F409239

General Info

Members Datasets Scaffolds Average Seq Length
328 212 656 351

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10081851|Ga0157373_100818514
Length 400
Sequence MIVTRFDSIVCRYYQESNPVSEVLCTTAGDAFGVIRCRTRFLHYIGAMSDPAPPPSLDALGTPLAWSGPDGRIAGCNPAFARWLGVSGRRLLGQPLAALEVQGEALAHFLARDERDSLRLNRLALALPGEAARFAEGWMSRRDDGGWLLEAHPVDEFPGLDPTQALPSALSAALKGLAHELRNPLAGLKGAAQLLARRAAQRDASERELIDLIGSEIERLNGLLEQLLSPAPAAPHAALNIHAALERVLRLAENEAGWAVRLQRDYDPSIPEFDGDADRLTQAVWNLVRNAIQAGAGNITLRTRVEHGVRIAEQLHTLALRLEIADDGRGVPEELAEHLFLPLVSGRAEGTGLGLALAQQVAREHRGTLTYRSRPGHTVFTLLLPIGNGTAAAEEAPRDV

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
93 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
168 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
169 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
170 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
171 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
172 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
173 2643221559 Lysobacter sp. Root559 Isolate Unclassified
174 2643221573 Lysobacter sp. Root604 Isolate Unclassified
175 2643221586 Lysobacter sp. Root667 Isolate Unclassified
176 2643221593 Lysobacter sp. Root690 Isolate Unclassified
177 2643221612 Lysobacter sp. Root76 Isolate Unclassified
178 2643221695 Lysobacter sp. Root494 Isolate Unclassified
179 2643221720 Lysobacter sp. Root916 Isolate Unclassified
180 2643221727 Lysobacter sp. Root96 Isolate Unclassified
181 2643221728 Lysobacter sp. Root983 Isolate Unclassified
182 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
183 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
184 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
185 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
186 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
187 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
188 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
189 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
190 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
191 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
192 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
193 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
194 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
195 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
196 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
197 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
198 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
199 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
200 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
201 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
202 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
203 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
204 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
205 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
206 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
207 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
208 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
209 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
210 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
211 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
212 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.28
Metatranscriptomes 0
Isolates 13.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 21.04
Nodule 0.3
Rhizoplane 2.13
Rhizosphere 54.27
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10081851 3300013100 Bacteria 2276
2 JGI25151J46595_10000856 3300003187 Bacteria 24192
3 rootH2_10016307 3300003320 Bacteria 10064
4 Ga0055526_1000197 3300003771 Bacteria 52057
5 Ga0055537_1000054 3300003773 Bacteria 82420
6 Ga0055537_1000151 3300003773 Bacteria 52057
7 Ga0055524_1000269 3300003775 Bacteria 52057
8 Ga0055524_1017005 3300003775 Bacteria 2581
9 Ga0055524_1022307 3300003775 Bacteria 2072
10 Ga0055536_1000760 3300003781 Bacteria 21487
11 Ga0055536_1011665 3300003781 Bacteria 3341
12 Ga0055534_1000148 3300003784 Bacteria 52057
13 Ga0055534_1000188 3300003784 Bacteria 45268
14 Ga0055534_1000360 3300003784 Bacteria 28779
15 Ga0055528_1000192 3300003790 Bacteria 52057
16 Ga0055528_1000799 3300003790 Bacteria 21739
17 Ga0055530_10001643 3300003791 Bacteria 15958
18 Ga0055530_10003495 3300003791 Bacteria 8890
19 Ga0055540_1019028 3300003792 Bacteria 1863
20 Ga0055531_10001475 3300003794 Bacteria 17318
21 Ga0055531_10004030 3300003794 Bacteria 9116
22 Ga0055531_10006066 3300003794 Bacteria 6924
23 Ga0055531_10021284 3300003794 Bacteria 2522
24 Ga0058692_1000005 3300003856 Bacteria 398815
25 Ga0070658_10066288 3300005327 Bacteria 2949
26 Ga0070690_100089665 3300005330 Unclassified 2023
27 Ga0070677_10043937 3300005333 Bacteria 1776
28 Ga0068869_100044127 3300005334 Bacteria 3206
29 Ga0070666_10056951 3300005335 Bacteria 2641
30 Ga0068868_100082281 3300005338 Bacteria 2582
31 Ga0068868_100156709 3300005338 Bacteria 1878
32 Ga0070660_100069075 3300005339 Bacteria 2754
33 Ga0070689_100261257 3300005340 Bacteria 1431
34 Ga0070668_100178570 3300005347 Bacteria 1733
35 Ga0070667_100017830 3300005367 Bacteria 5884
36 Ga0070681_10055399 3300005458 Bacteria 3948
37 Ga0068867_100041715 3300005459 Bacteria 3353
38 Ga0070679_100373840 3300005530 Bacteria 1372
39 Ga0070672_100003036 3300005543 Bacteria 10812
40 Ga0070672_100222207 3300005543 Bacteria 1584
41 Ga0070665_100056703 3300005548 Bacteria 3928
42 Ga0068855_100472448 3300005563 Bacteria 1366
43 Ga0070664_100185334 3300005564 Bacteria 1852
44 Ga0068857_100025537 3300005577 Bacteria 5201
45 Ga0068859_100243172 3300005617 Bacteria 1889
46 Ga0068864_100017717 3300005618 Bacteria 5941
47 Ga0068851_10004172 3300005834 Bacteria 6508
48 Ga0068860_100026265 3300005843 Bacteria 5614
49 Ga0081539_10004645 3300005985 Bacteria 14951
50 Ga0075364_10000394 3300006051 Bacteria 21776
51 Ga0097620_100243165 3300006931 Bacteria 1889
52 Ga0105251_10004231 3300009011 Bacteria 9915
53 Ga0105240_10049198 3300009093 Bacteria 5322
54 Ga0105240_10145433 3300009093 Bacteria 2829
55 Ga0105245_10061098 3300009098 Bacteria 3396
56 Ga0105245_10214599 3300009098 Bacteria 1854
57 Ga0105243_10073540 3300009148 Bacteria 2770
58 Ga0105241_10013807 3300009174 Bacteria 5916
59 Ga0105248_10003195 3300009177 Bacteria 18164
60 Ga0105248_10445646 3300009177 Bacteria 1459
61 Ga0105237_10209053 3300009545 Bacteria 1951
62 Ga0105239_10166927 3300010375 Bacteria 2462
63 Ga0105246_10025196 3300011119 Bacteria 3876
64 Ga0157373_10034813 3300013100 Bacteria 3617
65 Ga0157373_10070785 3300013100 Bacteria 2465
66 Ga0157371_10006018 3300013102 Bacteria 10107
67 Ga0157371_10023298 3300013102 Bacteria 4527
68 Ga0157371_10042010 3300013102 Bacteria 3260
69 Ga0157371_10160008 3300013102 Bacteria 1608
70 Ga0157370_10012478 3300013104 Bacteria 8806
71 Ga0157370_10100406 3300013104 Bacteria 2711
72 Ga0157370_10256586 3300013104 Bacteria 1616
73 Ga0157369_10096995 3300013105 Bacteria 3145
74 Ga0157369_10233117 3300013105 Bacteria 1924
75 Ga0157375_10000833 3300013308 Bacteria 26970
76 Ga0157380_10276055 3300014326 Bacteria 1535
77 Ga0182008_10000031 3300014497 Bacteria 166109
78 Ga0182008_10023283 3300014497 Bacteria 3165
79 Ga0182006_1006787 3300015261 Bacteria 5283
80 Ga0182006_1009483 3300015261 Bacteria 4360
81 Ga0182007_10000146 3300015262 Bacteria 47649
82 Ga0182005_1001314 3300015265 Bacteria 10175
83 Ga0183360_10002 3300015689 Bacteria 953821
84 Ga0163161_10031912 3300017792 Bacteria 3757
85 Ga0163161_10138735 3300017792 Bacteria 1840
86 Ga0207425_1001134 3300025245 Bacteria 12001
87 Ga0209565_1000002 3300025263 Bacteria 1423083
88 Ga0209565_1000033 3300025263 Bacteria 313960
89 Ga0209565_1008133 3300025263 Bacteria 2767
90 Ga0209673_1000002 3300025273 Bacteria 1423083
91 Ga0209673_1000062 3300025273 Bacteria 260727
92 Ga0209675_1000002 3300025291 Bacteria 1423083
93 Ga0209675_1000018 3300025291 Bacteria 377481
94 Ga0209675_1005200 3300025291 Bacteria 5514
95 Ga0209675_1014935 3300025291 Bacteria 2334
96 Ga0209676_1000095 3300025292 Bacteria 245393
97 Ga0209676_1000447 3300025292 Bacteria 70070
98 Ga0209676_1000550 3300025292 Bacteria 57330
99 Ga0209676_1000965 3300025292 Bacteria 34702
100 Ga0209676_1004854 3300025292 Bacteria 7286
101 Ga0209676_1019904 3300025292 Bacteria 2296
102 Ga0209676_1035186 3300025292 Bacteria 1471
103 Ga0209025_1000069 3300025294 Bacteria 290193
104 Ga0209025_1003054 3300025294 Bacteria 16481
105 Ga0209025_1006642 3300025294 Bacteria 8896
106 Ga0209025_1044280 3300025294 Bacteria 1863
107 Ga0209564_1000004 3300025295 Bacteria 1424639
108 Ga0209564_1002157 3300025295 Bacteria 16594
109 Ga0209564_1007528 3300025295 Bacteria 5609
110 Ga0209758_1051769 3300025297 Bacteria 1426
111 Ga0209050_1000158 3300025298 Bacteria 157468
112 Ga0209050_1000354 3300025298 Bacteria 88429
113 Ga0209050_1000621 3300025298 Bacteria 55657
114 Ga0209050_1029181 3300025298 Bacteria 1771
115 Ga0209256_1000004 3300025299 Bacteria 1424643
116 Ga0209256_1001671 3300025299 Bacteria 21532
117 Ga0209256_1001679 3300025299 Bacteria 21456
118 Ga0209256_1001946 3300025299 Bacteria 18753
119 Ga0209256_1014208 3300025299 Bacteria 2886
120 Ga0209256_1015689 3300025299 Bacteria 2633
121 Ga0209051_1006831 3300025303 Bacteria 6349
122 Ga0209051_1015753 3300025303 Bacteria 3463
123 Ga0209257_1000661 3300025304 Bacteria 54183
124 Ga0209257_1000718 3300025304 Bacteria 50885
125 Ga0209257_1001345 3300025304 Bacteria 29806
126 Ga0209257_1001597 3300025304 Bacteria 25962
127 Ga0209257_1001939 3300025304 Bacteria 22332
128 Ga0209257_1002693 3300025304 Bacteria 16983
129 Ga0209257_1005887 3300025304 Bacteria 8271
130 Ga0209257_1022517 3300025304 Bacteria 2245
131 Ga0207713_1000174 3300025735 Bacteria 92805
132 Ga0207647_10002046 3300025904 Bacteria 15407
133 Ga0207695_10013720 3300025913 Bacteria 9641
134 Ga0207671_10075793 3300025914 Bacteria 2516
135 Ga0207657_10000326 3300025919 Bacteria 50694
136 Ga0207657_10022452 3300025919 Bacteria 5901
137 Ga0207681_10069797 3300025923 Bacteria 2445
138 Ga0207687_10056958 3300025927 Bacteria 2743
139 Ga0207644_10006274 3300025931 Bacteria 7745
140 Ga0207709_10001536 3300025935 Bacteria 15851
141 Ga0207670_10270400 3300025936 Bacteria 1321
142 Ga0207691_10001199 3300025940 Bacteria 25800
143 Ga0207691_10010798 3300025940 Bacteria 8765
144 Ga0207711_10005510 3300025941 Bacteria 10704
145 Ga0207689_10036165 3300025942 Bacteria 4100
146 Ga0207667_10075523 3300025949 Bacteria 3499
147 Ga0207667_10523317 3300025949 Bacteria 1201
148 Ga0207668_10004877 3300025972 Bacteria 7894
149 Ga0207648_10125198 3300026089 Bacteria 2260
150 Ga0207674_10002111 3300026116 Bacteria 25147
151 Ga0207674_10144837 3300026116 Bacteria 2334
152 Ga0209371_1000031 3300027312 Bacteria 399263
153 Ga0268266_10021210 3300028379 Bacteria 5534
154 Ga0268264_10066627 3300028381 Bacteria 3037
155 Ga0268256_1000034 3300030500 Bacteria 398909
156 Ga0316176_1200030 3300030732 Bacteria 5643
157 Ga0316181_1213093 3300030744 Bacteria 3507
158 Ga0265330_10036182 3300031235 Bacteria 2201
159 Ga0265340_10037754 3300031247 Bacteria 2392
160 Ga0307408_100006147 3300031548 Bacteria 7971
161 Ga0307516_10056959 3300031730 Bacteria 3809
162 Ga0307516_10166557 3300031730 Bacteria 1948
163 Ga0307405_10390706 3300031731 Bacteria 1086
164 Ga0307413_10000323 3300031824 Bacteria 14943
165 Ga0307413_10001866 3300031824 Bacteria 8317
166 Ga0307410_10287643 3300031852 Bacteria 1292
167 Ga0307406_10001694 3300031901 Bacteria 12109
168 Ga0307406_10175282 3300031901 Bacteria 1556
169 Ga0307412_10002257 3300031911 Bacteria 10679
170 Ga0307409_100453075 3300031995 Bacteria 1239
171 Ga0307414_10000787 3300032004 Bacteria 16186
172 Ga0307414_10001019 3300032004 Bacteria 14310
173 Ga0307414_10087118 3300032004 Bacteria 2306
174 Ga0307414_10215509 3300032004 Bacteria 1572
175 Ga0307414_10264138 3300032004 Bacteria 1438
176 Ga0307411_10102181 3300032005 Bacteria 2031
177 Ga0395899_0033437 3300037312 Bacteria 3862
178 Ga0395900_0142944 3300037418 Bacteria 2449
179 Ga0395905_0020204 3300037471 Bacteria 6309
180 Ga0395905_0064438 3300037471 Bacteria 3429
181 Ga0395901_0155821 3300038443 Bacteria 2399
182 Ga0237819_02486 3300038705 Bacteria 3685
183 Ga0439436_0024038 3300041404 Bacteria 1800
184 Ga0439439_0010151 3300041406 Bacteria 2249
185 Ga0439466_0052991 3300041411 Bacteria 1325
186 Ga0451795_1638724 3300041456 Bacteria 1200
187 Ga0451837_0376744 3300041494 Bacteria 1449
188 Ga0451837_0824651 3300041494 Bacteria 4769
189 Ga0439432_043313 3300042006 Bacteria 1421
190 Ga0439449_0004128 3300042007 Bacteria 5618
191 Ga0439449_0007754 3300042007 Bacteria 4075
192 Ga0439449_0024073 3300042007 Bacteria 2277
193 Ga0439452_029805 3300042010 Bacteria 1351
194 Ga0439462_0005277 3300042015 Bacteria 3184
195 Ga0450898_012372 3300042134 Bacteria 1409
196 Ga0450905_005797 3300042142 Bacteria 1658
197 Ga0451577_0002222 3300042876 Bacteria 23618
198 Ga0451577_0346619 3300042876 Bacteria 1347
199 Ga0453683_0083483 3300044673 Bacteria 2002
200 Ga0453684_0000583 3300044712 Bacteria 135940
201 Ga0451576_0000137 3300045051 Bacteria 185212
202 Ga0466967_0285394 3300045976 Bacteria 1585
203 Ga0495627_038517 3300046453 Bacteria 1477
204 Ga0495638_0002323 3300046460 Bacteria 15658
205 Ga0495605_0096071 3300046474 Bacteria 1367
206 Ga0495610_0002649 3300046512 Bacteria 14787
207 Ga0495616_0036247 3300046513 Bacteria 2546
208 Ga0495631_0001465 3300046518 Bacteria 14310
209 Ga0495643_0000363 3300046522 Bacteria 61710
210 Ga0495663_0002399 3300046525 Bacteria 5633
211 Ga0495663_0002614 3300046525 Bacteria 5367
212 Ga0495663_0051845 3300046525 Bacteria 1272
213 Ga0495598_0003258 3300046537 Bacteria 3430
214 Ga0495621_0014162 3300046539 Bacteria 2518
215 Ga0495633_0004210 3300046558 Bacteria 9220
216 Ga0495656_0003388 3300046615 Bacteria 5389
217 Ga0495656_0004125 3300046615 Bacteria 4950
218 Ga0495656_0066534 3300046615 Bacteria 1588
219 Ga0495668_0008433 3300046616 Bacteria 6441
220 Ga0495668_0009958 3300046616 Bacteria 5793
221 Ga0495625_0024760 3300046660 Bacteria 4561
222 Ga0495660_0023709 3300046810 Bacteria 3500
223 Ga0495636_0012927 3300047318 Bacteria 3308
224 Ga0495672_0000330 3300047320 Bacteria 62176
225 Ga0495672_0092579 3300047320 Bacteria 1657
226 Ga0495685_019854 3300047447 Bacteria 2310
227 Ga0496100_0009741 3300048903 Bacteria 5409
228 Ga0496102_0224117 3300048905 Bacteria 1773
229 Ga0496108_0211294 3300048911 Bacteria 1685
230 Ga0496109_0020315 3300048912 Bacteria 5866
231 Ga0496111_0248464 3300048914 Bacteria 1320
232 Ga0496113_0251469 3300048916 Bacteria 1411
233 Ga0496116_0005577 3300048919 Bacteria 11607
234 Ga0496116_0007440 3300048919 Bacteria 9716
235 Ga0496116_0019510 3300048919 Bacteria 5190
236 Ga0496116_0123996 3300048919 Bacteria 1488
237 Ga0496117_0004667 3300048920 Bacteria 14892
238 Ga0496117_0006385 3300048920 Bacteria 11963
239 Ga0496117_0015802 3300048920 Bacteria 6405
240 Ga0496118_0003611 3300048921 Bacteria 19224
241 Ga0496118_0005140 3300048921 Bacteria 15011
242 Ga0496118_0007132 3300048921 Bacteria 11982
243 Ga0496118_0012476 3300048921 Bacteria 8151
244 Ga0496118_0038545 3300048921 Bacteria 3828
245 Ga0496119_0000351 3300048922 Bacteria 64668
246 Ga0496120_0000512 3300048923 Bacteria 60483
247 Ga0496121_0000400 3300048924 Bacteria 86667
248 Ga0496121_0013433 3300048924 Bacteria 8796
249 Ga0496121_0017502 3300048924 Bacteria 7314
250 Ga0496121_0021817 3300048924 Bacteria 6253
251 Ga0496121_0052748 3300048924 Bacteria 3411
252 Ga0496122_0000144 3300048925 Bacteria 166503
253 Ga0496122_0006995 3300048925 Bacteria 12695
254 Ga0496122_0012644 3300048925 Bacteria 8370
255 Ga0496122_0022692 3300048925 Bacteria 5570
256 Ga0496123_0000205 3300048926 Bacteria 120918
257 Ga0496123_0007005 3300048926 Bacteria 10751
258 Ga0496123_0015727 3300048926 Bacteria 6189
259 Ga0496123_0132172 3300048926 Bacteria 1380
260 Ga0496124_0000022 3300048927 Bacteria 421020
261 Ga0496124_0000282 3300048927 Bacteria 96697
262 Ga0496124_0009145 3300048927 Bacteria 10231
263 Ga0496124_0012089 3300048927 Bacteria 8567
264 Ga0496124_0012446 3300048927 Bacteria 8398
265 Ga0496124_0019829 3300048927 Bacteria 6240
266 Ga0496124_0024516 3300048927 Bacteria 5481
267 Ga0496124_0042233 3300048927 Bacteria 3927
268 Ga0496124_0091083 3300048927 Bacteria 2485
269 Ga0496125_0010551 3300048928 Bacteria 9339
270 Ga0496125_0014711 3300048928 Bacteria 7604
271 Ga0496125_0022652 3300048928 Bacteria 5826
272 Ga0496125_0059515 3300048928 Bacteria 3077
273 Ga0496126_0000590 3300048929 Bacteria 68750
274 Ga0501031_0032039 3300049568 Bacteria 3428
275 Ga0501031_0105032 3300049568 Bacteria 1843
276 Ga0501031_0186871 3300049568 Bacteria 1353
277 Ga0501033_0000266 3300049570 Bacteria 50261
278 Ga0501034_0000515 3300049571 Bacteria 62133
279 Ga0501034_0303942 3300049571 Bacteria 1531
280 Ga0501035_0016953 3300049822 Bacteria 6714
281 Ga0501035_0109608 3300049822 Bacteria 2420
282 nmdc:mga00v17_2423_c1 3300050491 Bacteria 9536
283 Ga0500634_0001330 3300053161 Bacteria 9462
284 2525557534 2524614729 Bacteria 3091755
285 2547499762 2547132130 Bacteria 4660562
286 2572255687 2571042365 Bacteria 3289345
287 2578460212 2576861471 Bacteria 4648976
288 2630649125 2627854209 Bacteria 3093011
289 2643817188 2643221559 Bacteria 4424915
290 2643879774 2643221573 Bacteria 4784121
291 2643939686 2643221586 Bacteria 4446529
292 2643976425 2643221593 Bacteria 6296053
293 2644080553 2643221612 Bacteria 4361984
294 2644530792 2643221695 Bacteria 3441323
295 2644663225 2643221720 Bacteria 4694283
296 2644696661 2643221727 Bacteria 4415595
297 2644701028 2643221728 Bacteria 4797149
298 2747947539 2747842428 Bacteria 4689383
299 2765577082 2765235840 Bacteria 4663337
300 2816519709 2816332141 Bacteria 4436036
301 2842393345 2842391507 Bacteria 4486072
302 2842760273 2842757796 Bacteria 3981385
303 2842783006 2842780639 Bacteria 4337790
304 2852652720 2852649853 Bacteria 4036942
305 2857443518 2857442823 Bacteria 4562550
306 2874224001 2874220319 Bacteria 4594709
307 2895502999 2895498888 Bacteria 5283788
308 2895513038 2895511927 Bacteria 6802080
309 2895523050 2895522137 Bacteria 3284416
310 2895526946 2895525241 Bacteria 3388457
311 2919090056 2919089067 Bacteria 4560942
312 2919138588 2919134579 Bacteria 4480386
313 2928498026 2928496128 Bacteria 4631123
314 2931382620 2931380184 Bacteria 4455911
315 2937613512 2937610967 Bacteria 4618818
316 2939592705 2939589442 Bacteria 4214238
317 2939623350 2939622612 Bacteria 4698046
318 2939628038 2939626828 Bacteria 4695272
319 2941479276 2941475908 Bacteria 4145589
320 2941493518 2941489479 Bacteria 6313767
321 2961050765 2961047084 Bacteria 4594415
322 2961068008 2961064222 Bacteria 4749990
323 2974310640 2974307012 Bacteria 4172388
324 2977251387 2977247770 Bacteria 4160543
325 2984517986 2984514374 Bacteria 4172479
326 2987605477 2987605356 Bacteria 4187822
327 2995949109 2995948881 Bacteria 6358104
328 8003017260 8003014200 Bacteria 4059994
329 Ga0157373_10081851
330 JGI25151J46595_10000856
331 rootH2_10016307
332 Ga0055526_1000197
333 Ga0055537_1000054
334 Ga0055537_1000151
335 Ga0055524_1000269
336 Ga0055524_1017005
337 Ga0055524_1022307
338 Ga0055536_1000760
339 Ga0055536_1011665
340 Ga0055534_1000148
341 Ga0055534_1000188
342 Ga0055534_1000360
343 Ga0055528_1000192
344 Ga0055528_1000799
345 Ga0055530_10001643
346 Ga0055530_10003495
347 Ga0055540_1019028
348 Ga0055531_10001475
349 Ga0055531_10004030
350 Ga0055531_10006066
351 Ga0055531_10021284
352 Ga0058692_1000005
353 Ga0070658_10066288
354 Ga0070690_100089665
355 Ga0070677_10043937
356 Ga0068869_100044127
357 Ga0070666_10056951
358 Ga0068868_100082281
359 Ga0068868_100156709
360 Ga0070660_100069075
361 Ga0070689_100261257
362 Ga0070668_100178570
363 Ga0070667_100017830
364 Ga0070681_10055399
365 Ga0068867_100041715
366 Ga0070679_100373840
367 Ga0070672_100003036
368 Ga0070672_100222207
369 Ga0070665_100056703
370 Ga0068855_100472448
371 Ga0070664_100185334
372 Ga0068857_100025537
373 Ga0068859_100243172
374 Ga0068864_100017717
375 Ga0068851_10004172
376 Ga0068860_100026265
377 Ga0081539_10004645
378 Ga0075364_10000394
379 Ga0097620_100243165
380 Ga0105251_10004231
381 Ga0105240_10049198
382 Ga0105240_10145433
383 Ga0105245_10061098
384 Ga0105245_10214599
385 Ga0105243_10073540
386 Ga0105241_10013807
387 Ga0105248_10003195
388 Ga0105248_10445646
389 Ga0105237_10209053
390 Ga0105239_10166927
391 Ga0105246_10025196
392 Ga0157373_10034813
393 Ga0157373_10070785
394 Ga0157371_10006018
395 Ga0157371_10023298
396 Ga0157371_10042010
397 Ga0157371_10160008
398 Ga0157370_10012478
399 Ga0157370_10100406
400 Ga0157370_10256586
401 Ga0157369_10096995
402 Ga0157369_10233117
403 Ga0157375_10000833
404 Ga0157380_10276055
405 Ga0182008_10000031
406 Ga0182008_10023283
407 Ga0182006_1006787
408 Ga0182006_1009483
409 Ga0182007_10000146
410 Ga0182005_1001314
411 Ga0183360_10002
412 Ga0163161_10031912
413 Ga0163161_10138735
414 Ga0207425_1001134
415 Ga0209565_1000002
416 Ga0209565_1000033
417 Ga0209565_1008133
418 Ga0209673_1000002
419 Ga0209673_1000062
420 Ga0209675_1000002
421 Ga0209675_1000018
422 Ga0209675_1005200
423 Ga0209675_1014935
424 Ga0209676_1000095
425 Ga0209676_1000447
426 Ga0209676_1000550
427 Ga0209676_1000965
428 Ga0209676_1004854
429 Ga0209676_1019904
430 Ga0209676_1035186
431 Ga0209025_1000069
432 Ga0209025_1003054
433 Ga0209025_1006642
434 Ga0209025_1044280
435 Ga0209564_1000004
436 Ga0209564_1002157
437 Ga0209564_1007528
438 Ga0209758_1051769
439 Ga0209050_1000158
440 Ga0209050_1000354
441 Ga0209050_1000621
442 Ga0209050_1029181
443 Ga0209256_1000004
444 Ga0209256_1001671
445 Ga0209256_1001679
446 Ga0209256_1001946
447 Ga0209256_1014208
448 Ga0209256_1015689
449 Ga0209051_1006831
450 Ga0209051_1015753
451 Ga0209257_1000661
452 Ga0209257_1000718
453 Ga0209257_1001345
454 Ga0209257_1001597
455 Ga0209257_1001939
456 Ga0209257_1002693
457 Ga0209257_1005887
458 Ga0209257_1022517
459 Ga0207713_1000174
460 Ga0207647_10002046
461 Ga0207695_10013720
462 Ga0207671_10075793
463 Ga0207657_10000326
464 Ga0207657_10022452
465 Ga0207681_10069797
466 Ga0207687_10056958
467 Ga0207644_10006274
468 Ga0207709_10001536
469 Ga0207670_10270400
470 Ga0207691_10001199
471 Ga0207691_10010798
472 Ga0207711_10005510
473 Ga0207689_10036165
474 Ga0207667_10075523
475 Ga0207667_10523317
476 Ga0207668_10004877
477 Ga0207648_10125198
478 Ga0207674_10002111
479 Ga0207674_10144837
480 Ga0209371_1000031
481 Ga0268266_10021210
482 Ga0268264_10066627
483 Ga0268256_1000034
484 Ga0316176_1200030
485 Ga0316181_1213093
486 Ga0265330_10036182
487 Ga0265340_10037754
488 Ga0307408_100006147
489 Ga0307516_10056959
490 Ga0307516_10166557
491 Ga0307405_10390706
492 Ga0307413_10000323
493 Ga0307413_10001866
494 Ga0307410_10287643
495 Ga0307406_10001694
496 Ga0307406_10175282
497 Ga0307412_10002257
498 Ga0307409_100453075
499 Ga0307414_10000787
500 Ga0307414_10001019
501 Ga0307414_10087118
502 Ga0307414_10215509
503 Ga0307414_10264138
504 Ga0307411_10102181
505 Ga0395899_0033437
506 Ga0395900_0142944
507 Ga0395905_0020204
508 Ga0395905_0064438
509 Ga0395901_0155821
510 Ga0237819_02486
511 Ga0439436_0024038
512 Ga0439439_0010151
513 Ga0439466_0052991
514 Ga0451795_1638724
515 Ga0451837_0376744
516 Ga0451837_0824651
517 Ga0439432_043313
518 Ga0439449_0004128
519 Ga0439449_0007754
520 Ga0439449_0024073
521 Ga0439452_029805
522 Ga0439462_0005277
523 Ga0450898_012372
524 Ga0450905_005797
525 Ga0451577_0002222
526 Ga0451577_0346619
527 Ga0453683_0083483
528 Ga0453684_0000583
529 Ga0451576_0000137
530 Ga0466967_0285394
531 Ga0495627_038517
532 Ga0495638_0002323
533 Ga0495605_0096071
534 Ga0495610_0002649
535 Ga0495616_0036247
536 Ga0495631_0001465
537 Ga0495643_0000363
538 Ga0495663_0002399
539 Ga0495663_0002614
540 Ga0495663_0051845
541 Ga0495598_0003258
542 Ga0495621_0014162
543 Ga0495633_0004210
544 Ga0495656_0003388
545 Ga0495656_0004125
546 Ga0495656_0066534
547 Ga0495668_0008433
548 Ga0495668_0009958
549 Ga0495625_0024760
550 Ga0495660_0023709
551 Ga0495636_0012927
552 Ga0495672_0000330
553 Ga0495672_0092579
554 Ga0495685_019854
555 Ga0496100_0009741
556 Ga0496102_0224117
557 Ga0496108_0211294
558 Ga0496109_0020315
559 Ga0496111_0248464
560 Ga0496113_0251469
561 Ga0496116_0005577
562 Ga0496116_0007440
563 Ga0496116_0019510
564 Ga0496116_0123996
565 Ga0496117_0004667
566 Ga0496117_0006385
567 Ga0496117_0015802
568 Ga0496118_0003611
569 Ga0496118_0005140
570 Ga0496118_0007132
571 Ga0496118_0012476
572 Ga0496118_0038545
573 Ga0496119_0000351
574 Ga0496120_0000512
575 Ga0496121_0000400
576 Ga0496121_0013433
577 Ga0496121_0017502
578 Ga0496121_0021817
579 Ga0496121_0052748
580 Ga0496122_0000144
581 Ga0496122_0006995
582 Ga0496122_0012644
583 Ga0496122_0022692
584 Ga0496123_0000205
585 Ga0496123_0007005
586 Ga0496123_0015727
587 Ga0496123_0132172
588 Ga0496124_0000022
589 Ga0496124_0000282
590 Ga0496124_0009145
591 Ga0496124_0012089
592 Ga0496124_0012446
593 Ga0496124_0019829
594 Ga0496124_0024516
595 Ga0496124_0042233
596 Ga0496124_0091083
597 Ga0496125_0010551
598 Ga0496125_0014711
599 Ga0496125_0022652
600 Ga0496125_0059515
601 Ga0496126_0000590
602 Ga0501031_0032039
603 Ga0501031_0105032
604 Ga0501031_0186871
605 Ga0501033_0000266
606 Ga0501034_0000515
607 Ga0501034_0303942
608 Ga0501035_0016953
609 Ga0501035_0109608
610 nmdc:mga00v17_2423_c1
611 Ga0500634_0001330
612 2525557534
613 2547499762
614 2572255687
615 2578460212
616 2630649125
617 2643817188
618 2643879774
619 2643939686
620 2643976425
621 2644080553
622 2644530792
623 2644663225
624 2644696661
625 2644701028
626 2747947539
627 2765577082
628 2816519709
629 2842393345
630 2842760273
631 2842783006
632 2852652720
633 2857443518
634 2874224001
635 2895502999
636 2895513038
637 2895523050
638 2895526946
639 2919090056
640 2919138588
641 2928498026
642 2931382620
643 2937613512
644 2939592705
645 2939623350
646 2939628038
647 2941479276
648 2941493518
649 2961050765
650 2961068008
651 2974310640
652 2977251387
653 2984517986
654 2987605477
655 2995949109
656 8003017260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

169

233

0.91

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

275

388

0.85

PF08448

PAS_4

PAS fold

57

159

0.66

Map