495668_0052698 3300046616 Bacteria 2251
249 Ga0495625_0022063 3300046660 Bacteria 4888
250 Ga0495671_0013964 3300046692 Bacteria 4331
251 Ga0495687_064082 3300047443 Bacteria 1502
252 Ga0496101_0054709 3300048904 Bacteria 2881
253 Ga0496102_0009771 3300048905 Bacteria 8251
254 Ga0496105_0079567 3300048908 Bacteria 2706
255 Ga0496105_0138006 3300048908 Bacteria 2008
256 Ga0496106_0022629 3300048909 Bacteria 4671
257 Ga0496106_0231094 3300048909 Bacteria 1477
258 Ga0496107_0037406 3300048910 Bacteria 3482
259 Ga0496108_0010297 3300048911 Bacteria 7590
260 Ga0496109_0016104 3300048912 Bacteria 6533
261 Ga0496111_0009600 3300048914 Bacteria 6463
262 Ga0496112_0038883 3300048915 Bacteria 4648
263 Ga0496112_0074743 3300048915 Bacteria 3351
264 Ga0496114_0036849 3300048917 Bacteria 4043
265 Ga0496115_0018201 3300048918 Bacteria 5388
266 Ga0496118_0027013 3300048921 Bacteria 4870
267 Ga0496121_0009470 3300048924 Bacteria 11190
268 Ga0496125_0014790 3300048928 Bacteria 7580
269 Ga0501031_0135813 3300049568 Bacteria 1607
270 Ga0501032_0001784 3300049569 Bacteria 16985
271 Ga0501033_0084369 3300049570 Bacteria 2328
272 Ga0501034_0063028 3300049571 Bacteria 3722
273 Ga0501036_0054534 3300049572 Bacteria 3386
274 Ga0501038_0064185 3300049574 Bacteria 3132
275 Ga0501039_0005468 3300049575 Bacteria 9608
276 Ga0501040_0002988 3300049576 Bacteria 10943
277 Ga0501040_0005316 3300049576 Bacteria 8328
278 Ga0501042_0041537 3300049578 Bacteria 3271
279 Ga0501046_0030758 3300049580 Bacteria 4356
280 Ga0501047_0042306 3300049581 Bacteria 4403
281 Ga0501048_0003499 3300049582 Bacteria 11939
282 Ga0501067_0005594 3300049583 Bacteria 6971
283 Ga0501068_0000289 3300049584 Bacteria 25017
284 Ga0501068_0016967 3300049584 Bacteria 4207
285 Ga0501068_0038490 3300049584 Bacteria 2866
286 Ga0501071_0006734 3300049587 Bacteria 7476
287 Ga0501071_0015973 3300049587 Bacteria 5157
288 Ga0501072_0004133 3300049588 Bacteria 10987
289 Ga0501072_0005339 3300049588 Bacteria 9779
290 Ga0501072_0008386 3300049588 Bacteria 7844
291 Ga0501073_0000841 3300049589 Bacteria 21854
292 Ga0501074_0007607 3300049590 Bacteria 7841
293 Ga0501074_0011690 3300049590 Bacteria 6380
294 Ga0501075_0000865 3300049591 Bacteria 19107
295 Ga0501076_0000155 3300049592 Bacteria 39435
296 Ga0501076_0001977 3300049592 Bacteria 14000
297 Ga0501077_0003354 3300049593 Bacteria 9625
298 Ga0501077_0007212 3300049593 Bacteria 6857
299 Ga0501079_0000097 3300049741 Bacteria 43697
300 Ga0501079_0003723 3300049741 Bacteria 11249
301 Ga0501079_0008878 3300049741 Bacteria 7610
302 Ga0501080_0002352 3300049742 Bacteria 16493
303 Ga0501081_0003848 3300049743 Bacteria 9621
304 Ga0501083_0004435 3300049744 Bacteria 9910
305 Ga0501083_0026232 3300049744 Bacteria 4029
306 Ga0501035_0000410 3300049822 Bacteria 48698
307 Ga0501035_0027183 3300049822 Bacteria 5231
308 Ga0501035_0048206 3300049822 Bacteria 3821
309 Ga0501035_0191872 3300049822 Bacteria 1756
310 Ga0501044_0001947 3300049823 Bacteria 23893
311 Ga0501044_0003320 3300049823 Bacteria 18122
312 nmdc:mga06r32_219561_c1 3300050510 Bacteria 1889
313 Ga0500641_0060649 3300053096 Bacteria 1574
314 Ga0500628_005897 3300053129 Bacteria 2060
315 Ga0500588_0003100 3300053146 Bacteria 3469
316 Ga0500616_0000064 3300053153 Bacteria 243072
317 Ga0500622_0002133 3300053156 Bacteria 14728
318 Ga0500622_0015462 3300053156 Bacteria 4085
319 Ga0500630_062951 3300053159 Bacteria 1770
320 Ga0501084_0003333 3300054114 Bacteria 13001
321 Ga0501084_0008241 3300054114 Bacteria 8596
322 Ga0501084_0019192 3300054114 Bacteria 5694
323 Ga0501082_0003091 3300060353 Bacteria 14516
324 Ga0466962_0000184 3300061719 Bacteria 25901
325 Ga0530510_0004559 3300061734 Bacteria 9583
326 Ga0530510_0022594 3300061734 Bacteria 4481
327 Ga0530510_0090216 3300061734 Bacteria 2235
328 2916180594 2916178963 Bacteria 5265078
329 Ga0265327_10002450
330 JGI25406J46586_10011654
331 rootL2_10089547
332 Ga0070683_100003828
333 Ga0070690_100001913
334 Ga0068869_100068967
335 Ga0068869_100090093
336 Ga0070666_10006213
337 Ga0070680_100001502
338 Ga0068868_100005200
339 Ga0068868_100128428
340 Ga0070689_100040922
341 Ga0070689_100184148
342 Ga0070671_100005973
343 Ga0070671_100021456
344 Ga0070673_100018747
345 Ga0070667_100000395
346 Ga0070709_10003390
347 Ga0070714_100001781
348 Ga0070713_100000417
349 Ga0070713_100006572
350 Ga0070701_10006344
351 Ga0070711_100001331
352 Ga0070705_100062838
353 Ga0070700_100036794
354 Ga0070694_100078513
355 Ga0070678_100009566
356 Ga0070678_100010187
357 Ga0070662_100223118
358 Ga0070681_10001579
359 Ga0070681_10003874
360 Ga0070681_10006900
361 Ga0070681_10088501
362 Ga0070699_100140289
363 Ga0070679_100002348
364 Ga0070672_100023856
365 Ga0070686_100029301
366 Ga0070686_100034972
367 Ga0070695_100038568
368 Ga0070695_100039117
369 Ga0070665_100008883
370 Ga0070665_100008956
371 Ga0070665_100008975
372 Ga0070665_100166211
373 Ga0068855_100016154
374 Ga0068857_100207332
375 Ga0068856_100001707
376 Ga0068856_100023680
377 Ga0070702_100004117
378 Ga0070702_100083103
379 Ga0068859_100001110
380 Ga0068859_100029113
381 Ga0068859_100144454
382 Ga0068866_10014304
383 Ga0068861_100005755
384 Ga0068861_100017583
385 Ga0068861_100073445
386 Ga0068870_10012517
387 Ga0068863_100024407
388 Ga0068858_100000426
389 Ga0068860_100009903
390 Ga0068860_100037117
391 Ga0068862_100021616
392 Ga0081455_10000098
393 Ga0081455_10086025
394 Ga0081539_10000006
395 Ga0070717_10009358
396 Ga0070717_10031826
397 Ga0070715_10014982
398 Ga0070712_100013227
399 Ga0070712_100072642
400 Ga0097621_100027098
401 Ga0097621_100042203
402 Ga0068871_100011427
403 Ga0068865_100005510
404 Ga0068865_100036637
405 Ga0097620_100001110
406 Ga0097620_100029115
407 Ga0097620_100144449
408 Ga0099795_10029424
409 Ga0105240_10004207
410 Ga0111539_10248208
411 Ga0105245_10018181
412 Ga0105247_10000150
413 Ga0105247_10018245
414 Ga0105247_10032692
415 Ga0105242_10003269
416 Ga0105248_10015412
417 Ga0105248_10086906
418 Ga0105237_10009514
419 Ga0105237_10301567
420 Ga0105238_10003719
421 Ga0105238_10153556
422 Ga0105249_10005018
423 Ga0105249_10118741
424 Ga0105249_10291624
425 Ga0105239_10020978
426 Ga0157370_10010434
427 Ga0157369_10064463
428 Ga0157369_10154844
429 Ga0157374_10004470
430 Ga0163162_10010018
431 Ga0163163_10035026
432 Ga0163163_10118218
433 Ga0163163_10142457
434 Ga0157380_10070668
435 Ga0157379_10008766
436 Ga0157379_10039837
437 Ga0157376_10021200
438 Ga0213876_10013222
439 Ga0207692_10017781
440 Ga0207642_10033591
441 Ga0207710_10000181
442 Ga0207680_10032652
443 Ga0207685_10026084
444 Ga0207699_10004393
445 Ga0207699_10019065
446 Ga0207643_10085069
447 Ga0207707_10003445
448 Ga0207707_10004544
449 Ga0207707_10014092
450 Ga0207707_10017487
451 Ga0207707_10017793
452 Ga0207695_10009686
453 Ga0207695_10245010
454 Ga0207671_10071661
455 Ga0207693_10000211
456 Ga0207663_10040320
457 Ga0207663_10041926
458 Ga0207660_10001402
459 Ga0207660_10130737
460 Ga0207652_10004040
461 Ga0207652_10191116
462 Ga0207694_10055674
463 Ga0207650_10206111
464 Ga0207687_10016581
465 Ga0207700_10002585
466 Ga0207664_10004852
467 Ga0207644_10006472
468 Ga0207644_10093726
469 Ga0207670_10007602
470 Ga0207670_10164542
471 Ga0207665_10003585
472 Ga0207665_10012236
473 Ga0207665_10046997
474 Ga0207689_10081089
475 Ga0207661_10001137
476 Ga0207661_10027286
477 Ga0207679_10038723
478 Ga0207667_10107344
479 Ga0207667_10116481
480 Ga0207668_10045232
481 Ga0207703_10000627
482 Ga0207678_10114360
483 Ga0207708_10040039
484 Ga0207708_10098933
485 Ga0207648_10154042
486 Ga0207648_10243586
487 Ga0207675_100001255
488 Ga0207675_100047625
489 Ga0207675_100082482
490 Ga0207683_10002256
491 Ga0268266_10069537
492 Ga0268266_10219099
493 Ga0268265_10008065
494 Ga0268264_10030800
495 Ga0268264_10039258
496 Ga0265337_1029352
497 Ga0265319_1008857
498 Ga0265318_10000075
499 Ga0265318_10003137
500 Ga0265323_10000011
501 Ga0265323_10005128
502 Ga0265323_10011518
503 Ga0265322_10000671
504 Ga0265322_10001768
505 Ga0307515_10016790
506 Ga0265338_10018477
507 Ga0307511_10000310
508 Ga0307511_10006286
509 Ga0265760_10014876
510 Ga0265330_10013514
511 Ga0265320_10001363
512 Ga0265320_10002577
513 Ga0265320_10007089
514 Ga0265320_10023593
515 Ga0265327_10000016
516 Ga0265327_10007363
517 Ga0265327_10009586
518 Ga0265316_10000635
519 Ga0265316_10020530
520 Ga0307513_10011787
521 Ga0307513_10026109
522 Ga0307513_10104421
523 Ga0307509_10000017
524 Ga0307509_10203611
525 Ga0307509_10224600
526 Ga0265313_10004080
527 Ga0307508_10000022
528 Ga0316575_10017646
529 Ga0265314_10002815
530 Ga0265314_10007000
531 Ga0316576_10000085
532 Ga0316576_10000234
533 Ga0316576_10001383
534 Ga0316576_10048641
535 Ga0316577_10051071
536 Ga0307410_10001385
537 Ga0307412_10087872
538 Ga0307510_10048832
539 Ga0373951_0009484
540 Ga0373936_0012456
541 Ga0316574_0016718
542 Ga0316574_0073572
543 Ga0373937_0000692
544 Ga0373937_0204313
545 Ga0316582_0181304
546 Ga0316584_0015010
547 Ga0436365_1058487
548 Ga0436360_1226117
549 Ga0436361_1174016
550 Ga0436363_1684241
551 Ga0451807_0851828
552 Ga0439445_0011695
553 Ga0451577_0000012
554 Ga0451577_0015022
555 Ga0451577_0086060
556 Ga0466969_0002197
557 Ga0466972_0040635
558 Ga0466966_0001763
559 Ga0466961_0002432
560 Ga0453684_0039634
561 Ga0453684_0040627
562 Ga0453684_0041987
563 Ga0453684_0061467
564 Ga0466971_0004830
565 Ga0466970_0000209
566 Ga0451576_0000708
567 Ga0451576_0000742
568 Ga0451576_0004937
569 Ga0451576_0033629
570 Ga0451576_0164493
571 Ga0495590_0005993
572 Ga0495638_0008485
573 Ga0495580_0048304
574 Ga0495584_0026688
575 Ga0495616_0004552
576 Ga0495668_0052698
577 Ga0495625_0022063
578 Ga0495671_0013964
579 Ga0495687_064082
580 Ga0496101_0054709
581 Ga0496102_0009771
582 Ga0496105_0079567
583 Ga0496105_0138006
584 Ga0496106_0022629
585 Ga0496106_0231094
586 Ga0496107_0037406
587 Ga0496108_0010297
588 Ga0496109_0016104
589 Ga0496111_0009600
590 Ga0496112_0038883
591 Ga0496112_0074743
592 Ga0496114_0036849
593 Ga0496115_0018201
594 Ga0496118_0027013
595 Ga0496121_0009470
596 Ga0496125_0014790
597 Ga0501031_0135813
598 Ga0501032_0001784
599 Ga0501033_0084369
600 Ga0501034_0063028
601 Ga0501036_0054534
602 Ga0501038_0064185
603 Ga0501039_0005468
604 Ga0501040_0002988
605 Ga0501040_0005316
606 Ga0501042_0041537
607 Ga0501046_0030758
608 Ga0501047_0042306
609 Ga0501048_0003499
610 Ga0501067_0005594
611 Ga0501068_0000289
612 Ga0501068_0016967
613 Ga0501068_0038490
614 Ga0501071_0006734
615 Ga0501071_0015973
616 Ga0501072_0004133
617 Ga0501072_0005339
618 Ga0501072_0008386
619 Ga0501073_0000841
620 Ga0501074_0007607
621 Ga0501074_0011690
622 Ga0501075_0000865
623 Ga0501076_0000155
624 Ga0501076_0001977
625 Ga0501077_0003354
626 Ga0501077_0007212
627 Ga0501079_0000097
628 Ga0501079_0003723
629 Ga0501079_0008878
630 Ga0501080_0002352
631 Ga0501081_0003848
632 Ga0501083_0004435
633 Ga0501083_0026232
634 Ga0501035_0000410
635 Ga0501035_0027183
636 Ga0501035_0048206
637 Ga0501035_0191872
638 Ga0501044_0001947
639 Ga0501044_0003320
640 nmdc:mga06r32_219561_c1
641 Ga0500641_0060649
642 Ga0500628_005897
643 Ga0500588_0003100
644 Ga0500616_0000064
645 Ga0500622_0002133
646 Ga0500622_0015462
647 Ga0500630_062951
648 Ga0501084_0003333
649 Ga0501084_0008241
650 Ga0501084_0019192
651 Ga0501082_0003091
652 Ga0466962_0000184
653 Ga0530510_0004559
654 Ga0530510_0022594
655 Ga0530510_0090216
656 2916180594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07044

DUF1329

Protein of unknown function (DUF1329)

94

463

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bk5-assembly1.cif.gz_A crystal structure of putative outer membrane lipoprotein-sorting protein domain from vibrio parahaemolyticus 0.7835 170 455
3bk5-assembly1.cif.gz_A crystal structure of putative outer membrane lipoprotein-sorting protein domain from vibrio parahaemolyticus 0.7657 170 455
4z48-assembly2.cif.gz_B crystal structure of a duf1329 family protein (despig_00262) from desulfovibrio piger atcc 29098 at 1.75 a resolution 0.7469 183 454
4z48-assembly2.cif.gz_B crystal structure of a duf1329 family protein (despig_00262) from desulfovibrio piger atcc 29098 at 1.75 a resolution 0.6896 183 454
3buu-assembly2.cif.gz_B crystal structure of lola superfamily protein ne2245 from nitrosomonas europaea 0.658 168 453
ID Description Score Start End Superfamily
3bk5A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7557 170 455 2.50.20.10
4z48A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7452 173 454 2.50.20.10
3bk5A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7385 170 455 2.50.20.10
4z48A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7122 173 454 2.50.20.10
af_Q9VJ98_137_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7034 369 393 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A534B6R7-F1-model_v4 DUF1329 domain-containing protein 0.9857 38 460
AF-A0A534B6R7-F1-model_v4 DUF1329 domain-containing protein 0.9834 38 460
AF-A0A6L7S0X3-F1-model_v4 DUF1329 domain-containing protein 0.98 58 458
AF-A0A7T4R9L1-F1-model_v4 deleted 0.9749 19 460
AF-A0A850KY85-F1-model_v4 DUF1329 domain-containing protein 0.9739 44 458

Map