F409223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 194 | 328 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10038746|Ga0114129_100387467 |
| Length | 256 |
| Sequence | VVSRAQAAGLAAIALTDHDTVAGVPAAVAAGERCGVRVVSGCEFSTAAPWGEMHVLGYFLPTDSPLLEAFLERRREDRVRRGRAMVDRLRGMGVTLDFEDVLRQARGAVGRPHVARAIVLSGGAAGMSEAFDRYIGRGRPAFVDKVLPTFGEVADVVHAVRGIVSLAHLKDRGTRSFLDRLKGQGLDALETRHPSHDPDTRARLTDIALALGLLRTGGSDWHGDPEPGESHGTIGSQEVPLEWLERLDQHRLCEVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 171 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 172 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 173 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 177 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 178 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 191 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.06 |
| Rhizosphere | 89.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10106576 | 3300005293 | Unclassified | 2821 |
| 2 | Ga0070676_10004122 | 3300005328 | Bacteria | 7631 |
| 3 | Ga0070690_100015188 | 3300005330 | Bacteria | 4588 |
| 4 | Ga0070670_100058867 | 3300005331 | Bacteria | 3298 |
| 5 | Ga0070677_10058555 | 3300005333 | Bacteria | 1582 |
| 6 | Ga0068869_100007486 | 3300005334 | Bacteria | 6986 |
| 7 | Ga0070680_100197933 | 3300005336 | Unclassified | 1694 |
| 8 | Ga0070691_10059086 | 3300005341 | Unclassified | 1842 |
| 9 | Ga0070675_100138902 | 3300005354 | Bacteria | 2075 |
| 10 | Ga0070674_100002772 | 3300005356 | Bacteria | 9682 |
| 11 | Ga0070673_100025416 | 3300005364 | Bacteria | 4359 |
| 12 | Ga0070659_100035985 | 3300005366 | Bacteria | 3858 |
| 13 | Ga0070701_10078036 | 3300005438 | Unclassified | 1786 |
| 14 | Ga0070701_10089600 | 3300005438 | Bacteria | 1683 |
| 15 | Ga0070705_100001551 | 3300005440 | Bacteria | 12038 |
| 16 | Ga0070705_100003772 | 3300005440 | Bacteria | 7416 |
| 17 | Ga0070705_100010233 | 3300005440 | Bacteria | 4688 |
| 18 | Ga0070705_100024462 | 3300005440 | Bacteria | 3260 |
| 19 | Ga0070700_100153182 | 3300005441 | Unclassified | 1579 |
| 20 | Ga0070694_100008733 | 3300005444 | Bacteria | 6206 |
| 21 | Ga0070694_100039668 | 3300005444 | Unclassified | 3136 |
| 22 | Ga0070694_100187677 | 3300005444 | Unclassified | 1533 |
| 23 | Ga0070694_100210585 | 3300005444 | Bacteria | 1453 |
| 24 | Ga0070708_100000511 | 3300005445 | Bacteria | 29095 |
| 25 | Ga0070708_100052601 | 3300005445 | Bacteria | 3612 |
| 26 | Ga0070708_100089165 | 3300005445 | Bacteria | 2806 |
| 27 | Ga0070663_100112215 | 3300005455 | Unclassified | 2050 |
| 28 | Ga0070678_100083437 | 3300005456 | Unclassified | 2429 |
| 29 | Ga0070662_100008256 | 3300005457 | Bacteria | 6780 |
| 30 | Ga0070681_10366173 | 3300005458 | Bacteria | 1352 |
| 31 | Ga0068867_100032774 | 3300005459 | Bacteria | 3759 |
| 32 | Ga0070706_100003657 | 3300005467 | Bacteria | 15049 |
| 33 | Ga0070707_100000581 | 3300005468 | Bacteria | 36780 |
| 34 | Ga0070707_100001574 | 3300005468 | Bacteria | 22107 |
| 35 | Ga0070707_100108920 | 3300005468 | Bacteria | 2687 |
| 36 | Ga0070707_100335375 | 3300005468 | Bacteria | 1469 |
| 37 | Ga0070707_100405080 | 3300005468 | Unclassified | 1324 |
| 38 | Ga0070707_100504337 | 3300005468 | Unclassified | 1172 |
| 39 | Ga0070698_100025160 | 3300005471 | Bacteria | 6203 |
| 40 | Ga0070698_100318197 | 3300005471 | Unclassified | 1486 |
| 41 | Ga0070698_100325076 | 3300005471 | Unclassified | 1469 |
| 42 | Ga0070698_100326409 | 3300005471 | Bacteria | 1466 |
| 43 | Ga0070699_100000727 | 3300005518 | Bacteria | 30549 |
| 44 | Ga0070699_100004841 | 3300005518 | Bacteria | 11878 |
| 45 | Ga0070699_100033955 | 3300005518 | Bacteria | 4408 |
| 46 | Ga0070699_100091459 | 3300005518 | Bacteria | 2660 |
| 47 | Ga0070699_100098594 | 3300005518 | Bacteria | 2561 |
| 48 | Ga0070699_100120776 | 3300005518 | Unclassified | 2304 |
| 49 | Ga0070679_100167441 | 3300005530 | Bacteria | 2170 |
| 50 | Ga0070697_100005983 | 3300005536 | Bacteria | 9406 |
| 51 | Ga0070697_100156453 | 3300005536 | Bacteria | 1924 |
| 52 | Ga0070686_100078286 | 3300005544 | Bacteria | 2183 |
| 53 | Ga0070695_100004874 | 3300005545 | Bacteria | 7901 |
| 54 | Ga0070695_100012744 | 3300005545 | Bacteria | 5047 |
| 55 | Ga0070696_100000228 | 3300005546 | Bacteria | 33916 |
| 56 | Ga0070696_100002289 | 3300005546 | Bacteria | 12624 |
| 57 | Ga0070696_100019623 | 3300005546 | Unclassified | 4580 |
| 58 | Ga0070696_100019922 | 3300005546 | Bacteria | 4547 |
| 59 | Ga0070696_100101324 | 3300005546 | Bacteria | 2064 |
| 60 | Ga0070693_100061646 | 3300005547 | Bacteria | 2181 |
| 61 | Ga0070704_100000999 | 3300005549 | Bacteria | 14435 |
| 62 | Ga0070704_100009307 | 3300005549 | Bacteria | 5926 |
| 63 | Ga0070704_100025252 | 3300005549 | Bacteria | 3909 |
| 64 | Ga0070704_100074104 | 3300005549 | Bacteria | 2482 |
| 65 | Ga0070704_100191342 | 3300005549 | Bacteria | 1645 |
| 66 | Ga0070704_100278065 | 3300005549 | Unclassified | 1386 |
| 67 | Ga0070664_100146690 | 3300005564 | Bacteria | 2081 |
| 68 | Ga0068857_100251059 | 3300005577 | Bacteria | 1622 |
| 69 | Ga0068854_100001930 | 3300005578 | Bacteria | 12643 |
| 70 | Ga0070702_100014722 | 3300005615 | Bacteria | 3975 |
| 71 | Ga0068859_100509364 | 3300005617 | Unclassified | 1299 |
| 72 | Ga0068864_100029554 | 3300005618 | Bacteria | 4643 |
| 73 | Ga0068866_10000165 | 3300005718 | Bacteria | 30640 |
| 74 | Ga0068861_100457443 | 3300005719 | Unclassified | 1145 |
| 75 | Ga0068870_10038040 | 3300005840 | Unclassified | 2483 |
| 76 | Ga0068858_100092635 | 3300005842 | Bacteria | 2813 |
| 77 | Ga0068860_100144242 | 3300005843 | Bacteria | 2290 |
| 78 | Ga0081455_10089377 | 3300005937 | Bacteria | 2500 |
| 79 | Ga0097621_100082643 | 3300006237 | Unclassified | 2675 |
| 80 | Ga0068871_100060915 | 3300006358 | Unclassified | 3080 |
| 81 | Ga0075430_100260736 | 3300006846 | Unclassified | 1435 |
| 82 | Ga0075431_100170539 | 3300006847 | Bacteria | 2236 |
| 83 | Ga0075431_100184048 | 3300006847 | Bacteria | 2143 |
| 84 | Ga0075433_10020064 | 3300006852 | Bacteria | 5582 |
| 85 | Ga0075433_10047107 | 3300006852 | Bacteria | 3750 |
| 86 | Ga0075433_10322657 | 3300006852 | Bacteria | 1366 |
| 87 | Ga0075434_100023725 | 3300006871 | Bacteria | 5984 |
| 88 | Ga0075434_100027226 | 3300006871 | Bacteria | 5610 |
| 89 | Ga0075434_100263730 | 3300006871 | Unclassified | 1742 |
| 90 | Ga0075434_100271907 | 3300006871 | Bacteria | 1714 |
| 91 | Ga0075429_100005168 | 3300006880 | Bacteria | 11222 |
| 92 | Ga0075429_100048793 | 3300006880 | Bacteria | 3681 |
| 93 | Ga0075429_100237285 | 3300006880 | Bacteria | 1597 |
| 94 | Ga0068865_100001488 | 3300006881 | Bacteria | 13652 |
| 95 | Ga0075436_100095248 | 3300006914 | Bacteria | 2071 |
| 96 | Ga0097620_100509335 | 3300006931 | Unclassified | 1299 |
| 97 | Ga0075435_100071596 | 3300007076 | Bacteria | 2831 |
| 98 | Ga0075435_100217138 | 3300007076 | Bacteria | 1623 |
| 99 | Ga0105240_10209172 | 3300009093 | Bacteria | 2281 |
| 100 | Ga0114129_10000442 | 3300009147 | Bacteria | 49250 |
| 101 | Ga0114129_10038746 | 3300009147 | Bacteria | 6720 |
| 102 | Ga0114129_10084935 | 3300009147 | Bacteria | 4392 |
| 103 | Ga0114129_10160475 | 3300009147 | Bacteria | 3072 |
| 104 | Ga0114129_10342900 | 3300009147 | Unclassified | 1981 |
| 105 | Ga0105243_10003787 | 3300009148 | Bacteria | 12105 |
| 106 | Ga0105241_10006356 | 3300009174 | Bacteria | 8710 |
| 107 | Ga0105242_10010817 | 3300009176 | Bacteria | 7005 |
| 108 | Ga0105248_10027223 | 3300009177 | Bacteria | 6362 |
| 109 | Ga0105249_10062862 | 3300009553 | Unclassified | 3409 |
| 110 | Ga0105249_10101033 | 3300009553 | Bacteria | 2712 |
| 111 | Ga0105249_10277243 | 3300009553 | Unclassified | 1673 |
| 112 | Ga0105239_10009184 | 3300010375 | Bacteria | 11181 |
| 113 | Ga0105246_10004556 | 3300011119 | Bacteria | 8435 |
| 114 | Ga0157378_10013245 | 3300013297 | Bacteria | 7211 |
| 115 | Ga0163162_10112913 | 3300013306 | Unclassified | 2816 |
| 116 | Ga0163162_10235476 | 3300013306 | Bacteria | 1961 |
| 117 | Ga0157372_10381045 | 3300013307 | Bacteria | 1643 |
| 118 | Ga0163163_10121141 | 3300014325 | Bacteria | 2650 |
| 119 | Ga0163163_10159492 | 3300014325 | Unclassified | 2301 |
| 120 | Ga0157380_10055284 | 3300014326 | Bacteria | 3152 |
| 121 | Ga0157379_10026519 | 3300014968 | Bacteria | 5159 |
| 122 | Ga0157379_10086329 | 3300014968 | Unclassified | 2814 |
| 123 | Ga0207682_10029222 | 3300025893 | Bacteria | 2204 |
| 124 | Ga0207642_10004570 | 3300025899 | Bacteria | 4470 |
| 125 | Ga0207645_10000654 | 3300025907 | Bacteria | 28792 |
| 126 | Ga0207643_10007065 | 3300025908 | Bacteria | 6017 |
| 127 | Ga0207684_10008479 | 3300025910 | Bacteria | 9143 |
| 128 | Ga0207654_10085227 | 3300025911 | Bacteria | 1912 |
| 129 | Ga0207707_10076094 | 3300025912 | Bacteria | 2929 |
| 130 | Ga0207707_10104475 | 3300025912 | Bacteria | 2476 |
| 131 | Ga0207663_10288656 | 3300025916 | Bacteria | 1221 |
| 132 | Ga0207660_10038008 | 3300025917 | Bacteria | 3358 |
| 133 | Ga0207660_10207282 | 3300025917 | Unclassified | 1534 |
| 134 | Ga0207652_10032460 | 3300025921 | Bacteria | 4390 |
| 135 | Ga0207646_10025599 | 3300025922 | Bacteria | 5397 |
| 136 | Ga0207646_10036537 | 3300025922 | Bacteria | 4434 |
| 137 | Ga0207646_10086350 | 3300025922 | Unclassified | 2807 |
| 138 | Ga0207646_10191951 | 3300025922 | Unclassified | 1845 |
| 139 | Ga0207646_10231397 | 3300025922 | Unclassified | 1670 |
| 140 | Ga0207646_10511945 | 3300025922 | Bacteria | 1081 |
| 141 | Ga0207650_10431191 | 3300025925 | Bacteria | 1095 |
| 142 | Ga0207659_10104125 | 3300025926 | Bacteria | 2146 |
| 143 | Ga0207690_10026069 | 3300025932 | Bacteria | 3679 |
| 144 | Ga0207706_10000244 | 3300025933 | Bacteria | 59754 |
| 145 | Ga0207686_10000739 | 3300025934 | Bacteria | 20216 |
| 146 | Ga0207709_10023470 | 3300025935 | Unclassified | 3511 |
| 147 | Ga0207669_10003993 | 3300025937 | Bacteria | 6448 |
| 148 | Ga0207704_10003675 | 3300025938 | Bacteria | 6974 |
| 149 | Ga0207711_10072315 | 3300025941 | Bacteria | 2996 |
| 150 | Ga0207689_10004041 | 3300025942 | Bacteria | 13328 |
| 151 | Ga0207651_10021551 | 3300025960 | Unclassified | 3920 |
| 152 | Ga0207712_10009486 | 3300025961 | Bacteria | 6157 |
| 153 | Ga0207712_10119831 | 3300025961 | Bacteria | 1989 |
| 154 | Ga0207703_10041356 | 3300026035 | Bacteria | 3692 |
| 155 | Ga0207703_10488345 | 3300026035 | Bacteria | 1155 |
| 156 | Ga0207678_10139017 | 3300026067 | Unclassified | 2072 |
| 157 | Ga0207678_10295969 | 3300026067 | Unclassified | 1390 |
| 158 | Ga0207648_10000273 | 3300026089 | Bacteria | 56070 |
| 159 | Ga0207676_10006035 | 3300026095 | Bacteria | 8543 |
| 160 | Ga0207674_10427205 | 3300026116 | Bacteria | 1280 |
| 161 | Ga0207675_100038542 | 3300026118 | Bacteria | 4460 |
| 162 | Ga0207675_100261865 | 3300026118 | Bacteria | 1676 |
| 163 | Ga0207683_10116333 | 3300026121 | Unclassified | 2397 |
| 164 | Ga0268265_10036014 | 3300028380 | Unclassified | 3621 |
| 165 | Ga0268264_10018693 | 3300028381 | Bacteria | 5665 |
| 166 | Ga0307408_100062145 | 3300031548 | Unclassified | 2728 |
| 167 | Ga0307408_100236707 | 3300031548 | Unclassified | 1498 |
| 168 | Ga0307408_100401059 | 3300031548 | Unclassified | 1178 |
| 169 | Ga0307405_10047034 | 3300031731 | Unclassified | 2655 |
| 170 | Ga0307413_10063447 | 3300031824 | Unclassified | 2290 |
| 171 | Ga0307413_10068322 | 3300031824 | Bacteria | 2225 |
| 172 | Ga0307413_10136542 | 3300031824 | Unclassified | 1687 |
| 173 | Ga0307410_10001254 | 3300031852 | Bacteria | 11302 |
| 174 | Ga0307410_10015427 | 3300031852 | Unclassified | 4531 |
| 175 | Ga0307406_10046628 | 3300031901 | Unclassified | 2728 |
| 176 | Ga0307406_10093122 | 3300031901 | Unclassified | 2034 |
| 177 | Ga0307407_10025855 | 3300031903 | Unclassified | 3100 |
| 178 | Ga0307407_10074130 | 3300031903 | Bacteria | 2036 |
| 179 | Ga0307412_10022403 | 3300031911 | Bacteria | 3872 |
| 180 | Ga0307409_100012136 | 3300031995 | Bacteria | 5474 |
| 181 | Ga0307409_100152617 | 3300031995 | Bacteria | 2008 |
| 182 | Ga0307409_100161634 | 3300031995 | Unclassified | 1959 |
| 183 | Ga0307409_100221683 | 3300031995 | Bacteria | 1708 |
| 184 | Ga0307416_100008115 | 3300032002 | Bacteria | 6741 |
| 185 | Ga0307416_100086655 | 3300032002 | Bacteria | 2670 |
| 186 | Ga0307416_100141174 | 3300032002 | Unclassified | 2189 |
| 187 | Ga0307416_100142569 | 3300032002 | Bacteria | 2181 |
| 188 | Ga0307414_10037335 | 3300032004 | Bacteria | 3252 |
| 189 | Ga0307414_10132073 | 3300032004 | Unclassified | 1940 |
| 190 | Ga0307411_10002992 | 3300032005 | Bacteria | 7693 |
| 191 | Ga0307411_10016005 | 3300032005 | Bacteria | 4234 |
| 192 | Ga0307415_100001883 | 3300032126 | Bacteria | 10301 |
| 193 | Ga0373958_0022684 | 3300034819 | Unclassified | 1175 |
| 194 | Ga0373928_0027306 | 3300035084 | Bacteria | 1242 |
| 195 | Ga0373940_0001948 | 3300035088 | Bacteria | 3896 |
| 196 | Ga0373939_0055500 | 3300035114 | Bacteria | 1244 |
| 197 | Ga0373931_0037664 | 3300035691 | Bacteria | 2525 |
| 198 | Ga0451577_0013691 | 3300042876 | Bacteria | 7581 |
| 199 | Ga0451577_0088374 | 3300042876 | Unclassified | 2765 |
| 200 | Ga0453684_0118376 | 3300044712 | Unclassified | 3204 |
| 201 | Ga0495603_0204463 | 3300046455 | Bacteria | 1141 |
| 202 | Ga0495582_0010807 | 3300046473 | Bacteria | 5025 |
| 203 | Ga0495639_0011941 | 3300046475 | Bacteria | 3746 |
| 204 | Ga0495664_0207147 | 3300046477 | Bacteria | 1188 |
| 205 | Ga0495594_0042348 | 3300046499 | Bacteria | 2494 |
| 206 | Ga0495618_0151985 | 3300046514 | Bacteria | 1478 |
| 207 | Ga0495630_0008140 | 3300046517 | Bacteria | 7531 |
| 208 | Ga0495666_0022810 | 3300046526 | Bacteria | 3098 |
| 209 | Ga0495640_0025831 | 3300046533 | Bacteria | 4253 |
| 210 | Ga0495622_0070930 | 3300046557 | Bacteria | 1608 |
| 211 | Ga0495634_0014438 | 3300046642 | Bacteria | 5694 |
| 212 | Ga0495647_0002912 | 3300046681 | Bacteria | 5431 |
| 213 | Ga0495658_0002240 | 3300046683 | Bacteria | 9781 |
| 214 | Ga0495613_0051224 | 3300046689 | Bacteria | 3043 |
| 215 | Ga0495624_0068538 | 3300046690 | Bacteria | 2211 |
| 216 | Ga0495600_0146006 | 3300046809 | Bacteria | 1533 |
| 217 | Ga0495674_0003564 | 3300047319 | Bacteria | 15136 |
| 218 | Ga0495680_0047384 | 3300047322 | Bacteria | 3381 |
| 219 | Ga0496101_0014898 | 3300048904 | Bacteria | 5232 |
| 220 | Ga0496101_0026268 | 3300048904 | Bacteria | 4048 |
| 221 | Ga0496101_0247208 | 3300048904 | Unclassified | 1389 |
| 222 | Ga0496102_0001888 | 3300048905 | Bacteria | 18056 |
| 223 | Ga0496102_0046661 | 3300048905 | Bacteria | 3935 |
| 224 | Ga0496102_0142978 | 3300048905 | Unclassified | 2244 |
| 225 | Ga0496102_0497995 | 3300048905 | Unclassified | 1140 |
| 226 | Ga0496104_0002618 | 3300048907 | Bacteria | 15495 |
| 227 | Ga0496104_0124338 | 3300048907 | Unclassified | 2476 |
| 228 | Ga0496105_0002410 | 3300048908 | Bacteria | 13540 |
| 229 | Ga0496106_0056922 | 3300048909 | Bacteria | 2956 |
| 230 | Ga0496107_0121100 | 3300048910 | Bacteria | 1928 |
| 231 | Ga0496107_0298769 | 3300048910 | Unclassified | 1198 |
| 232 | Ga0496108_0006026 | 3300048911 | Bacteria | 9813 |
| 233 | Ga0496108_0015227 | 3300048911 | Bacteria | 6275 |
| 234 | Ga0496108_0121355 | 3300048911 | Bacteria | 2242 |
| 235 | Ga0496108_0132598 | 3300048911 | Unclassified | 2141 |
| 236 | Ga0496109_0001213 | 3300048912 | Bacteria | 21423 |
| 237 | Ga0496109_0001371 | 3300048912 | Bacteria | 20198 |
| 238 | Ga0496109_0024561 | 3300048912 | Bacteria | 5359 |
| 239 | Ga0496110_0000477 | 3300048913 | Bacteria | 27148 |
| 240 | Ga0496110_0053412 | 3300048913 | Bacteria | 3552 |
| 241 | Ga0496110_0254457 | 3300048913 | Unclassified | 1599 |
| 242 | Ga0496111_0001070 | 3300048914 | Bacteria | 15083 |
| 243 | Ga0496111_0001192 | 3300048914 | Bacteria | 14498 |
| 244 | Ga0496112_0019272 | 3300048915 | Bacteria | 6436 |
| 245 | Ga0496112_0037511 | 3300048915 | Bacteria | 4729 |
| 246 | Ga0496112_0167232 | 3300048915 | Unclassified | 2165 |
| 247 | Ga0496112_0468808 | 3300048915 | Unclassified | 1196 |
| 248 | Ga0496113_0009449 | 3300048916 | Bacteria | 6397 |
| 249 | Ga0496113_0016472 | 3300048916 | Bacteria | 5107 |
| 250 | Ga0496114_0362387 | 3300048917 | Bacteria | 1282 |
| 251 | Ga0496115_0065813 | 3300048918 | Bacteria | 2928 |
| 252 | Ga0501031_0157802 | 3300049568 | Bacteria | 1483 |
| 253 | Ga0501031_0175599 | 3300049568 | Unclassified | 1400 |
| 254 | Ga0501032_0263551 | 3300049569 | Bacteria | 1117 |
| 255 | Ga0501036_0035368 | 3300049572 | Bacteria | 4228 |
| 256 | Ga0501040_0011188 | 3300049576 | Bacteria | 5870 |
| 257 | Ga0501040_0040331 | 3300049576 | Bacteria | 3177 |
| 258 | Ga0501041_0018135 | 3300049577 | Bacteria | 4192 |
| 259 | Ga0501041_0018913 | 3300049577 | Bacteria | 4104 |
| 260 | Ga0501041_0095079 | 3300049577 | Bacteria | 1841 |
| 261 | Ga0501046_0039359 | 3300049580 | Bacteria | 3787 |
| 262 | Ga0501046_0048829 | 3300049580 | Bacteria | 3350 |
| 263 | Ga0501046_0106245 | 3300049580 | Bacteria | 2149 |
| 264 | Ga0501046_0320881 | 3300049580 | Bacteria | 1129 |
| 265 | Ga0501048_0027834 | 3300049582 | Bacteria | 4105 |
| 266 | Ga0501067_0015398 | 3300049583 | Bacteria | 4233 |
| 267 | Ga0501067_0138200 | 3300049583 | Bacteria | 1356 |
| 268 | Ga0501069_0119943 | 3300049585 | Bacteria | 1502 |
| 269 | Ga0501070_0226927 | 3300049586 | Bacteria | 1531 |
| 270 | Ga0501071_0040336 | 3300049587 | Bacteria | 3341 |
| 271 | Ga0501071_0057396 | 3300049587 | Bacteria | 2813 |
| 272 | Ga0501072_0058337 | 3300049588 | Bacteria | 3042 |
| 273 | Ga0501075_0001433 | 3300049591 | Bacteria | 15505 |
| 274 | Ga0501075_0015849 | 3300049591 | Bacteria | 5421 |
| 275 | Ga0501076_0029336 | 3300049592 | Bacteria | 4278 |
| 276 | Ga0501076_0045312 | 3300049592 | Bacteria | 3472 |
| 277 | Ga0501076_0558546 | 3300049592 | Unclassified | 944 |
| 278 | Ga0501077_0003991 | 3300049593 | Bacteria | 8904 |
| 279 | Ga0501077_0023693 | 3300049593 | Bacteria | 3892 |
| 280 | Ga0501077_0037912 | 3300049593 | Bacteria | 3069 |
| 281 | Ga0501247_001263 | 3300049677 | Unclassified | 2381 |
| 282 | Ga0501221_002832 | 3300049704 | Bacteria | 2856 |
| 283 | Ga0501234_011486 | 3300049707 | Unclassified | 1385 |
| 284 | Ga0501079_0006582 | 3300049741 | Bacteria | 8739 |
| 285 | Ga0501079_0007243 | 3300049741 | Bacteria | 8373 |
| 286 | Ga0501079_0082737 | 3300049741 | Bacteria | 2483 |
| 287 | Ga0501079_0158219 | 3300049741 | Unclassified | 1766 |
| 288 | Ga0501079_0170862 | 3300049741 | Unclassified | 1695 |
| 289 | Ga0501080_0069384 | 3300049742 | Bacteria | 3278 |
| 290 | Ga0501080_0111426 | 3300049742 | Bacteria | 2537 |
| 291 | Ga0501080_0185517 | 3300049742 | Bacteria | 1913 |
| 292 | Ga0501080_0234907 | 3300049742 | Bacteria | 1675 |
| 293 | Ga0501081_0003935 | 3300049743 | Bacteria | 9521 |
| 294 | Ga0501081_0025510 | 3300049743 | Bacteria | 3976 |
| 295 | Ga0501081_0032766 | 3300049743 | Bacteria | 3527 |
| 296 | Ga0501268_000345 | 3300049765 | Bacteria | 4822 |
| 297 | Ga0501272_003141 | 3300049769 | Unclassified | 1667 |
| 298 | Ga0501035_0060420 | 3300049822 | Bacteria | 3374 |
| 299 | Ga0501045_0032122 | 3300049824 | Bacteria | 3803 |
| 300 | Ga0501045_0149060 | 3300049824 | Bacteria | 1740 |
| 301 | nmdc:mga05p37_178553_c1 | 3300050507 | Bacteria | 2585 |
| 302 | nmdc:mga05p37_558_c1 | 3300050507 | Bacteria | 40956 |
| 303 | nmdc:mga05p37_85700_c1 | 3300050507 | Unclassified | 3882 |
| 304 | nmdc:mga09592_10838_c1 | 3300050508 | Bacteria | 7417 |
| 305 | nmdc:mga09592_56824_c1 | 3300050508 | Bacteria | 3307 |
| 306 | nmdc:mga0qj67_89905_c1 | 3300050509 | Bacteria | 2466 |
| 307 | nmdc:mga06r32_65391_c1 | 3300050510 | Bacteria | 3507 |
| 308 | nmdc:mga0n895_152917_c1 | 3300050512 | Bacteria | 2338 |
| 309 | nmdc:mga0n895_25277_c1 | 3300050512 | Bacteria | 5609 |
| 310 | nmdc:mga0n895_275806_c1 | 3300050512 | Unclassified | 1705 |
| 311 | nmdc:mga0rr50_318192_c1 | 3300050513 | Bacteria | 1304 |
| 312 | nmdc:mga0rr50_50624_c1 | 3300050513 | Bacteria | 3078 |
| 313 | nmdc:mga08x19_181553_c1 | 3300050514 | Bacteria | 1437 |
| 314 | nmdc:mga0a205_104716_c1 | 3300050515 | Unclassified | 2728 |
| 315 | nmdc:mga0a205_19285_c1 | 3300050515 | Bacteria | 6427 |
| 316 | Ga0501084_0146658 | 3300054114 | Bacteria | 1988 |
| 317 | Ga0590071_000173 | 3300059421 | Bacteria | 18614 |
| 318 | Ga0590074_003758 | 3300059423 | Bacteria | 2514 |
| 319 | Ga0590074_020800 | 3300059423 | Unclassified | 1130 |
| 320 | Ga0590075_021046 | 3300059424 | Bacteria | 1625 |
| 321 | Ga0590077_023457 | 3300059426 | Unclassified | 1321 |
| 322 | Ga0501082_0010946 | 3300060353 | Bacteria | 7807 |
| 323 | Ga0501082_0051635 | 3300060353 | Bacteria | 3544 |
| 324 | Ga0501082_0106776 | 3300060353 | Bacteria | 2422 |
| 325 | Ga0501082_0147934 | 3300060353 | Unclassified | 2040 |
| 326 | Ga0501082_0554767 | 3300060353 | Bacteria | 1005 |
| 327 | Ga0530510_0074758 | 3300061734 | Bacteria | 2460 |
| 328 | Ga0530510_0453125 | 3300061734 | Bacteria | 970 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0298769 | Ga0496107_0298769_19_768 | 248 |
| 2 | 3300009147 | Ga0114129_10342900 | Ga0114129_103429004 | 250 |
| 3 | 3300049569 | Ga0501032_0263551 | Ga0501032_0263551_294_1049 | 251 |
| 4 | 3300005518 | Ga0070699_100091459 | Ga0070699_1000914594 | 252 |
| 5 | 3300006871 | Ga0075434_100023725 | Ga0075434_1000237257 | 252 |
| 6 | 3300050512 | nmdc:mga0n895_152917_c1 | nmdc:mga0n895_152917_c1_1169_1933 | 252 |
| 7 | 3300005441 | Ga0070700_100153182 | Ga0070700_1001531823 | 253 |
| 8 | 3300005549 | Ga0070704_100278065 | Ga0070704_1002780653 | 253 |
| 9 | 3300025922 | Ga0207646_10036537 | Ga0207646_100365373 | 253 |
| 10 | 3300005438 | Ga0070701_10078036 | Ga0070701_100780363 | 255 |
| 11 | 3300005445 | Ga0070708_100089165 | Ga0070708_1000891651 | 255 |
| 12 | 3300005468 | Ga0070707_100000581 | Ga0070707_10000058123 | 255 |
| 13 | 3300005468 | Ga0070707_100108920 | Ga0070707_1001089203 | 255 |
| 14 | 3300005468 | Ga0070707_100405080 | Ga0070707_1004050801 | 255 |
| 15 | 3300005471 | Ga0070698_100325076 | Ga0070698_1003250762 | 255 |
| 16 | 3300005518 | Ga0070699_100000727 | Ga0070699_1000007271 | 255 |
| 17 | 3300005617 | Ga0068859_100509364 | Ga0068859_1005093642 | 255 |
| 18 | 3300005719 | Ga0068861_100457443 | Ga0068861_1004574432 | 255 |
| 19 | 3300006847 | Ga0075431_100184048 | Ga0075431_1001840482 | 255 |
| 20 | 3300006880 | Ga0075429_100048793 | Ga0075429_1000487932 | 255 |
| 21 | 3300006931 | Ga0097620_100509335 | Ga0097620_1005093352 | 255 |
| 22 | 3300025922 | Ga0207646_10086350 | Ga0207646_100863503 | 255 |
| 23 | 3300025922 | Ga0207646_10191951 | Ga0207646_101919512 | 255 |
| 24 | 3300025922 | Ga0207646_10231397 | Ga0207646_102313972 | 255 |
| 25 | 3300005549 | Ga0070704_100025252 | Ga0070704_1000252524 | 256 |
| 26 | 3300009147 | Ga0114129_10038746 | Ga0114129_100387467 | 256 |
| 27 | 3300009553 | Ga0105249_10277243 | Ga0105249_102772433 | 256 |
| 28 | 3300049568 | Ga0501031_0175599 | Ga0501031_0175599_221_991 | 256 |
| 29 | 3300049580 | Ga0501046_0048829 | Ga0501046_0048829_1863_2633 | 256 |
| 30 | 3300049587 | Ga0501071_0040336 | Ga0501071_0040336_2175_2945 | 256 |
| 31 | 3300050508 | nmdc:mga09592_10838_c1 | nmdc:mga09592_10838_c1_6299_7078 | 256 |
| 32 | 3300050510 | nmdc:mga06r32_65391_c1 | nmdc:mga06r32_65391_c1_10_789 | 256 |
| 33 | 3300060353 | Ga0501082_0106776 | Ga0501082_0106776_684_1454 | 256 |
| 34 | 3300009147 | Ga0114129_10160475 | Ga0114129_101604754 | 257 |
| 35 | 3300049576 | Ga0501040_0011188 | Ga0501040_0011188_2564_3337 | 257 |
| 36 | 3300049577 | Ga0501041_0018913 | Ga0501041_0018913_1345_2118 | 257 |
| 37 | 3300049577 | Ga0501041_0095079 | Ga0501041_0095079_606_1379 | 257 |
| 38 | 3300049580 | Ga0501046_0106245 | Ga0501046_0106245_590_1363 | 257 |
| 39 | 3300049580 | Ga0501046_0320881 | Ga0501046_0320881_301_1074 | 257 |
| 40 | 3300049587 | Ga0501071_0057396 | Ga0501071_0057396_207_980 | 257 |
| 41 | 3300049588 | Ga0501072_0058337 | Ga0501072_0058337_1033_1806 | 257 |
| 42 | 3300049591 | Ga0501075_0001433 | Ga0501075_0001433_13388_14161 | 257 |
| 43 | 3300049591 | Ga0501075_0015849 | Ga0501075_0015849_2956_3729 | 257 |
| 44 | 3300049592 | Ga0501076_0045312 | Ga0501076_0045312_1360_2133 | 257 |
| 45 | 3300049593 | Ga0501077_0003991 | Ga0501077_0003991_5060_5833 | 257 |
| 46 | 3300049593 | Ga0501077_0023693 | Ga0501077_0023693_2049_2822 | 257 |
| 47 | 3300049741 | Ga0501079_0006582 | Ga0501079_0006582_7341_8114 | 257 |
| 48 | 3300049742 | Ga0501080_0234907 | Ga0501080_0234907_163_936 | 257 |
| 49 | 3300049743 | Ga0501081_0003935 | Ga0501081_0003935_7341_8114 | 257 |
| 50 | 3300049743 | Ga0501081_0025510 | Ga0501081_0025510_1100_1873 | 257 |
| 51 | 3300049822 | Ga0501035_0060420 | Ga0501035_0060420_2452_3225 | 257 |
| 52 | 3300049824 | Ga0501045_0149060 | Ga0501045_0149060_143_916 | 257 |
| 53 | 3300050507 | nmdc:mga05p37_178553_c1 | nmdc:mga05p37_178553_c1_974_1747 | 257 |
| 54 | 3300059421 | Ga0590071_000173 | Ga0590071_000173_7643_8416 | 257 |
| 55 | 3300059423 | Ga0590074_003758 | Ga0590074_003758_1439_2212 | 257 |
| 56 | 3300059424 | Ga0590075_021046 | Ga0590075_021046_372_1145 | 257 |
| 57 | 3300061734 | Ga0530510_0453125 | Ga0530510_0453125_59_832 | 257 |
| 58 | 3300049592 | Ga0501076_0558546 | Ga0501076_0558546_134_910 | 258 |
| 59 | 3300049741 | Ga0501079_0170862 | Ga0501079_0170862_21_797 | 258 |
| 60 | 3300049742 | Ga0501080_0185517 | Ga0501080_0185517_101_877 | 258 |
| 61 | 3300006880 | Ga0075429_100005168 | Ga0075429_1000051686 | 259 |
| 62 | 3300031901 | Ga0307406_10046628 | Ga0307406_100466284 | 259 |
| 63 | 3300031903 | Ga0307407_10074130 | Ga0307407_100741303 | 259 |
| 64 | 3300049572 | Ga0501036_0035368 | Ga0501036_0035368_1432_2217 | 259 |
| 65 | 3300049576 | Ga0501040_0040331 | Ga0501040_0040331_2215_3000 | 259 |
| 66 | 3300049577 | Ga0501041_0018135 | Ga0501041_0018135_1129_1914 | 259 |
| 67 | 3300049580 | Ga0501046_0039359 | Ga0501046_0039359_2256_3041 | 259 |
| 68 | 3300049582 | Ga0501048_0027834 | Ga0501048_0027834_3068_3853 | 259 |
| 69 | 3300049592 | Ga0501076_0029336 | Ga0501076_0029336_1859_2644 | 259 |
| 70 | 3300049593 | Ga0501077_0037912 | Ga0501077_0037912_1799_2584 | 259 |
| 71 | 3300049741 | Ga0501079_0007243 | Ga0501079_0007243_1771_2556 | 259 |
| 72 | 3300049742 | Ga0501080_0069384 | Ga0501080_0069384_104_889 | 259 |
| 73 | 3300049743 | Ga0501081_0032766 | Ga0501081_0032766_2263_3048 | 259 |
| 74 | 3300049824 | Ga0501045_0032122 | Ga0501045_0032122_1440_2225 | 259 |
| 75 | 3300050508 | nmdc:mga09592_56824_c1 | nmdc:mga09592_56824_c1_1415_2200 | 259 |
| 76 | 3300060353 | Ga0501082_0010946 | Ga0501082_0010946_6653_7438 | 259 |
| 77 | 3300061734 | Ga0530510_0074758 | Ga0530510_0074758_500_1285 | 259 |
| 78 | 3300025912 | Ga0207707_10104475 | Ga0207707_101044754 | 260 |
| 79 | 3300031824 | Ga0307413_10068322 | Ga0307413_100683223 | 260 |
| 80 | 3300032004 | Ga0307414_10037335 | Ga0307414_100373351 | 260 |
| 81 | 3300046455 | Ga0495603_0204463 | Ga0495603_0204463_300_1088 | 260 |
| 82 | 3300046473 | Ga0495582_0010807 | Ga0495582_0010807_724_1512 | 260 |
| 83 | 3300046475 | Ga0495639_0011941 | Ga0495639_0011941_220_1008 | 260 |
| 84 | 3300046477 | Ga0495664_0207147 | Ga0495664_0207147_94_882 | 260 |
| 85 | 3300046514 | Ga0495618_0151985 | Ga0495618_0151985_315_1103 | 260 |
| 86 | 3300046517 | Ga0495630_0008140 | Ga0495630_0008140_2374_3162 | 260 |
| 87 | 3300046526 | Ga0495666_0022810 | Ga0495666_0022810_1932_2720 | 260 |
| 88 | 3300046533 | Ga0495640_0025831 | Ga0495640_0025831_866_1654 | 260 |
| 89 | 3300046642 | Ga0495634_0014438 | Ga0495634_0014438_4836_5624 | 260 |
| 90 | 3300046681 | Ga0495647_0002912 | Ga0495647_0002912_2892_3680 | 260 |
| 91 | 3300046683 | Ga0495658_0002240 | Ga0495658_0002240_4470_5258 | 260 |
| 92 | 3300046689 | Ga0495613_0051224 | Ga0495613_0051224_1893_2681 | 260 |
| 93 | 3300046690 | Ga0495624_0068538 | Ga0495624_0068538_1206_1994 | 260 |
| 94 | 3300046809 | Ga0495600_0146006 | Ga0495600_0146006_396_1184 | 260 |
| 95 | 3300047319 | Ga0495674_0003564 | Ga0495674_0003564_961_1749 | 260 |
| 96 | 3300047322 | Ga0495680_0047384 | Ga0495680_0047384_424_1212 | 260 |
| 97 | 3300049583 | Ga0501067_0015398 | Ga0501067_0015398_2134_2919 | 260 |
| 98 | 3300049585 | Ga0501069_0119943 | Ga0501069_0119943_128_913 | 260 |
| 99 | 3300032005 | Ga0307411_10016005 | Ga0307411_100160054 | 261 |
| 100 | 3300049568 | Ga0501031_0157802 | Ga0501031_0157802_19_828 | 261 |
| 101 | 3300060353 | Ga0501082_0554767 | Ga0501082_0554767_36_863 | 261 |
| 102 | 3300049741 | Ga0501079_0158219 | Ga0501079_0158219_190_987 | 262 |
| 103 | 3300014325 | Ga0163163_10159492 | Ga0163163_101594923 | 263 |
| 104 | 3300034819 | Ga0373958_0022684 | Ga0373958_0022684_48_890 | 263 |
| 105 | 3300035088 | Ga0373940_0001948 | Ga0373940_0001948_919_1761 | 263 |
| 106 | 3300035114 | Ga0373939_0055500 | Ga0373939_0055500_236_1078 | 263 |
| 107 | 3300035691 | Ga0373931_0037664 | Ga0373931_0037664_1272_2114 | 263 |
| 108 | 3300048907 | Ga0496104_0124338 | Ga0496104_0124338_1363_2205 | 263 |
| 109 | 3300048911 | Ga0496108_0006026 | Ga0496108_0006026_6279_7121 | 263 |
| 110 | 3300048912 | Ga0496109_0001213 | Ga0496109_0001213_9909_10751 | 263 |
| 111 | 3300048913 | Ga0496110_0053412 | Ga0496110_0053412_1347_2189 | 263 |
| 112 | 3300048915 | Ga0496112_0037511 | Ga0496112_0037511_1604_2446 | 263 |
| 113 | 3300048916 | Ga0496113_0016472 | Ga0496113_0016472_2061_2903 | 263 |
| 114 | 3300050512 | nmdc:mga0n895_275806_c1 | nmdc:mga0n895_275806_c1_162_1004 | 263 |
| 115 | 3300025917 | Ga0207660_10207282 | Ga0207660_102072824 | 265 |
| 116 | 3300031995 | Ga0307409_100221683 | Ga0307409_1002216833 | 265 |
| 117 | 3300035084 | Ga0373928_0027306 | Ga0373928_0027306_152_994 | 265 |
| 118 | 3300048904 | Ga0496101_0247208 | Ga0496101_0247208_237_1037 | 265 |
| 119 | 3300048911 | Ga0496108_0132598 | Ga0496108_0132598_640_1440 | 265 |
| 120 | 3300048912 | Ga0496109_0024561 | Ga0496109_0024561_348_1148 | 265 |
| 121 | 3300048914 | Ga0496111_0001192 | Ga0496111_0001192_1388_2188 | 265 |
| 122 | 3300048915 | Ga0496112_0468808 | Ga0496112_0468808_185_985 | 265 |
| 123 | 3300050513 | nmdc:mga0rr50_318192_c1 | nmdc:mga0rr50_318192_c1_33_836 | 265 |
| 124 | 3300009147 | Ga0114129_10084935 | Ga0114129_100849355 | 270 |
| 125 | 3300014325 | Ga0163163_10121141 | Ga0163163_101211412 | 270 |
| 126 | 3300050507 | nmdc:mga05p37_85700_c1 | nmdc:mga05p37_85700_c1_2110_2931 | 270 |
| 127 | 3300049586 | Ga0501070_0226927 | Ga0501070_0226927_220_1047 | 272 |
| 128 | 3300005445 | Ga0070708_100052601 | Ga0070708_1000526015 | 274 |
| 129 | 3300005468 | Ga0070707_100504337 | Ga0070707_1005043372 | 274 |
| 130 | 3300006846 | Ga0075430_100260736 | Ga0075430_1002607362 | 274 |
| 131 | 3300009553 | Ga0105249_10062862 | Ga0105249_100628624 | 274 |
| 132 | 3300013306 | Ga0163162_10235476 | Ga0163162_102354762 | 274 |
| 133 | 3300014968 | Ga0157379_10086329 | Ga0157379_100863294 | 274 |
| 134 | 3300031731 | Ga0307405_10047034 | Ga0307405_100470343 | 274 |
| 135 | 3300031824 | Ga0307413_10136542 | Ga0307413_101365423 | 274 |
| 136 | 3300031852 | Ga0307410_10015427 | Ga0307410_100154276 | 274 |
| 137 | 3300031995 | Ga0307409_100161634 | Ga0307409_1001616343 | 274 |
| 138 | 3300032002 | Ga0307416_100008115 | Ga0307416_1000081156 | 274 |
| 139 | 3300032004 | Ga0307414_10132073 | Ga0307414_101320733 | 274 |
| 140 | 3300042876 | Ga0451577_0088374 | Ga0451577_0088374_81_926 | 274 |
| 141 | 3300044712 | Ga0453684_0118376 | Ga0453684_0118376_848_1693 | 274 |
| 142 | 3300049742 | Ga0501080_0111426 | Ga0501080_0111426_287_1123 | 274 |
| 143 | 3300060353 | Ga0501082_0051635 | Ga0501082_0051635_1774_2610 | 274 |
| 144 | 3300005471 | Ga0070698_100326409 | Ga0070698_1003264092 | 275 |
| 145 | 3300026035 | Ga0207703_10488345 | Ga0207703_104883452 | 276 |
| 146 | 3300005440 | Ga0070705_100001551 | Ga0070705_1000015514 | 277 |
| 147 | 3300005444 | Ga0070694_100187677 | Ga0070694_1001876773 | 277 |
| 148 | 3300005471 | Ga0070698_100318197 | Ga0070698_1003181972 | 277 |
| 149 | 3300005518 | Ga0070699_100098594 | Ga0070699_1000985944 | 277 |
| 150 | 3300005546 | Ga0070696_100019623 | Ga0070696_1000196235 | 277 |
| 151 | 3300005549 | Ga0070704_100000999 | Ga0070704_1000009994 | 277 |
| 152 | 3300049583 | Ga0501067_0138200 | Ga0501067_0138200_243_1082 | 277 |
| 153 | 3300049741 | Ga0501079_0082737 | Ga0501079_0082737_1209_2051 | 277 |
| 154 | 3300005471 | Ga0070698_100025160 | Ga0070698_1000251606 | 278 |
| 155 | 3300005518 | Ga0070699_100120776 | Ga0070699_1001207762 | 278 |
| 156 | 3300005547 | Ga0070693_100061646 | Ga0070693_1000616464 | 278 |
| 157 | 3300006871 | Ga0075434_100271907 | Ga0075434_1002719074 | 278 |
| 158 | 3300006880 | Ga0075429_100237285 | Ga0075429_1002372852 | 278 |
| 159 | 3300031911 | Ga0307412_10022403 | Ga0307412_100224032 | 278 |
| 160 | 3300048904 | Ga0496101_0026268 | Ga0496101_0026268_1520_2359 | 278 |
| 161 | 3300050509 | nmdc:mga0qj67_89905_c1 | nmdc:mga0qj67_89905_c1_1357_2196 | 278 |
| 162 | 3300005336 | Ga0070680_100197933 | Ga0070680_1001979333 | 281 |
| 163 | 3300005366 | Ga0070659_100035985 | Ga0070659_1000359854 | 281 |
| 164 | 3300005458 | Ga0070681_10366173 | Ga0070681_103661732 | 281 |
| 165 | 3300005530 | Ga0070679_100167441 | Ga0070679_1001674413 | 281 |
| 166 | 3300005577 | Ga0068857_100251059 | Ga0068857_1002510592 | 281 |
| 167 | 3300025912 | Ga0207707_10076094 | Ga0207707_100760945 | 281 |
| 168 | 3300025917 | Ga0207660_10038008 | Ga0207660_100380086 | 281 |
| 169 | 3300025921 | Ga0207652_10032460 | Ga0207652_100324604 | 281 |
| 170 | 3300025932 | Ga0207690_10026069 | Ga0207690_100260694 | 281 |
| 171 | 3300026067 | Ga0207678_10295969 | Ga0207678_102959693 | 281 |
| 172 | 3300026116 | Ga0207674_10427205 | Ga0207674_104272052 | 281 |
| 173 | 3300032002 | Ga0307416_100142569 | Ga0307416_1001425694 | 281 |
| 174 | 3300042876 | Ga0451577_0013691 | Ga0451577_0013691_5076_5924 | 281 |
| 175 | 3300048911 | Ga0496108_0121355 | Ga0496108_0121355_297_1154 | 281 |
| 176 | 3300048913 | Ga0496110_0254457 | Ga0496110_0254457_659_1516 | 281 |
| 177 | 3300005937 | Ga0081455_10089377 | Ga0081455_100893774 | 282 |
| 178 | 3300054114 | Ga0501084_0146658 | Ga0501084_0146658_748_1644 | 283 |
| 179 | 3300059423 | Ga0590074_020800 | Ga0590074_020800_183_1079 | 283 |
| 180 | 3300059426 | Ga0590077_023457 | Ga0590077_023457_46_942 | 283 |
| 181 | 3300060353 | Ga0501082_0147934 | Ga0501082_0147934_703_1599 | 283 |
| 182 | 3300005444 | Ga0070694_100210585 | Ga0070694_1002105852 | 285 |
| 183 | 3300005518 | Ga0070699_100033955 | Ga0070699_1000339556 | 285 |
| 184 | 3300005536 | Ga0070697_100005983 | Ga0070697_10000598310 | 285 |
| 185 | 3300005545 | Ga0070695_100012744 | Ga0070695_1000127445 | 285 |
| 186 | 3300005546 | Ga0070696_100000228 | Ga0070696_10000022840 | 285 |
| 187 | 3300005549 | Ga0070704_100074104 | Ga0070704_1000741043 | 285 |
| 188 | 3300006852 | Ga0075433_10020064 | Ga0075433_100200648 | 285 |
| 189 | 3300031995 | Ga0307409_100152617 | Ga0307409_1001526172 | 285 |
| 190 | 3300050515 | nmdc:mga0a205_19285_c1 | nmdc:mga0a205_19285_c1_3013_3888 | 285 |
| 191 | 3300005331 | Ga0070670_100058867 | Ga0070670_1000588676 | 286 |
| 192 | 3300005333 | Ga0070677_10058555 | Ga0070677_100585553 | 286 |
| 193 | 3300005354 | Ga0070675_100138902 | Ga0070675_1001389023 | 286 |
| 194 | 3300005564 | Ga0070664_100146690 | Ga0070664_1001466902 | 286 |
| 195 | 3300025893 | Ga0207682_10029222 | Ga0207682_100292224 | 286 |
| 196 | 3300025916 | Ga0207663_10288656 | Ga0207663_102886562 | 286 |
| 197 | 3300025925 | Ga0207650_10431191 | Ga0207650_104311912 | 286 |
| 198 | 3300025938 | Ga0207704_10003675 | Ga0207704_100036755 | 286 |
| 199 | 3300048905 | Ga0496102_0497995 | Ga0496102_0497995_253_1116 | 286 |
| 200 | 3300048915 | Ga0496112_0167232 | Ga0496112_0167232_607_1470 | 286 |
| 201 | 3300005328 | Ga0070676_10004122 | Ga0070676_100041227 | 287 |
| 202 | 3300005330 | Ga0070690_100015188 | Ga0070690_1000151884 | 287 |
| 203 | 3300005334 | Ga0068869_100007486 | Ga0068869_1000074865 | 287 |
| 204 | 3300005341 | Ga0070691_10059086 | Ga0070691_100590863 | 287 |
| 205 | 3300005356 | Ga0070674_100002772 | Ga0070674_1000027729 | 287 |
| 206 | 3300005364 | Ga0070673_100025416 | Ga0070673_1000254164 | 287 |
| 207 | 3300005438 | Ga0070701_10089600 | Ga0070701_100896003 | 287 |
| 208 | 3300005440 | Ga0070705_100003772 | Ga0070705_1000037724 | 287 |
| 209 | 3300005444 | Ga0070694_100008733 | Ga0070694_1000087336 | 287 |
| 210 | 3300005455 | Ga0070663_100112215 | Ga0070663_1001122152 | 287 |
| 211 | 3300005456 | Ga0070678_100083437 | Ga0070678_1000834371 | 287 |
| 212 | 3300005457 | Ga0070662_100008256 | Ga0070662_1000082562 | 287 |
| 213 | 3300005459 | Ga0068867_100032774 | Ga0068867_1000327745 | 287 |
| 214 | 3300005468 | Ga0070707_100335375 | Ga0070707_1003353752 | 287 |
| 215 | 3300005544 | Ga0070686_100078286 | Ga0070686_1000782864 | 287 |
| 216 | 3300005545 | Ga0070695_100004874 | Ga0070695_1000048745 | 287 |
| 217 | 3300005546 | Ga0070696_100002289 | Ga0070696_10000228911 | 287 |
| 218 | 3300005549 | Ga0070704_100191342 | Ga0070704_1001913423 | 287 |
| 219 | 3300005578 | Ga0068854_100001930 | Ga0068854_1000019305 | 287 |
| 220 | 3300005615 | Ga0070702_100014722 | Ga0070702_1000147222 | 287 |
| 221 | 3300005618 | Ga0068864_100029554 | Ga0068864_1000295544 | 287 |
| 222 | 3300005718 | Ga0068866_10000165 | Ga0068866_1000016512 | 287 |
| 223 | 3300005840 | Ga0068870_10038040 | Ga0068870_100380403 | 287 |
| 224 | 3300005842 | Ga0068858_100092635 | Ga0068858_1000926353 | 287 |
| 225 | 3300005843 | Ga0068860_100144242 | Ga0068860_1001442423 | 287 |
| 226 | 3300006237 | Ga0097621_100082643 | Ga0097621_1000826434 | 287 |
| 227 | 3300006358 | Ga0068871_100060915 | Ga0068871_1000609154 | 287 |
| 228 | 3300006852 | Ga0075433_10322657 | Ga0075433_103226571 | 287 |
| 229 | 3300006881 | Ga0068865_100001488 | Ga0068865_1000014886 | 287 |
| 230 | 3300009093 | Ga0105240_10209172 | Ga0105240_102091722 | 287 |
| 231 | 3300009148 | Ga0105243_10003787 | Ga0105243_1000378714 | 287 |
| 232 | 3300009174 | Ga0105241_10006356 | Ga0105241_100063564 | 287 |
| 233 | 3300009176 | Ga0105242_10010817 | Ga0105242_100108172 | 287 |
| 234 | 3300009177 | Ga0105248_10027223 | Ga0105248_100272231 | 287 |
| 235 | 3300009553 | Ga0105249_10101033 | Ga0105249_101010334 | 287 |
| 236 | 3300011119 | Ga0105246_10004556 | Ga0105246_100045565 | 287 |
| 237 | 3300013297 | Ga0157378_10013245 | Ga0157378_100132457 | 287 |
| 238 | 3300013306 | Ga0163162_10112913 | Ga0163162_101129134 | 287 |
| 239 | 3300013307 | Ga0157372_10381045 | Ga0157372_103810453 | 287 |
| 240 | 3300014326 | Ga0157380_10055284 | Ga0157380_100552842 | 287 |
| 241 | 3300014968 | Ga0157379_10026519 | Ga0157379_100265194 | 287 |
| 242 | 3300025899 | Ga0207642_10004570 | Ga0207642_100045705 | 287 |
| 243 | 3300025907 | Ga0207645_10000654 | Ga0207645_1000065424 | 287 |
| 244 | 3300025908 | Ga0207643_10007065 | Ga0207643_100070656 | 287 |
| 245 | 3300025911 | Ga0207654_10085227 | Ga0207654_100852274 | 287 |
| 246 | 3300025922 | Ga0207646_10511945 | Ga0207646_105119452 | 287 |
| 247 | 3300025926 | Ga0207659_10104125 | Ga0207659_101041253 | 287 |
| 248 | 3300025933 | Ga0207706_10000244 | Ga0207706_1000024419 | 287 |
| 249 | 3300025934 | Ga0207686_10000739 | Ga0207686_100007392 | 287 |
| 250 | 3300025935 | Ga0207709_10023470 | Ga0207709_100234703 | 287 |
| 251 | 3300025937 | Ga0207669_10003993 | Ga0207669_100039935 | 287 |
| 252 | 3300025941 | Ga0207711_10072315 | Ga0207711_100723154 | 287 |
| 253 | 3300025942 | Ga0207689_10004041 | Ga0207689_100040416 | 287 |
| 254 | 3300025960 | Ga0207651_10021551 | Ga0207651_100215514 | 287 |
| 255 | 3300025961 | Ga0207712_10009486 | Ga0207712_100094862 | 287 |
| 256 | 3300025961 | Ga0207712_10119831 | Ga0207712_101198313 | 287 |
| 257 | 3300026035 | Ga0207703_10041356 | Ga0207703_100413565 | 287 |
| 258 | 3300026067 | Ga0207678_10139017 | Ga0207678_101390172 | 287 |
| 259 | 3300026089 | Ga0207648_10000273 | Ga0207648_1000027342 | 287 |
| 260 | 3300026095 | Ga0207676_10006035 | Ga0207676_100060353 | 287 |
| 261 | 3300026118 | Ga0207675_100038542 | Ga0207675_1000385425 | 287 |
| 262 | 3300026118 | Ga0207675_100261865 | Ga0207675_1002618652 | 287 |
| 263 | 3300026121 | Ga0207683_10116333 | Ga0207683_101163332 | 287 |
| 264 | 3300028380 | Ga0268265_10036014 | Ga0268265_100360143 | 287 |
| 265 | 3300028381 | Ga0268264_10018693 | Ga0268264_100186935 | 287 |
| 266 | 3300046499 | Ga0495594_0042348 | Ga0495594_0042348_938_1876 | 287 |
| 267 | 3300046557 | Ga0495622_0070930 | Ga0495622_0070930_45_983 | 287 |
| 268 | 3300048905 | Ga0496102_0142978 | Ga0496102_0142978_193_1131 | 287 |
| 269 | 3300048910 | Ga0496107_0121100 | Ga0496107_0121100_64_1002 | 287 |
| 270 | 3300048917 | Ga0496114_0362387 | Ga0496114_0362387_250_1188 | 287 |
| 271 | 3300005440 | Ga0070705_100010233 | Ga0070705_1000102332 | 288 |
| 272 | 3300005445 | Ga0070708_100000511 | Ga0070708_10000051127 | 288 |
| 273 | 3300005467 | Ga0070706_100003657 | Ga0070706_10000365720 | 288 |
| 274 | 3300005468 | Ga0070707_100001574 | Ga0070707_10000157427 | 288 |
| 275 | 3300005518 | Ga0070699_100004841 | Ga0070699_10000484112 | 288 |
| 276 | 3300005536 | Ga0070697_100156453 | Ga0070697_1001564532 | 288 |
| 277 | 3300005546 | Ga0070696_100101324 | Ga0070696_1001013243 | 288 |
| 278 | 3300025910 | Ga0207684_10008479 | Ga0207684_100084799 | 288 |
| 279 | 3300025922 | Ga0207646_10025599 | Ga0207646_100255996 | 288 |
| 280 | 3300031548 | Ga0307408_100062145 | Ga0307408_1000621453 | 288 |
| 281 | 3300031548 | Ga0307408_100236707 | Ga0307408_1002367072 | 288 |
| 282 | 3300031548 | Ga0307408_100401059 | Ga0307408_1004010592 | 288 |
| 283 | 3300031824 | Ga0307413_10063447 | Ga0307413_100634474 | 288 |
| 284 | 3300031852 | Ga0307410_10001254 | Ga0307410_1000125412 | 288 |
| 285 | 3300031901 | Ga0307406_10093122 | Ga0307406_100931223 | 288 |
| 286 | 3300031903 | Ga0307407_10025855 | Ga0307407_100258553 | 288 |
| 287 | 3300031995 | Ga0307409_100012136 | Ga0307409_1000121366 | 288 |
| 288 | 3300032002 | Ga0307416_100086655 | Ga0307416_1000866553 | 288 |
| 289 | 3300032002 | Ga0307416_100141174 | Ga0307416_1001411743 | 288 |
| 290 | 3300032005 | Ga0307411_10002992 | Ga0307411_100029927 | 288 |
| 291 | 3300032126 | Ga0307415_100001883 | Ga0307415_10000188312 | 288 |
| 292 | 3300049677 | Ga0501247_001263 | Ga0501247_001263_620_1489 | 288 |
| 293 | 3300049704 | Ga0501221_002832 | Ga0501221_002832_1232_2101 | 288 |
| 294 | 3300049707 | Ga0501234_011486 | Ga0501234_011486_229_1098 | 288 |
| 295 | 3300049765 | Ga0501268_000345 | Ga0501268_000345_1959_2828 | 288 |
| 296 | 3300049769 | Ga0501272_003141 | Ga0501272_003141_361_1230 | 288 |
| 297 | 3300007076 | Ga0075435_100217138 | Ga0075435_1002171381 | 289 |
| 298 | 3300005293 | Ga0065715_10106576 | Ga0065715_101065764 | 290 |
| 299 | 3300005440 | Ga0070705_100024462 | Ga0070705_1000244622 | 290 |
| 300 | 3300005444 | Ga0070694_100039668 | Ga0070694_1000396682 | 290 |
| 301 | 3300005546 | Ga0070696_100019922 | Ga0070696_1000199224 | 290 |
| 302 | 3300005549 | Ga0070704_100009307 | Ga0070704_1000093076 | 290 |
| 303 | 3300006847 | Ga0075431_100170539 | Ga0075431_1001705394 | 290 |
| 304 | 3300006852 | Ga0075433_10047107 | Ga0075433_100471072 | 290 |
| 305 | 3300006871 | Ga0075434_100027226 | Ga0075434_1000272264 | 290 |
| 306 | 3300006871 | Ga0075434_100263730 | Ga0075434_1002637302 | 290 |
| 307 | 3300006914 | Ga0075436_100095248 | Ga0075436_1000952482 | 290 |
| 308 | 3300007076 | Ga0075435_100071596 | Ga0075435_1000715962 | 290 |
| 309 | 3300009147 | Ga0114129_10000442 | Ga0114129_1000044246 | 290 |
| 310 | 3300010375 | Ga0105239_10009184 | Ga0105239_100091849 | 290 |
| 311 | 3300048904 | Ga0496101_0014898 | Ga0496101_0014898_1288_2160 | 290 |
| 312 | 3300048905 | Ga0496102_0001888 | Ga0496102_0001888_1534_2406 | 290 |
| 313 | 3300048905 | Ga0496102_0046661 | Ga0496102_0046661_1603_2475 | 290 |
| 314 | 3300048907 | Ga0496104_0002618 | Ga0496104_0002618_10759_11631 | 290 |
| 315 | 3300048908 | Ga0496105_0002410 | Ga0496105_0002410_10960_11832 | 290 |
| 316 | 3300048909 | Ga0496106_0056922 | Ga0496106_0056922_104_976 | 290 |
| 317 | 3300048911 | Ga0496108_0015227 | Ga0496108_0015227_1613_2485 | 290 |
| 318 | 3300048912 | Ga0496109_0001371 | Ga0496109_0001371_16301_17173 | 290 |
| 319 | 3300048913 | Ga0496110_0000477 | Ga0496110_0000477_13644_14516 | 290 |
| 320 | 3300048914 | Ga0496111_0001070 | Ga0496111_0001070_3743_4615 | 290 |
| 321 | 3300048915 | Ga0496112_0019272 | Ga0496112_0019272_2797_3669 | 290 |
| 322 | 3300048916 | Ga0496113_0009449 | Ga0496113_0009449_4417_5289 | 290 |
| 323 | 3300048918 | Ga0496115_0065813 | Ga0496115_0065813_1012_1884 | 290 |
| 324 | 3300050507 | nmdc:mga05p37_558_c1 | nmdc:mga05p37_558_c1_15173_16045 | 290 |
| 325 | 3300050512 | nmdc:mga0n895_25277_c1 | nmdc:mga0n895_25277_c1_2706_3578 | 290 |
| 326 | 3300050513 | nmdc:mga0rr50_50624_c1 | nmdc:mga0rr50_50624_c1_930_1802 | 290 |
| 327 | 3300050514 | nmdc:mga08x19_181553_c1 | nmdc:mga08x19_181553_c1_97_969 | 290 |
| 328 | 3300050515 | nmdc:mga0a205_104716_c1 | nmdc:mga0a205_104716_c1_1727_2599 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e0f-assembly1.cif.gz_A | crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution | 0.9121 | 12 | 277 |
| 2yb4-assembly1.cif.gz_A | structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal | 0.8618 | 12 | 282 |
| 3e0f-assembly1.cif.gz_A | crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution | 0.8477 | 12 | 277 |
| 2yb4-assembly1.cif.gz_A | structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal | 0.8215 | 12 | 282 |
| 7ug9-assembly1.cif.gz_A | crystal structure of rnase am php domain | 0.8021 | 11 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yb4A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.902 | 107 | 176 | 1.10.150.650 |
| 3o0fA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.8771 | 106 | 176 | 1.10.150.650 |
| 3e0fA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8668 | 12 | 277 | 3.20.20.140 |
| 2yb4A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.8571 | 107 | 176 | 1.10.150.650 |
| 3o0fA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.8443 | 106 | 176 | 1.10.150.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9FEC2-F1-model_v4 | PHP domain-containing protein | 0.9855 | 9 | 287 |
GO:0004534
GO:0035312 |
| AF-A0A524AFZ6-F1-model_v4 | PHP domain-containing protein | 0.9828 | 10 | 179 |
GO:0004534
GO:0035312 |
| AF-A0A661K3U6-F1-model_v4 | PHP domain-containing protein | 0.9794 | 11 | 87 |
GO:0004534
GO:0035312 |
| AF-A0A1Q7CEI4-F1-model_v4 | Polymerase/histidinol phosphatase N-terminal domain-containing protein | 0.9792 | 8 | 179 |
GO:0004534
GO:0035312 |
| AF-A0A2V7IYT8-F1-model_v4 | Polymerase/histidinol phosphatase N-terminal domain-containing protein | 0.977 | 8 | 279 |
GO:0004534
GO:0035312 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar