F409223

General Info

Members Datasets Scaffolds Average Seq Length
328 194 328 282

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10038746|Ga0114129_100387467
Length 256
Sequence VVSRAQAAGLAAIALTDHDTVAGVPAAVAAGERCGVRVVSGCEFSTAAPWGEMHVLGYFLPTDSPLLEAFLERRREDRVRRGRAMVDRLRGMGVTLDFEDVLRQARGAVGRPHVARAIVLSGGAAGMSEAFDRYIGRGRPAFVDKVLPTFGEVADVVHAVRGIVSLAHLKDRGTRSFLDRLKGQGLDALETRHPSHDPDTRARLTDIALALGLLRTGGSDWHGDPEPGESHGTIGSQEVPLEWLERLDQHRLCEVP

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
177 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.06
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10106576 3300005293 Unclassified 2821
2 Ga0070676_10004122 3300005328 Bacteria 7631
3 Ga0070690_100015188 3300005330 Bacteria 4588
4 Ga0070670_100058867 3300005331 Bacteria 3298
5 Ga0070677_10058555 3300005333 Bacteria 1582
6 Ga0068869_100007486 3300005334 Bacteria 6986
7 Ga0070680_100197933 3300005336 Unclassified 1694
8 Ga0070691_10059086 3300005341 Unclassified 1842
9 Ga0070675_100138902 3300005354 Bacteria 2075
10 Ga0070674_100002772 3300005356 Bacteria 9682
11 Ga0070673_100025416 3300005364 Bacteria 4359
12 Ga0070659_100035985 3300005366 Bacteria 3858
13 Ga0070701_10078036 3300005438 Unclassified 1786
14 Ga0070701_10089600 3300005438 Bacteria 1683
15 Ga0070705_100001551 3300005440 Bacteria 12038
16 Ga0070705_100003772 3300005440 Bacteria 7416
17 Ga0070705_100010233 3300005440 Bacteria 4688
18 Ga0070705_100024462 3300005440 Bacteria 3260
19 Ga0070700_100153182 3300005441 Unclassified 1579
20 Ga0070694_100008733 3300005444 Bacteria 6206
21 Ga0070694_100039668 3300005444 Unclassified 3136
22 Ga0070694_100187677 3300005444 Unclassified 1533
23 Ga0070694_100210585 3300005444 Bacteria 1453
24 Ga0070708_100000511 3300005445 Bacteria 29095
25 Ga0070708_100052601 3300005445 Bacteria 3612
26 Ga0070708_100089165 3300005445 Bacteria 2806
27 Ga0070663_100112215 3300005455 Unclassified 2050
28 Ga0070678_100083437 3300005456 Unclassified 2429
29 Ga0070662_100008256 3300005457 Bacteria 6780
30 Ga0070681_10366173 3300005458 Bacteria 1352
31 Ga0068867_100032774 3300005459 Bacteria 3759
32 Ga0070706_100003657 3300005467 Bacteria 15049
33 Ga0070707_100000581 3300005468 Bacteria 36780
34 Ga0070707_100001574 3300005468 Bacteria 22107
35 Ga0070707_100108920 3300005468 Bacteria 2687
36 Ga0070707_100335375 3300005468 Bacteria 1469
37 Ga0070707_100405080 3300005468 Unclassified 1324
38 Ga0070707_100504337 3300005468 Unclassified 1172
39 Ga0070698_100025160 3300005471 Bacteria 6203
40 Ga0070698_100318197 3300005471 Unclassified 1486
41 Ga0070698_100325076 3300005471 Unclassified 1469
42 Ga0070698_100326409 3300005471 Bacteria 1466
43 Ga0070699_100000727 3300005518 Bacteria 30549
44 Ga0070699_100004841 3300005518 Bacteria 11878
45 Ga0070699_100033955 3300005518 Bacteria 4408
46 Ga0070699_100091459 3300005518 Bacteria 2660
47 Ga0070699_100098594 3300005518 Bacteria 2561
48 Ga0070699_100120776 3300005518 Unclassified 2304
49 Ga0070679_100167441 3300005530 Bacteria 2170
50 Ga0070697_100005983 3300005536 Bacteria 9406
51 Ga0070697_100156453 3300005536 Bacteria 1924
52 Ga0070686_100078286 3300005544 Bacteria 2183
53 Ga0070695_100004874 3300005545 Bacteria 7901
54 Ga0070695_100012744 3300005545 Bacteria 5047
55 Ga0070696_100000228 3300005546 Bacteria 33916
56 Ga0070696_100002289 3300005546 Bacteria 12624
57 Ga0070696_100019623 3300005546 Unclassified 4580
58 Ga0070696_100019922 3300005546 Bacteria 4547
59 Ga0070696_100101324 3300005546 Bacteria 2064
60 Ga0070693_100061646 3300005547 Bacteria 2181
61 Ga0070704_100000999 3300005549 Bacteria 14435
62 Ga0070704_100009307 3300005549 Bacteria 5926
63 Ga0070704_100025252 3300005549 Bacteria 3909
64 Ga0070704_100074104 3300005549 Bacteria 2482
65 Ga0070704_100191342 3300005549 Bacteria 1645
66 Ga0070704_100278065 3300005549 Unclassified 1386
67 Ga0070664_100146690 3300005564 Bacteria 2081
68 Ga0068857_100251059 3300005577 Bacteria 1622
69 Ga0068854_100001930 3300005578 Bacteria 12643
70 Ga0070702_100014722 3300005615 Bacteria 3975
71 Ga0068859_100509364 3300005617 Unclassified 1299
72 Ga0068864_100029554 3300005618 Bacteria 4643
73 Ga0068866_10000165 3300005718 Bacteria 30640
74 Ga0068861_100457443 3300005719 Unclassified 1145
75 Ga0068870_10038040 3300005840 Unclassified 2483
76 Ga0068858_100092635 3300005842 Bacteria 2813
77 Ga0068860_100144242 3300005843 Bacteria 2290
78 Ga0081455_10089377 3300005937 Bacteria 2500
79 Ga0097621_100082643 3300006237 Unclassified 2675
80 Ga0068871_100060915 3300006358 Unclassified 3080
81 Ga0075430_100260736 3300006846 Unclassified 1435
82 Ga0075431_100170539 3300006847 Bacteria 2236
83 Ga0075431_100184048 3300006847 Bacteria 2143
84 Ga0075433_10020064 3300006852 Bacteria 5582
85 Ga0075433_10047107 3300006852 Bacteria 3750
86 Ga0075433_10322657 3300006852 Bacteria 1366
87 Ga0075434_100023725 3300006871 Bacteria 5984
88 Ga0075434_100027226 3300006871 Bacteria 5610
89 Ga0075434_100263730 3300006871 Unclassified 1742
90 Ga0075434_100271907 3300006871 Bacteria 1714
91 Ga0075429_100005168 3300006880 Bacteria 11222
92 Ga0075429_100048793 3300006880 Bacteria 3681
93 Ga0075429_100237285 3300006880 Bacteria 1597
94 Ga0068865_100001488 3300006881 Bacteria 13652
95 Ga0075436_100095248 3300006914 Bacteria 2071
96 Ga0097620_100509335 3300006931 Unclassified 1299
97 Ga0075435_100071596 3300007076 Bacteria 2831
98 Ga0075435_100217138 3300007076 Bacteria 1623
99 Ga0105240_10209172 3300009093 Bacteria 2281
100 Ga0114129_10000442 3300009147 Bacteria 49250
101 Ga0114129_10038746 3300009147 Bacteria 6720
102 Ga0114129_10084935 3300009147 Bacteria 4392
103 Ga0114129_10160475 3300009147 Bacteria 3072
104 Ga0114129_10342900 3300009147 Unclassified 1981
105 Ga0105243_10003787 3300009148 Bacteria 12105
106 Ga0105241_10006356 3300009174 Bacteria 8710
107 Ga0105242_10010817 3300009176 Bacteria 7005
108 Ga0105248_10027223 3300009177 Bacteria 6362
109 Ga0105249_10062862 3300009553 Unclassified 3409
110 Ga0105249_10101033 3300009553 Bacteria 2712
111 Ga0105249_10277243 3300009553 Unclassified 1673
112 Ga0105239_10009184 3300010375 Bacteria 11181
113 Ga0105246_10004556 3300011119 Bacteria 8435
114 Ga0157378_10013245 3300013297 Bacteria 7211
115 Ga0163162_10112913 3300013306 Unclassified 2816
116 Ga0163162_10235476 3300013306 Bacteria 1961
117 Ga0157372_10381045 3300013307 Bacteria 1643
118 Ga0163163_10121141 3300014325 Bacteria 2650
119 Ga0163163_10159492 3300014325 Unclassified 2301
120 Ga0157380_10055284 3300014326 Bacteria 3152
121 Ga0157379_10026519 3300014968 Bacteria 5159
122 Ga0157379_10086329 3300014968 Unclassified 2814
123 Ga0207682_10029222 3300025893 Bacteria 2204
124 Ga0207642_10004570 3300025899 Bacteria 4470
125 Ga0207645_10000654 3300025907 Bacteria 28792
126 Ga0207643_10007065 3300025908 Bacteria 6017
127 Ga0207684_10008479 3300025910 Bacteria 9143
128 Ga0207654_10085227 3300025911 Bacteria 1912
129 Ga0207707_10076094 3300025912 Bacteria 2929
130 Ga0207707_10104475 3300025912 Bacteria 2476
131 Ga0207663_10288656 3300025916 Bacteria 1221
132 Ga0207660_10038008 3300025917 Bacteria 3358
133 Ga0207660_10207282 3300025917 Unclassified 1534
134 Ga0207652_10032460 3300025921 Bacteria 4390
135 Ga0207646_10025599 3300025922 Bacteria 5397
136 Ga0207646_10036537 3300025922 Bacteria 4434
137 Ga0207646_10086350 3300025922 Unclassified 2807
138 Ga0207646_10191951 3300025922 Unclassified 1845
139 Ga0207646_10231397 3300025922 Unclassified 1670
140 Ga0207646_10511945 3300025922 Bacteria 1081
141 Ga0207650_10431191 3300025925 Bacteria 1095
142 Ga0207659_10104125 3300025926 Bacteria 2146
143 Ga0207690_10026069 3300025932 Bacteria 3679
144 Ga0207706_10000244 3300025933 Bacteria 59754
145 Ga0207686_10000739 3300025934 Bacteria 20216
146 Ga0207709_10023470 3300025935 Unclassified 3511
147 Ga0207669_10003993 3300025937 Bacteria 6448
148 Ga0207704_10003675 3300025938 Bacteria 6974
149 Ga0207711_10072315 3300025941 Bacteria 2996
150 Ga0207689_10004041 3300025942 Bacteria 13328
151 Ga0207651_10021551 3300025960 Unclassified 3920
152 Ga0207712_10009486 3300025961 Bacteria 6157
153 Ga0207712_10119831 3300025961 Bacteria 1989
154 Ga0207703_10041356 3300026035 Bacteria 3692
155 Ga0207703_10488345 3300026035 Bacteria 1155
156 Ga0207678_10139017 3300026067 Unclassified 2072
157 Ga0207678_10295969 3300026067 Unclassified 1390
158 Ga0207648_10000273 3300026089 Bacteria 56070
159 Ga0207676_10006035 3300026095 Bacteria 8543
160 Ga0207674_10427205 3300026116 Bacteria 1280
161 Ga0207675_100038542 3300026118 Bacteria 4460
162 Ga0207675_100261865 3300026118 Bacteria 1676
163 Ga0207683_10116333 3300026121 Unclassified 2397
164 Ga0268265_10036014 3300028380 Unclassified 3621
165 Ga0268264_10018693 3300028381 Bacteria 5665
166 Ga0307408_100062145 3300031548 Unclassified 2728
167 Ga0307408_100236707 3300031548 Unclassified 1498
168 Ga0307408_100401059 3300031548 Unclassified 1178
169 Ga0307405_10047034 3300031731 Unclassified 2655
170 Ga0307413_10063447 3300031824 Unclassified 2290
171 Ga0307413_10068322 3300031824 Bacteria 2225
172 Ga0307413_10136542 3300031824 Unclassified 1687
173 Ga0307410_10001254 3300031852 Bacteria 11302
174 Ga0307410_10015427 3300031852 Unclassified 4531
175 Ga0307406_10046628 3300031901 Unclassified 2728
176 Ga0307406_10093122 3300031901 Unclassified 2034
177 Ga0307407_10025855 3300031903 Unclassified 3100
178 Ga0307407_10074130 3300031903 Bacteria 2036
179 Ga0307412_10022403 3300031911 Bacteria 3872
180 Ga0307409_100012136 3300031995 Bacteria 5474
181 Ga0307409_100152617 3300031995 Bacteria 2008
182 Ga0307409_100161634 3300031995 Unclassified 1959
183 Ga0307409_100221683 3300031995 Bacteria 1708
184 Ga0307416_100008115 3300032002 Bacteria 6741
185 Ga0307416_100086655 3300032002 Bacteria 2670
186 Ga0307416_100141174 3300032002 Unclassified 2189
187 Ga0307416_100142569 3300032002 Bacteria 2181
188 Ga0307414_10037335 3300032004 Bacteria 3252
189 Ga0307414_10132073 3300032004 Unclassified 1940
190 Ga0307411_10002992 3300032005 Bacteria 7693
191 Ga0307411_10016005 3300032005 Bacteria 4234
192 Ga0307415_100001883 3300032126 Bacteria 10301
193 Ga0373958_0022684 3300034819 Unclassified 1175
194 Ga0373928_0027306 3300035084 Bacteria 1242
195 Ga0373940_0001948 3300035088 Bacteria 3896
196 Ga0373939_0055500 3300035114 Bacteria 1244
197 Ga0373931_0037664 3300035691 Bacteria 2525
198 Ga0451577_0013691 3300042876 Bacteria 7581
199 Ga0451577_0088374 3300042876 Unclassified 2765
200 Ga0453684_0118376 3300044712 Unclassified 3204
201 Ga0495603_0204463 3300046455 Bacteria 1141
202 Ga0495582_0010807 3300046473 Bacteria 5025
203 Ga0495639_0011941 3300046475 Bacteria 3746
204 Ga0495664_0207147 3300046477 Bacteria 1188
205 Ga0495594_0042348 3300046499 Bacteria 2494
206 Ga0495618_0151985 3300046514 Bacteria 1478
207 Ga0495630_0008140 3300046517 Bacteria 7531
208 Ga0495666_0022810 3300046526 Bacteria 3098
209 Ga0495640_0025831 3300046533 Bacteria 4253
210 Ga0495622_0070930 3300046557 Bacteria 1608
211 Ga0495634_0014438 3300046642 Bacteria 5694
212 Ga0495647_0002912 3300046681 Bacteria 5431
213 Ga0495658_0002240 3300046683 Bacteria 9781
214 Ga0495613_0051224 3300046689 Bacteria 3043
215 Ga0495624_0068538 3300046690 Bacteria 2211
216 Ga0495600_0146006 3300046809 Bacteria 1533
217 Ga0495674_0003564 3300047319 Bacteria 15136
218 Ga0495680_0047384 3300047322 Bacteria 3381
219 Ga0496101_0014898 3300048904 Bacteria 5232
220 Ga0496101_0026268 3300048904 Bacteria 4048
221 Ga0496101_0247208 3300048904 Unclassified 1389
222 Ga0496102_0001888 3300048905 Bacteria 18056
223 Ga0496102_0046661 3300048905 Bacteria 3935
224 Ga0496102_0142978 3300048905 Unclassified 2244
225 Ga0496102_0497995 3300048905 Unclassified 1140
226 Ga0496104_0002618 3300048907 Bacteria 15495
227 Ga0496104_0124338 3300048907 Unclassified 2476
228 Ga0496105_0002410 3300048908 Bacteria 13540
229 Ga0496106_0056922 3300048909 Bacteria 2956
230 Ga0496107_0121100 3300048910 Bacteria 1928
231 Ga0496107_0298769 3300048910 Unclassified 1198
232 Ga0496108_0006026 3300048911 Bacteria 9813
233 Ga0496108_0015227 3300048911 Bacteria 6275
234 Ga0496108_0121355 3300048911 Bacteria 2242
235 Ga0496108_0132598 3300048911 Unclassified 2141
236 Ga0496109_0001213 3300048912 Bacteria 21423
237 Ga0496109_0001371 3300048912 Bacteria 20198
238 Ga0496109_0024561 3300048912 Bacteria 5359
239 Ga0496110_0000477 3300048913 Bacteria 27148
240 Ga0496110_0053412 3300048913 Bacteria 3552
241 Ga0496110_0254457 3300048913 Unclassified 1599
242 Ga0496111_0001070 3300048914 Bacteria 15083
243 Ga0496111_0001192 3300048914 Bacteria 14498
244 Ga0496112_0019272 3300048915 Bacteria 6436
245 Ga0496112_0037511 3300048915 Bacteria 4729
246 Ga0496112_0167232 3300048915 Unclassified 2165
247 Ga0496112_0468808 3300048915 Unclassified 1196
248 Ga0496113_0009449 3300048916 Bacteria 6397
249 Ga0496113_0016472 3300048916 Bacteria 5107
250 Ga0496114_0362387 3300048917 Bacteria 1282
251 Ga0496115_0065813 3300048918 Bacteria 2928
252 Ga0501031_0157802 3300049568 Bacteria 1483
253 Ga0501031_0175599 3300049568 Unclassified 1400
254 Ga0501032_0263551 3300049569 Bacteria 1117
255 Ga0501036_0035368 3300049572 Bacteria 4228
256 Ga0501040_0011188 3300049576 Bacteria 5870
257 Ga0501040_0040331 3300049576 Bacteria 3177
258 Ga0501041_0018135 3300049577 Bacteria 4192
259 Ga0501041_0018913 3300049577 Bacteria 4104
260 Ga0501041_0095079 3300049577 Bacteria 1841
261 Ga0501046_0039359 3300049580 Bacteria 3787
262 Ga0501046_0048829 3300049580 Bacteria 3350
263 Ga0501046_0106245 3300049580 Bacteria 2149
264 Ga0501046_0320881 3300049580 Bacteria 1129
265 Ga0501048_0027834 3300049582 Bacteria 4105
266 Ga0501067_0015398 3300049583 Bacteria 4233
267 Ga0501067_0138200 3300049583 Bacteria 1356
268 Ga0501069_0119943 3300049585 Bacteria 1502
269 Ga0501070_0226927 3300049586 Bacteria 1531
270 Ga0501071_0040336 3300049587 Bacteria 3341
271 Ga0501071_0057396 3300049587 Bacteria 2813
272 Ga0501072_0058337 3300049588 Bacteria 3042
273 Ga0501075_0001433 3300049591 Bacteria 15505
274 Ga0501075_0015849 3300049591 Bacteria 5421
275 Ga0501076_0029336 3300049592 Bacteria 4278
276 Ga0501076_0045312 3300049592 Bacteria 3472
277 Ga0501076_0558546 3300049592 Unclassified 944
278 Ga0501077_0003991 3300049593 Bacteria 8904
279 Ga0501077_0023693 3300049593 Bacteria 3892
280 Ga0501077_0037912 3300049593 Bacteria 3069
281 Ga0501247_001263 3300049677 Unclassified 2381
282 Ga0501221_002832 3300049704 Bacteria 2856
283 Ga0501234_011486 3300049707 Unclassified 1385
284 Ga0501079_0006582 3300049741 Bacteria 8739
285 Ga0501079_0007243 3300049741 Bacteria 8373
286 Ga0501079_0082737 3300049741 Bacteria 2483
287 Ga0501079_0158219 3300049741 Unclassified 1766
288 Ga0501079_0170862 3300049741 Unclassified 1695
289 Ga0501080_0069384 3300049742 Bacteria 3278
290 Ga0501080_0111426 3300049742 Bacteria 2537
291 Ga0501080_0185517 3300049742 Bacteria 1913
292 Ga0501080_0234907 3300049742 Bacteria 1675
293 Ga0501081_0003935 3300049743 Bacteria 9521
294 Ga0501081_0025510 3300049743 Bacteria 3976
295 Ga0501081_0032766 3300049743 Bacteria 3527
296 Ga0501268_000345 3300049765 Bacteria 4822
297 Ga0501272_003141 3300049769 Unclassified 1667
298 Ga0501035_0060420 3300049822 Bacteria 3374
299 Ga0501045_0032122 3300049824 Bacteria 3803
300 Ga0501045_0149060 3300049824 Bacteria 1740
301 nmdc:mga05p37_178553_c1 3300050507 Bacteria 2585
302 nmdc:mga05p37_558_c1 3300050507 Bacteria 40956
303 nmdc:mga05p37_85700_c1 3300050507 Unclassified 3882
304 nmdc:mga09592_10838_c1 3300050508 Bacteria 7417
305 nmdc:mga09592_56824_c1 3300050508 Bacteria 3307
306 nmdc:mga0qj67_89905_c1 3300050509 Bacteria 2466
307 nmdc:mga06r32_65391_c1 3300050510 Bacteria 3507
308 nmdc:mga0n895_152917_c1 3300050512 Bacteria 2338
309 nmdc:mga0n895_25277_c1 3300050512 Bacteria 5609
310 nmdc:mga0n895_275806_c1 3300050512 Unclassified 1705
311 nmdc:mga0rr50_318192_c1 3300050513 Bacteria 1304
312 nmdc:mga0rr50_50624_c1 3300050513 Bacteria 3078
313 nmdc:mga08x19_181553_c1 3300050514 Bacteria 1437
314 nmdc:mga0a205_104716_c1 3300050515 Unclassified 2728
315 nmdc:mga0a205_19285_c1 3300050515 Bacteria 6427
316 Ga0501084_0146658 3300054114 Bacteria 1988
317 Ga0590071_000173 3300059421 Bacteria 18614
318 Ga0590074_003758 3300059423 Bacteria 2514
319 Ga0590074_020800 3300059423 Unclassified 1130
320 Ga0590075_021046 3300059424 Bacteria 1625
321 Ga0590077_023457 3300059426 Unclassified 1321
322 Ga0501082_0010946 3300060353 Bacteria 7807
323 Ga0501082_0051635 3300060353 Bacteria 3544
324 Ga0501082_0106776 3300060353 Bacteria 2422
325 Ga0501082_0147934 3300060353 Unclassified 2040
326 Ga0501082_0554767 3300060353 Bacteria 1005
327 Ga0530510_0074758 3300061734 Bacteria 2460
328 Ga0530510_0453125 3300061734 Bacteria 970

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0298769 Ga0496107_0298769_19_768 248
2 3300009147 Ga0114129_10342900 Ga0114129_103429004 250
3 3300049569 Ga0501032_0263551 Ga0501032_0263551_294_1049 251
4 3300005518 Ga0070699_100091459 Ga0070699_1000914594 252
5 3300006871 Ga0075434_100023725 Ga0075434_1000237257 252
6 3300050512 nmdc:mga0n895_152917_c1 nmdc:mga0n895_152917_c1_1169_1933 252
7 3300005441 Ga0070700_100153182 Ga0070700_1001531823 253
8 3300005549 Ga0070704_100278065 Ga0070704_1002780653 253
9 3300025922 Ga0207646_10036537 Ga0207646_100365373 253
10 3300005438 Ga0070701_10078036 Ga0070701_100780363 255
11 3300005445 Ga0070708_100089165 Ga0070708_1000891651 255
12 3300005468 Ga0070707_100000581 Ga0070707_10000058123 255
13 3300005468 Ga0070707_100108920 Ga0070707_1001089203 255
14 3300005468 Ga0070707_100405080 Ga0070707_1004050801 255
15 3300005471 Ga0070698_100325076 Ga0070698_1003250762 255
16 3300005518 Ga0070699_100000727 Ga0070699_1000007271 255
17 3300005617 Ga0068859_100509364 Ga0068859_1005093642 255
18 3300005719 Ga0068861_100457443 Ga0068861_1004574432 255
19 3300006847 Ga0075431_100184048 Ga0075431_1001840482 255
20 3300006880 Ga0075429_100048793 Ga0075429_1000487932 255
21 3300006931 Ga0097620_100509335 Ga0097620_1005093352 255
22 3300025922 Ga0207646_10086350 Ga0207646_100863503 255
23 3300025922 Ga0207646_10191951 Ga0207646_101919512 255
24 3300025922 Ga0207646_10231397 Ga0207646_102313972 255
25 3300005549 Ga0070704_100025252 Ga0070704_1000252524 256
26 3300009147 Ga0114129_10038746 Ga0114129_100387467 256
27 3300009553 Ga0105249_10277243 Ga0105249_102772433 256
28 3300049568 Ga0501031_0175599 Ga0501031_0175599_221_991 256
29 3300049580 Ga0501046_0048829 Ga0501046_0048829_1863_2633 256
30 3300049587 Ga0501071_0040336 Ga0501071_0040336_2175_2945 256
31 3300050508 nmdc:mga09592_10838_c1 nmdc:mga09592_10838_c1_6299_7078 256
32 3300050510 nmdc:mga06r32_65391_c1 nmdc:mga06r32_65391_c1_10_789 256
33 3300060353 Ga0501082_0106776 Ga0501082_0106776_684_1454 256
34 3300009147 Ga0114129_10160475 Ga0114129_101604754 257
35 3300049576 Ga0501040_0011188 Ga0501040_0011188_2564_3337 257
36 3300049577 Ga0501041_0018913 Ga0501041_0018913_1345_2118 257
37 3300049577 Ga0501041_0095079 Ga0501041_0095079_606_1379 257
38 3300049580 Ga0501046_0106245 Ga0501046_0106245_590_1363 257
39 3300049580 Ga0501046_0320881 Ga0501046_0320881_301_1074 257
40 3300049587 Ga0501071_0057396 Ga0501071_0057396_207_980 257
41 3300049588 Ga0501072_0058337 Ga0501072_0058337_1033_1806 257
42 3300049591 Ga0501075_0001433 Ga0501075_0001433_13388_14161 257
43 3300049591 Ga0501075_0015849 Ga0501075_0015849_2956_3729 257
44 3300049592 Ga0501076_0045312 Ga0501076_0045312_1360_2133 257
45 3300049593 Ga0501077_0003991 Ga0501077_0003991_5060_5833 257
46 3300049593 Ga0501077_0023693 Ga0501077_0023693_2049_2822 257
47 3300049741 Ga0501079_0006582 Ga0501079_0006582_7341_8114 257
48 3300049742 Ga0501080_0234907 Ga0501080_0234907_163_936 257
49 3300049743 Ga0501081_0003935 Ga0501081_0003935_7341_8114 257
50 3300049743 Ga0501081_0025510 Ga0501081_0025510_1100_1873 257
51 3300049822 Ga0501035_0060420 Ga0501035_0060420_2452_3225 257
52 3300049824 Ga0501045_0149060 Ga0501045_0149060_143_916 257
53 3300050507 nmdc:mga05p37_178553_c1 nmdc:mga05p37_178553_c1_974_1747 257
54 3300059421 Ga0590071_000173 Ga0590071_000173_7643_8416 257
55 3300059423 Ga0590074_003758 Ga0590074_003758_1439_2212 257
56 3300059424 Ga0590075_021046 Ga0590075_021046_372_1145 257
57 3300061734 Ga0530510_0453125 Ga0530510_0453125_59_832 257
58 3300049592 Ga0501076_0558546 Ga0501076_0558546_134_910 258
59 3300049741 Ga0501079_0170862 Ga0501079_0170862_21_797 258
60 3300049742 Ga0501080_0185517 Ga0501080_0185517_101_877 258
61 3300006880 Ga0075429_100005168 Ga0075429_1000051686 259
62 3300031901 Ga0307406_10046628 Ga0307406_100466284 259
63 3300031903 Ga0307407_10074130 Ga0307407_100741303 259
64 3300049572 Ga0501036_0035368 Ga0501036_0035368_1432_2217 259
65 3300049576 Ga0501040_0040331 Ga0501040_0040331_2215_3000 259
66 3300049577 Ga0501041_0018135 Ga0501041_0018135_1129_1914 259
67 3300049580 Ga0501046_0039359 Ga0501046_0039359_2256_3041 259
68 3300049582 Ga0501048_0027834 Ga0501048_0027834_3068_3853 259
69 3300049592 Ga0501076_0029336 Ga0501076_0029336_1859_2644 259
70 3300049593 Ga0501077_0037912 Ga0501077_0037912_1799_2584 259
71 3300049741 Ga0501079_0007243 Ga0501079_0007243_1771_2556 259
72 3300049742 Ga0501080_0069384 Ga0501080_0069384_104_889 259
73 3300049743 Ga0501081_0032766 Ga0501081_0032766_2263_3048 259
74 3300049824 Ga0501045_0032122 Ga0501045_0032122_1440_2225 259
75 3300050508 nmdc:mga09592_56824_c1 nmdc:mga09592_56824_c1_1415_2200 259
76 3300060353 Ga0501082_0010946 Ga0501082_0010946_6653_7438 259
77 3300061734 Ga0530510_0074758 Ga0530510_0074758_500_1285 259
78 3300025912 Ga0207707_10104475 Ga0207707_101044754 260
79 3300031824 Ga0307413_10068322 Ga0307413_100683223 260
80 3300032004 Ga0307414_10037335 Ga0307414_100373351 260
81 3300046455 Ga0495603_0204463 Ga0495603_0204463_300_1088 260
82 3300046473 Ga0495582_0010807 Ga0495582_0010807_724_1512 260
83 3300046475 Ga0495639_0011941 Ga0495639_0011941_220_1008 260
84 3300046477 Ga0495664_0207147 Ga0495664_0207147_94_882 260
85 3300046514 Ga0495618_0151985 Ga0495618_0151985_315_1103 260
86 3300046517 Ga0495630_0008140 Ga0495630_0008140_2374_3162 260
87 3300046526 Ga0495666_0022810 Ga0495666_0022810_1932_2720 260
88 3300046533 Ga0495640_0025831 Ga0495640_0025831_866_1654 260
89 3300046642 Ga0495634_0014438 Ga0495634_0014438_4836_5624 260
90 3300046681 Ga0495647_0002912 Ga0495647_0002912_2892_3680 260
91 3300046683 Ga0495658_0002240 Ga0495658_0002240_4470_5258 260
92 3300046689 Ga0495613_0051224 Ga0495613_0051224_1893_2681 260
93 3300046690 Ga0495624_0068538 Ga0495624_0068538_1206_1994 260
94 3300046809 Ga0495600_0146006 Ga0495600_0146006_396_1184 260
95 3300047319 Ga0495674_0003564 Ga0495674_0003564_961_1749 260
96 3300047322 Ga0495680_0047384 Ga0495680_0047384_424_1212 260
97 3300049583 Ga0501067_0015398 Ga0501067_0015398_2134_2919 260
98 3300049585 Ga0501069_0119943 Ga0501069_0119943_128_913 260
99 3300032005 Ga0307411_10016005 Ga0307411_100160054 261
100 3300049568 Ga0501031_0157802 Ga0501031_0157802_19_828 261
101 3300060353 Ga0501082_0554767 Ga0501082_0554767_36_863 261
102 3300049741 Ga0501079_0158219 Ga0501079_0158219_190_987 262
103 3300014325 Ga0163163_10159492 Ga0163163_101594923 263
104 3300034819 Ga0373958_0022684 Ga0373958_0022684_48_890 263
105 3300035088 Ga0373940_0001948 Ga0373940_0001948_919_1761 263
106 3300035114 Ga0373939_0055500 Ga0373939_0055500_236_1078 263
107 3300035691 Ga0373931_0037664 Ga0373931_0037664_1272_2114 263
108 3300048907 Ga0496104_0124338 Ga0496104_0124338_1363_2205 263
109 3300048911 Ga0496108_0006026 Ga0496108_0006026_6279_7121 263
110 3300048912 Ga0496109_0001213 Ga0496109_0001213_9909_10751 263
111 3300048913 Ga0496110_0053412 Ga0496110_0053412_1347_2189 263
112 3300048915 Ga0496112_0037511 Ga0496112_0037511_1604_2446 263
113 3300048916 Ga0496113_0016472 Ga0496113_0016472_2061_2903 263
114 3300050512 nmdc:mga0n895_275806_c1 nmdc:mga0n895_275806_c1_162_1004 263
115 3300025917 Ga0207660_10207282 Ga0207660_102072824 265
116 3300031995 Ga0307409_100221683 Ga0307409_1002216833 265
117 3300035084 Ga0373928_0027306 Ga0373928_0027306_152_994 265
118 3300048904 Ga0496101_0247208 Ga0496101_0247208_237_1037 265
119 3300048911 Ga0496108_0132598 Ga0496108_0132598_640_1440 265
120 3300048912 Ga0496109_0024561 Ga0496109_0024561_348_1148 265
121 3300048914 Ga0496111_0001192 Ga0496111_0001192_1388_2188 265
122 3300048915 Ga0496112_0468808 Ga0496112_0468808_185_985 265
123 3300050513 nmdc:mga0rr50_318192_c1 nmdc:mga0rr50_318192_c1_33_836 265
124 3300009147 Ga0114129_10084935 Ga0114129_100849355 270
125 3300014325 Ga0163163_10121141 Ga0163163_101211412 270
126 3300050507 nmdc:mga05p37_85700_c1 nmdc:mga05p37_85700_c1_2110_2931 270
127 3300049586 Ga0501070_0226927 Ga0501070_0226927_220_1047 272
128 3300005445 Ga0070708_100052601 Ga0070708_1000526015 274
129 3300005468 Ga0070707_100504337 Ga0070707_1005043372 274
130 3300006846 Ga0075430_100260736 Ga0075430_1002607362 274
131 3300009553 Ga0105249_10062862 Ga0105249_100628624 274
132 3300013306 Ga0163162_10235476 Ga0163162_102354762 274
133 3300014968 Ga0157379_10086329 Ga0157379_100863294 274
134 3300031731 Ga0307405_10047034 Ga0307405_100470343 274
135 3300031824 Ga0307413_10136542 Ga0307413_101365423 274
136 3300031852 Ga0307410_10015427 Ga0307410_100154276 274
137 3300031995 Ga0307409_100161634 Ga0307409_1001616343 274
138 3300032002 Ga0307416_100008115 Ga0307416_1000081156 274
139 3300032004 Ga0307414_10132073 Ga0307414_101320733 274
140 3300042876 Ga0451577_0088374 Ga0451577_0088374_81_926 274
141 3300044712 Ga0453684_0118376 Ga0453684_0118376_848_1693 274
142 3300049742 Ga0501080_0111426 Ga0501080_0111426_287_1123 274
143 3300060353 Ga0501082_0051635 Ga0501082_0051635_1774_2610 274
144 3300005471 Ga0070698_100326409 Ga0070698_1003264092 275
145 3300026035 Ga0207703_10488345 Ga0207703_104883452 276
146 3300005440 Ga0070705_100001551 Ga0070705_1000015514 277
147 3300005444 Ga0070694_100187677 Ga0070694_1001876773 277
148 3300005471 Ga0070698_100318197 Ga0070698_1003181972 277
149 3300005518 Ga0070699_100098594 Ga0070699_1000985944 277
150 3300005546 Ga0070696_100019623 Ga0070696_1000196235 277
151 3300005549 Ga0070704_100000999 Ga0070704_1000009994 277
152 3300049583 Ga0501067_0138200 Ga0501067_0138200_243_1082 277
153 3300049741 Ga0501079_0082737 Ga0501079_0082737_1209_2051 277
154 3300005471 Ga0070698_100025160 Ga0070698_1000251606 278
155 3300005518 Ga0070699_100120776 Ga0070699_1001207762 278
156 3300005547 Ga0070693_100061646 Ga0070693_1000616464 278
157 3300006871 Ga0075434_100271907 Ga0075434_1002719074 278
158 3300006880 Ga0075429_100237285 Ga0075429_1002372852 278
159 3300031911 Ga0307412_10022403 Ga0307412_100224032 278
160 3300048904 Ga0496101_0026268 Ga0496101_0026268_1520_2359 278
161 3300050509 nmdc:mga0qj67_89905_c1 nmdc:mga0qj67_89905_c1_1357_2196 278
162 3300005336 Ga0070680_100197933 Ga0070680_1001979333 281
163 3300005366 Ga0070659_100035985 Ga0070659_1000359854 281
164 3300005458 Ga0070681_10366173 Ga0070681_103661732 281
165 3300005530 Ga0070679_100167441 Ga0070679_1001674413 281
166 3300005577 Ga0068857_100251059 Ga0068857_1002510592 281
167 3300025912 Ga0207707_10076094 Ga0207707_100760945 281
168 3300025917 Ga0207660_10038008 Ga0207660_100380086 281
169 3300025921 Ga0207652_10032460 Ga0207652_100324604 281
170 3300025932 Ga0207690_10026069 Ga0207690_100260694 281
171 3300026067 Ga0207678_10295969 Ga0207678_102959693 281
172 3300026116 Ga0207674_10427205 Ga0207674_104272052 281
173 3300032002 Ga0307416_100142569 Ga0307416_1001425694 281
174 3300042876 Ga0451577_0013691 Ga0451577_0013691_5076_5924 281
175 3300048911 Ga0496108_0121355 Ga0496108_0121355_297_1154 281
176 3300048913 Ga0496110_0254457 Ga0496110_0254457_659_1516 281
177 3300005937 Ga0081455_10089377 Ga0081455_100893774 282
178 3300054114 Ga0501084_0146658 Ga0501084_0146658_748_1644 283
179 3300059423 Ga0590074_020800 Ga0590074_020800_183_1079 283
180 3300059426 Ga0590077_023457 Ga0590077_023457_46_942 283
181 3300060353 Ga0501082_0147934 Ga0501082_0147934_703_1599 283
182 3300005444 Ga0070694_100210585 Ga0070694_1002105852 285
183 3300005518 Ga0070699_100033955 Ga0070699_1000339556 285
184 3300005536 Ga0070697_100005983 Ga0070697_10000598310 285
185 3300005545 Ga0070695_100012744 Ga0070695_1000127445 285
186 3300005546 Ga0070696_100000228 Ga0070696_10000022840 285
187 3300005549 Ga0070704_100074104 Ga0070704_1000741043 285
188 3300006852 Ga0075433_10020064 Ga0075433_100200648 285
189 3300031995 Ga0307409_100152617 Ga0307409_1001526172 285
190 3300050515 nmdc:mga0a205_19285_c1 nmdc:mga0a205_19285_c1_3013_3888 285
191 3300005331 Ga0070670_100058867 Ga0070670_1000588676 286
192 3300005333 Ga0070677_10058555 Ga0070677_100585553 286
193 3300005354 Ga0070675_100138902 Ga0070675_1001389023 286
194 3300005564 Ga0070664_100146690 Ga0070664_1001466902 286
195 3300025893 Ga0207682_10029222 Ga0207682_100292224 286
196 3300025916 Ga0207663_10288656 Ga0207663_102886562 286
197 3300025925 Ga0207650_10431191 Ga0207650_104311912 286
198 3300025938 Ga0207704_10003675 Ga0207704_100036755 286
199 3300048905 Ga0496102_0497995 Ga0496102_0497995_253_1116 286
200 3300048915 Ga0496112_0167232 Ga0496112_0167232_607_1470 286
201 3300005328 Ga0070676_10004122 Ga0070676_100041227 287
202 3300005330 Ga0070690_100015188 Ga0070690_1000151884 287
203 3300005334 Ga0068869_100007486 Ga0068869_1000074865 287
204 3300005341 Ga0070691_10059086 Ga0070691_100590863 287
205 3300005356 Ga0070674_100002772 Ga0070674_1000027729 287
206 3300005364 Ga0070673_100025416 Ga0070673_1000254164 287
207 3300005438 Ga0070701_10089600 Ga0070701_100896003 287
208 3300005440 Ga0070705_100003772 Ga0070705_1000037724 287
209 3300005444 Ga0070694_100008733 Ga0070694_1000087336 287
210 3300005455 Ga0070663_100112215 Ga0070663_1001122152 287
211 3300005456 Ga0070678_100083437 Ga0070678_1000834371 287
212 3300005457 Ga0070662_100008256 Ga0070662_1000082562 287
213 3300005459 Ga0068867_100032774 Ga0068867_1000327745 287
214 3300005468 Ga0070707_100335375 Ga0070707_1003353752 287
215 3300005544 Ga0070686_100078286 Ga0070686_1000782864 287
216 3300005545 Ga0070695_100004874 Ga0070695_1000048745 287
217 3300005546 Ga0070696_100002289 Ga0070696_10000228911 287
218 3300005549 Ga0070704_100191342 Ga0070704_1001913423 287
219 3300005578 Ga0068854_100001930 Ga0068854_1000019305 287
220 3300005615 Ga0070702_100014722 Ga0070702_1000147222 287
221 3300005618 Ga0068864_100029554 Ga0068864_1000295544 287
222 3300005718 Ga0068866_10000165 Ga0068866_1000016512 287
223 3300005840 Ga0068870_10038040 Ga0068870_100380403 287
224 3300005842 Ga0068858_100092635 Ga0068858_1000926353 287
225 3300005843 Ga0068860_100144242 Ga0068860_1001442423 287
226 3300006237 Ga0097621_100082643 Ga0097621_1000826434 287
227 3300006358 Ga0068871_100060915 Ga0068871_1000609154 287
228 3300006852 Ga0075433_10322657 Ga0075433_103226571 287
229 3300006881 Ga0068865_100001488 Ga0068865_1000014886 287
230 3300009093 Ga0105240_10209172 Ga0105240_102091722 287
231 3300009148 Ga0105243_10003787 Ga0105243_1000378714 287
232 3300009174 Ga0105241_10006356 Ga0105241_100063564 287
233 3300009176 Ga0105242_10010817 Ga0105242_100108172 287
234 3300009177 Ga0105248_10027223 Ga0105248_100272231 287
235 3300009553 Ga0105249_10101033 Ga0105249_101010334 287
236 3300011119 Ga0105246_10004556 Ga0105246_100045565 287
237 3300013297 Ga0157378_10013245 Ga0157378_100132457 287
238 3300013306 Ga0163162_10112913 Ga0163162_101129134 287
239 3300013307 Ga0157372_10381045 Ga0157372_103810453 287
240 3300014326 Ga0157380_10055284 Ga0157380_100552842 287
241 3300014968 Ga0157379_10026519 Ga0157379_100265194 287
242 3300025899 Ga0207642_10004570 Ga0207642_100045705 287
243 3300025907 Ga0207645_10000654 Ga0207645_1000065424 287
244 3300025908 Ga0207643_10007065 Ga0207643_100070656 287
245 3300025911 Ga0207654_10085227 Ga0207654_100852274 287
246 3300025922 Ga0207646_10511945 Ga0207646_105119452 287
247 3300025926 Ga0207659_10104125 Ga0207659_101041253 287
248 3300025933 Ga0207706_10000244 Ga0207706_1000024419 287
249 3300025934 Ga0207686_10000739 Ga0207686_100007392 287
250 3300025935 Ga0207709_10023470 Ga0207709_100234703 287
251 3300025937 Ga0207669_10003993 Ga0207669_100039935 287
252 3300025941 Ga0207711_10072315 Ga0207711_100723154 287
253 3300025942 Ga0207689_10004041 Ga0207689_100040416 287
254 3300025960 Ga0207651_10021551 Ga0207651_100215514 287
255 3300025961 Ga0207712_10009486 Ga0207712_100094862 287
256 3300025961 Ga0207712_10119831 Ga0207712_101198313 287
257 3300026035 Ga0207703_10041356 Ga0207703_100413565 287
258 3300026067 Ga0207678_10139017 Ga0207678_101390172 287
259 3300026089 Ga0207648_10000273 Ga0207648_1000027342 287
260 3300026095 Ga0207676_10006035 Ga0207676_100060353 287
261 3300026118 Ga0207675_100038542 Ga0207675_1000385425 287
262 3300026118 Ga0207675_100261865 Ga0207675_1002618652 287
263 3300026121 Ga0207683_10116333 Ga0207683_101163332 287
264 3300028380 Ga0268265_10036014 Ga0268265_100360143 287
265 3300028381 Ga0268264_10018693 Ga0268264_100186935 287
266 3300046499 Ga0495594_0042348 Ga0495594_0042348_938_1876 287
267 3300046557 Ga0495622_0070930 Ga0495622_0070930_45_983 287
268 3300048905 Ga0496102_0142978 Ga0496102_0142978_193_1131 287
269 3300048910 Ga0496107_0121100 Ga0496107_0121100_64_1002 287
270 3300048917 Ga0496114_0362387 Ga0496114_0362387_250_1188 287
271 3300005440 Ga0070705_100010233 Ga0070705_1000102332 288
272 3300005445 Ga0070708_100000511 Ga0070708_10000051127 288
273 3300005467 Ga0070706_100003657 Ga0070706_10000365720 288
274 3300005468 Ga0070707_100001574 Ga0070707_10000157427 288
275 3300005518 Ga0070699_100004841 Ga0070699_10000484112 288
276 3300005536 Ga0070697_100156453 Ga0070697_1001564532 288
277 3300005546 Ga0070696_100101324 Ga0070696_1001013243 288
278 3300025910 Ga0207684_10008479 Ga0207684_100084799 288
279 3300025922 Ga0207646_10025599 Ga0207646_100255996 288
280 3300031548 Ga0307408_100062145 Ga0307408_1000621453 288
281 3300031548 Ga0307408_100236707 Ga0307408_1002367072 288
282 3300031548 Ga0307408_100401059 Ga0307408_1004010592 288
283 3300031824 Ga0307413_10063447 Ga0307413_100634474 288
284 3300031852 Ga0307410_10001254 Ga0307410_1000125412 288
285 3300031901 Ga0307406_10093122 Ga0307406_100931223 288
286 3300031903 Ga0307407_10025855 Ga0307407_100258553 288
287 3300031995 Ga0307409_100012136 Ga0307409_1000121366 288
288 3300032002 Ga0307416_100086655 Ga0307416_1000866553 288
289 3300032002 Ga0307416_100141174 Ga0307416_1001411743 288
290 3300032005 Ga0307411_10002992 Ga0307411_100029927 288
291 3300032126 Ga0307415_100001883 Ga0307415_10000188312 288
292 3300049677 Ga0501247_001263 Ga0501247_001263_620_1489 288
293 3300049704 Ga0501221_002832 Ga0501221_002832_1232_2101 288
294 3300049707 Ga0501234_011486 Ga0501234_011486_229_1098 288
295 3300049765 Ga0501268_000345 Ga0501268_000345_1959_2828 288
296 3300049769 Ga0501272_003141 Ga0501272_003141_361_1230 288
297 3300007076 Ga0075435_100217138 Ga0075435_1002171381 289
298 3300005293 Ga0065715_10106576 Ga0065715_101065764 290
299 3300005440 Ga0070705_100024462 Ga0070705_1000244622 290
300 3300005444 Ga0070694_100039668 Ga0070694_1000396682 290
301 3300005546 Ga0070696_100019922 Ga0070696_1000199224 290
302 3300005549 Ga0070704_100009307 Ga0070704_1000093076 290
303 3300006847 Ga0075431_100170539 Ga0075431_1001705394 290
304 3300006852 Ga0075433_10047107 Ga0075433_100471072 290
305 3300006871 Ga0075434_100027226 Ga0075434_1000272264 290
306 3300006871 Ga0075434_100263730 Ga0075434_1002637302 290
307 3300006914 Ga0075436_100095248 Ga0075436_1000952482 290
308 3300007076 Ga0075435_100071596 Ga0075435_1000715962 290
309 3300009147 Ga0114129_10000442 Ga0114129_1000044246 290
310 3300010375 Ga0105239_10009184 Ga0105239_100091849 290
311 3300048904 Ga0496101_0014898 Ga0496101_0014898_1288_2160 290
312 3300048905 Ga0496102_0001888 Ga0496102_0001888_1534_2406 290
313 3300048905 Ga0496102_0046661 Ga0496102_0046661_1603_2475 290
314 3300048907 Ga0496104_0002618 Ga0496104_0002618_10759_11631 290
315 3300048908 Ga0496105_0002410 Ga0496105_0002410_10960_11832 290
316 3300048909 Ga0496106_0056922 Ga0496106_0056922_104_976 290
317 3300048911 Ga0496108_0015227 Ga0496108_0015227_1613_2485 290
318 3300048912 Ga0496109_0001371 Ga0496109_0001371_16301_17173 290
319 3300048913 Ga0496110_0000477 Ga0496110_0000477_13644_14516 290
320 3300048914 Ga0496111_0001070 Ga0496111_0001070_3743_4615 290
321 3300048915 Ga0496112_0019272 Ga0496112_0019272_2797_3669 290
322 3300048916 Ga0496113_0009449 Ga0496113_0009449_4417_5289 290
323 3300048918 Ga0496115_0065813 Ga0496115_0065813_1012_1884 290
324 3300050507 nmdc:mga05p37_558_c1 nmdc:mga05p37_558_c1_15173_16045 290
325 3300050512 nmdc:mga0n895_25277_c1 nmdc:mga0n895_25277_c1_2706_3578 290
326 3300050513 nmdc:mga0rr50_50624_c1 nmdc:mga0rr50_50624_c1_930_1802 290
327 3300050514 nmdc:mga08x19_181553_c1 nmdc:mga08x19_181553_c1_97_969 290
328 3300050515 nmdc:mga0a205_104716_c1 nmdc:mga0a205_104716_c1_1727_2599 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

1

105

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.9121 12 277
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8618 12 282
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.8477 12 277
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8215 12 282
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8021 11 267
ID Description Score Start End Superfamily
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.902 107 176 1.10.150.650
3o0fA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8771 106 176 1.10.150.650
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8668 12 277 3.20.20.140
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8571 107 176 1.10.150.650
3o0fA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8443 106 176 1.10.150.650
ID Description Score Start End GO Terms
AF-A0A7V9FEC2-F1-model_v4 PHP domain-containing protein 0.9855 9 287 GO:0004534
GO:0035312
AF-A0A524AFZ6-F1-model_v4 PHP domain-containing protein 0.9828 10 179 GO:0004534
GO:0035312
AF-A0A661K3U6-F1-model_v4 PHP domain-containing protein 0.9794 11 87 GO:0004534
GO:0035312
AF-A0A1Q7CEI4-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9792 8 179 GO:0004534
GO:0035312
AF-A0A2V7IYT8-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.977 8 279 GO:0004534
GO:0035312

Feature Viewer

pLDDT pTM Quality
92.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map