F408995

General Info

Members Datasets Scaffolds Average Seq Length
327 237 292 464

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_000224|Ga0500608_000224_3179_4726
Length 515
Sequence VVLPKDGQAQRLSIQHQLCVATSPPDLTIRSSRGGFFTLFTRHQGNGAMDGVRGIKRAIAATLLASVALAGCGKGSGDQAKPAASANGIEKPTLKLGFIKLTDIAPLVVAQEKGFFKDEGLTVTLEPQANWKVLLDGVTGGQLDGAHMLAGQVLASGAGIGSKVPLVTPFSLDINGKGVTVSNQVWDMIAPTLPKGPDGKVQMPISAEALKPVVAKFKAEGKPFKMGMVFPVSTHNYILRYWLAAGGLNPGYYLPADTAGVTGAEVQLSVTPPPQMPSTMEAGTINGYSVGEPWNQASVAKKIGVPIIVDPDIAGTTGDKVFGLTAEFAKKNPNTVKAITRALIRASMWLDADGGKNRPEAVKLLANSKYVGADEKVLMASMTGSFTFGAGDTRSTPEFNLFFNQQASYPFYSDGIWFLTQMRRWGQIPDDKSDQWYLDTVKSVYREDLYDEAAKSLVADGKAKAEDFPKTDGFRVYAHKAIDGVPFDAHKPAAYAASFTIGLKPGQKVTPAGVK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
5 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
6 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
7 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
8 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
9 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
10 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
14 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
15 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
16 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
17 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
18 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
19 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
20 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
21 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
22 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
23 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
24 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
25 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
26 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
27 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
28 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
29 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
30 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
31 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
101 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
164 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
165 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
231 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
234 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
235 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
236 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
237 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 1.83
Isolates 10.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 2.75
Rhizoplane 2.45
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 13.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_539634 2162886007 Bacteria 21292
2 JGI24751J29686_10000134 3300002459 Bacteria 37360
3 JGI25153J46596_10000010 3300003215 Bacteria 337769
4 rootH2_10012658 3300003320 Bacteria 82320
5 rootH1_10267483 3300003323 Bacteria 4689
6 Ga0055531_10019110 3300003794 Bacteria 2792
7 Ga0065704_10000191 3300005289 Bacteria 318191
8 Ga0065707_10083905 3300005295 Bacteria 8009
9 Ga0065707_10133118 3300005295 Bacteria 1887
10 Ga0070658_10000486 3300005327 Bacteria 34470
11 Ga0070683_100011322 3300005329 Bacteria 7704
12 Ga0070683_100211797 3300005329 Bacteria 1841
13 Ga0070690_100005887 3300005330 Bacteria 6915
14 Ga0070670_100020715 3300005331 Bacteria 5655
15 Ga0068868_100010709 3300005338 Bacteria 6647
16 Ga0070689_100009668 3300005340 Bacteria 6841
17 Ga0070691_10052180 3300005341 Bacteria 1955
18 Ga0070669_100069163 3300005353 Bacteria 2607
19 Ga0070675_100005379 3300005354 Bacteria 9785
20 Ga0070675_100051956 3300005354 Bacteria 3369
21 Ga0070671_100028552 3300005355 Bacteria 4595
22 Ga0070674_100069854 3300005356 Bacteria 2479
23 Ga0070673_100035714 3300005364 Bacteria 3770
24 Ga0070673_100110931 3300005364 Bacteria 2275
25 Ga0070688_100044936 3300005365 Bacteria 2727
26 Ga0070667_100001223 3300005367 Bacteria 23386
27 Ga0070705_100054996 3300005440 Bacteria 2337
28 Ga0070678_100056657 3300005456 Bacteria 2868
29 Ga0068867_100102628 3300005459 Bacteria 2186
30 Ga0070685_10028263 3300005466 Bacteria 3107
31 Ga0070699_100006662 3300005518 Bacteria 10041
32 Ga0070672_100005632 3300005543 Bacteria 8336
33 Ga0070672_100103764 3300005543 Bacteria 2309
34 Ga0070686_100013313 3300005544 Bacteria 4705
35 Ga0068855_100031451 3300005563 Bacteria 6337
36 Ga0068855_100115257 3300005563 Bacteria 3081
37 Ga0070664_100000900 3300005564 Bacteria 23120
38 Ga0068854_100000459 3300005578 Bacteria 25127
39 Ga0068856_100000776 3300005614 Bacteria 34703
40 Ga0068856_100011271 3300005614 Bacteria 8677
41 Ga0068856_100013718 3300005614 Bacteria 7834
42 Ga0070702_100007747 3300005615 Bacteria 5159
43 Ga0068852_100000231 3300005616 Bacteria 37728
44 Ga0068852_100019858 3300005616 Bacteria 5330
45 Ga0068852_100098575 3300005616 Bacteria 2632
46 Ga0068859_100003052 3300005617 Bacteria 16996
47 Ga0068870_10004252 3300005840 Bacteria 6154
48 Ga0068863_100005703 3300005841 Bacteria 12224
49 Ga0068863_100147282 3300005841 Bacteria 2252
50 Ga0068858_100001710 3300005842 Bacteria 22428
51 Ga0068858_100057350 3300005842 Bacteria 3599
52 Ga0068860_100004891 3300005843 Bacteria 13657
53 Ga0068860_100009817 3300005843 Bacteria 9501
54 Ga0068860_100083230 3300005843 Bacteria 3043
55 Ga0068862_100000095 3300005844 Bacteria 105957
56 Ga0068862_100004950 3300005844 Bacteria 11216
57 Ga0068862_100006952 3300005844 Bacteria 9389
58 Ga0081455_10064098 3300005937 Bacteria 3079
59 Ga0075368_10000041 3300006042 Bacteria 29722
60 Ga0075432_10001736 3300006058 Bacteria 7174
61 Ga0070712_100086488 3300006175 Bacteria 2285
62 Ga0075362_10000042 3300006177 Bacteria 45768
63 Ga0075362_10001396 3300006177 Bacteria 7673
64 Ga0075369_10001319 3300006186 Bacteria 8437
65 Ga0075366_10000086 3300006195 Bacteria 36542
66 Ga0075366_10008795 3300006195 Bacteria 5623
67 Ga0097621_100012010 3300006237 Bacteria 6409
68 Ga0097621_100076411 3300006237 Bacteria 2778
69 Ga0075370_10000026 3300006353 Bacteria 51806
70 Ga0075370_10003519 3300006353 Bacteria 7469
71 Ga0068871_100061054 3300006358 Bacteria 3077
72 Ga0097620_100003052 3300006931 Bacteria 16996
73 Ga0105240_10013931 3300009093 Bacteria 11008
74 Ga0105240_10267262 3300009093 Bacteria 1971
75 Ga0105245_10003339 3300009098 Bacteria 14395
76 Ga0105247_10001474 3300009101 Bacteria 16937
77 Ga0114129_10034549 3300009147 Bacteria 7142
78 Ga0105243_10122182 3300009148 Bacteria 2197
79 Ga0105241_10036769 3300009174 Bacteria 3686
80 Ga0105248_10010752 3300009177 Bacteria 10102
81 Ga0105238_10006007 3300009551 Bacteria 12035
82 Ga0105249_10000079 3300009553 Bacteria 139904
83 Ga0105239_10153081 3300010375 Bacteria 2574
84 Ga0157374_10003995 3300013296 Bacteria 12394
85 Ga0157374_10155193 3300013296 Bacteria 2227
86 Ga0157372_10256815 3300013307 Bacteria 2029
87 Ga0157375_10001697 3300013308 Bacteria 18902
88 Ga0163163_10004421 3300014325 Bacteria 11982
89 Ga0157380_10071815 3300014326 Bacteria 2801
90 Ga0157380_10168607 3300014326 Bacteria 1910
91 Ga0157379_10002963 3300014968 Bacteria 14324
92 Ga0157379_10078162 3300014968 Bacteria 2963
93 Ga0157376_10052737 3300014969 Bacteria 3383
94 Ga0214544_1007743 3300021320 Bacteria 18523
95 Ga0214542_1000082 3300021321 Bacteria 120825
96 Ga0214543_1000075 3300021327 Bacteria 120861
97 Ga0209758_1000033 3300025297 Bacteria 469998
98 Ga0209758_1016919 3300025297 Bacteria 3670
99 Ga0209050_1004613 3300025298 Bacteria 9204
100 Ga0209257_1000237 3300025304 Bacteria 128812
101 Ga0207682_10000460 3300025893 Bacteria 18816
102 Ga0207680_10029494 3300025903 Bacteria 3083
103 Ga0207647_10016969 3300025904 Bacteria 4957
104 Ga0207645_10015834 3300025907 Bacteria 4997
105 Ga0207705_10000004 3300025909 Bacteria 705756
106 Ga0207693_10085513 3300025915 Bacteria 2470
107 Ga0207663_10140522 3300025916 Bacteria 1681
108 Ga0207659_10023892 3300025926 Bacteria 4087
109 Ga0207644_10005436 3300025931 Bacteria 8307
110 Ga0207686_10070370 3300025934 Bacteria 2248
111 Ga0207670_10021273 3300025936 Bacteria 4000
112 Ga0207691_10003078 3300025940 Bacteria 16275
113 Ga0207691_10085255 3300025940 Bacteria 2835
114 Ga0207691_10091825 3300025940 Bacteria 2719
115 Ga0207711_10082036 3300025941 Bacteria 2818
116 Ga0207689_10051691 3300025942 Bacteria 3387
117 Ga0207679_10068565 3300025945 Bacteria 2665
118 Ga0207667_10073620 3300025949 Bacteria 3549
119 Ga0207667_10115765 3300025949 Bacteria 2763
120 Ga0207651_10024624 3300025960 Bacteria 3727
121 Ga0207712_10000030 3300025961 Bacteria 216514
122 Ga0207668_10166690 3300025972 Bacteria 1723
123 Ga0207640_10000508 3300025981 Bacteria 23527
124 Ga0207658_10064520 3300025986 Bacteria 2747
125 Ga0207677_10060707 3300026023 Bacteria 2615
126 Ga0207703_10023384 3300026035 Bacteria 4853
127 Ga0207702_10004366 3300026078 Bacteria 12605
128 Ga0207702_10018238 3300026078 Bacteria 5806
129 Ga0207702_10059451 3300026078 Bacteria 3255
130 Ga0207641_10001899 3300026088 Bacteria 20063
131 Ga0207641_10004134 3300026088 Bacteria 12647
132 Ga0207648_10025130 3300026089 Bacteria 5311
133 Ga0207676_10025068 3300026095 Bacteria 4422
134 Ga0207674_10011136 3300026116 Bacteria 10115
135 Ga0207675_100084181 3300026118 Bacteria 2984
136 Ga0207675_100102841 3300026118 Bacteria 2692
137 Ga0207683_10021106 3300026121 Bacteria 5574
138 Ga0207683_10038214 3300026121 Bacteria 4182
139 Ga0207698_10000058 3300026142 Bacteria 78048
140 Ga0209813_10000435 3300027866 Bacteria 10213
141 Ga0268266_10038776 3300028379 Bacteria 4056
142 Ga0268265_10000132 3300028380 Bacteria 95410
143 Ga0268265_10008102 3300028380 Bacteria 7101
144 Ga0268264_10000779 3300028381 Bacteria 35038
145 Ga0268264_10007130 3300028381 Bacteria 9367
146 Ga0268264_10066177 3300028381 Bacteria 3047
147 Ga0265338_10043333 3300028800 Bacteria 4176
148 Ga0307513_10000914 3300031456 Bacteria 42646
149 Ga0307513_10014670 3300031456 Bacteria 9538
150 Ga0307509_10008486 3300031507 Bacteria 13080
151 Ga0307508_10034010 3300031616 Bacteria 4596
152 Ga0316579_10038386 3300031691 Bacteria 2214
153 Ga0307516_10052291 3300031730 Bacteria 3999
154 Ga0307405_10016515 3300031731 Bacteria 4028
155 Ga0307405_10031886 3300031731 Bacteria 3108
156 Ga0307412_10000866 3300031911 Bacteria 17389
157 Ga0307412_10029158 3300031911 Bacteria 3461
158 Ga0307409_100053391 3300031995 Bacteria 3105
159 Ga0307409_100077331 3300031995 Bacteria 2673
160 Ga0307414_10002587 3300032004 Bacteria 9520
161 Ga0307414_10031392 3300032004 Bacteria 3484
162 Ga0307415_100093597 3300032126 Bacteria 2183
163 Ga0316592_1000294 3300033524 Bacteria 6357
164 Ga0316596_1000407 3300033541 Bacteria 7145
165 Ga0316596_1002523 3300033541 Bacteria 3918
166 Ga0316596_1002630 3300033541 Bacteria 3850
167 Ga0316596_1003043 3300033541 Bacteria 3643
168 Ga0316596_1014933 3300033541 Bacteria 1932
169 Ga0316574_0005375 3300035398 Bacteria 6827
170 Ga0373931_0025365 3300035691 Bacteria 3011
171 Ga0373931_0080347 3300035691 Bacteria 1798
172 Ga0373935_0062949 3300035692 Bacteria 2377
173 Ga0373927_0006067 3300035695 Bacteria 8278
174 Ga0373947_0023724 3300035725 Bacteria 3571
175 Ga0373937_0122471 3300036401 Bacteria 2424
176 Ga0373937_0123462 3300036401 Bacteria 2414
177 Ga0316582_0003576 3300036647 Bacteria 7655
178 Ga0316582_0014450 3300036647 Bacteria 4480
179 Ga0316582_0034477 3300036647 Bacteria 3118
180 Ga0316582_0064491 3300036647 Bacteria 2356
181 Ga0316584_0014068 3300036712 Bacteria 5682
182 Ga0316584_0014219 3300036712 Bacteria 5660
183 Ga0316584_0026398 3300036712 Bacteria 4270
184 Ga0316584_0080571 3300036712 Bacteria 2439
185 Ga0316584_0084018 3300036712 Bacteria 2384
186 Ga0373925_0003815 3300037068 Bacteria 11568
187 Ga0373925_0024075 3300037068 Bacteria 4444
188 Ga0373925_0069798 3300037068 Bacteria 2655
189 Ga0316581_0003288 3300037588 Bacteria 4007
190 Ga0316581_0005685 3300037588 Bacteria 3264
191 Ga0400490_02808 3300038726 Bacteria 16281
192 Ga0400491_23555 3300038727 Bacteria 9874
193 Ga0400483_018242 3300039062 Bacteria 11628
194 Ga0400483_031978 3300039062 Bacteria 104878
195 Ga0400483_062144 3300039062 Bacteria 10878
196 Ga0400483_071737 3300039062 Bacteria 4871
197 Ga0400483_113767 3300039062 Bacteria 3088
198 Ga0400483_144965 3300039062 Bacteria 108715
199 Ga0400483_148749 3300039062 Bacteria 1985
200 Ga0400483_192144 3300039062 Bacteria 3637
201 Ga0400483_221680 3300039062 Bacteria 2072
202 Ga0400483_280444 3300039062 Bacteria 1639
203 Ga0439435_0006568 3300042436 Bacteria 2618
204 Ga0451577_0000091 3300042876 Bacteria 201647
205 Ga0451577_0009299 3300042876 Bacteria 9473
206 Ga0453684_0000632 3300044712 Bacteria 127568
207 Ga0453684_0000838 3300044712 Bacteria 103849
208 Ga0453684_0054058 3300044712 Bacteria 5235
209 Ga0453684_0073999 3300044712 Bacteria 4292
210 Ga0453684_0119751 3300044712 Bacteria 3181
211 Ga0451576_0000449 3300045051 Bacteria 93533
212 Ga0451576_0023332 3300045051 Bacteria 6699
213 Ga0495627_000799 3300046453 Bacteria 23006
214 Ga0495651_0050937 3300046462 Bacteria 3194
215 Ga0495650_0000565 3300046471 Bacteria 52077
216 Ga0495596_0000313 3300046500 Bacteria 31894
217 Ga0495583_0012249 3300046506 Bacteria 4867
218 Ga0495610_0001553 3300046512 Bacteria 20242
219 Ga0495620_0010179 3300046515 Bacteria 4967
220 Ga0495632_0057373 3300046519 Bacteria 1900
221 Ga0495643_0005754 3300046522 Bacteria 8294
222 Ga0495644_0005626 3300046523 Bacteria 4888
223 Ga0495652_0124169 3300046529 Bacteria 2054
224 Ga0495621_0007641 3300046539 Bacteria 3209
225 Ga0495656_0015274 3300046615 Bacteria 2896
226 Ga0495625_0014725 3300046660 Bacteria 6226
227 Ga0495625_0015263 3300046660 Bacteria 6092
228 Ga0495625_0058477 3300046660 Bacteria 2739
229 Ga0495658_0044903 3300046683 Bacteria 2477
230 Ga0495681_0000014 3300047470 Bacteria 184395
231 Ga0495686_0056507 3300047472 Bacteria 2452
232 Ga0496109_0007421 3300048912 Bacteria 9281
233 Ga0496110_0188285 3300048913 Bacteria 1874
234 Ga0496111_0040413 3300048914 Bacteria 3346
235 Ga0496112_0006325 3300048915 Bacteria 10399
236 Ga0496113_0116976 3300048916 Bacteria 2081
237 Ga0496114_0010463 3300048917 Bacteria 7382
238 Ga0496114_0016581 3300048917 Bacteria 5938
239 Ga0496115_0058098 3300048918 Bacteria 3112
240 Ga0496123_0090645 3300048926 Bacteria 1817
241 Ga0496126_0002855 3300048929 Bacteria 22592
242 Ga0501031_0128958 3300049568 Bacteria 1652
243 Ga0501032_0007778 3300049569 Bacteria 7817
244 Ga0501034_0000012 3300049571 Bacteria 310504
245 Ga0501034_0197008 3300049571 Bacteria 1974
246 Ga0501036_0105384 3300049572 Bacteria 2385
247 Ga0501036_0233542 3300049572 Bacteria 1543
248 Ga0501037_0111545 3300049573 Bacteria 1970
249 Ga0501038_0000500 3300049574 Bacteria 34410
250 Ga0501041_0090088 3300049577 Bacteria 1894
251 Ga0501042_0073526 3300049578 Bacteria 2445
252 Ga0501047_0082802 3300049581 Bacteria 3084
253 Ga0501071_0057276 3300049587 Bacteria 2816
254 Ga0501073_0003752 3300049589 Bacteria 11419
255 Ga0501075_0161250 3300049591 Bacteria 1711
256 Ga0501257_000001 3300049686 Bacteria 74809
257 Ga0501080_0052905 3300049742 Bacteria 3780
258 Ga0501083_0001453 3300049744 Bacteria 16170
259 Ga0501083_0004532 3300049744 Bacteria 9816
260 Ga0501083_0013371 3300049744 Bacteria 5737
261 Ga0501044_0000032 3300049823 Bacteria 169439
262 Ga0501044_0001887 3300049823 Bacteria 24285
263 Ga0501044_0048823 3300049823 Bacteria 4370
264 Ga0501044_0183863 3300049823 Bacteria 2056
265 nmdc:mga03683_313_c1 3300050489 Bacteria 13884
266 nmdc:mga03683_53_c1 3300050489 Bacteria 47904
267 nmdc:mga03n38_2795_c1 3300050490 Bacteria 5482
268 nmdc:mga03n38_46312_c1 3300050490 Bacteria 1920
269 nmdc:mga00v17_1428_c1 3300050491 Bacteria 12538
270 nmdc:mga0k408_5_c2 3300050493 Bacteria 142245
271 nmdc:mga06z11_282_c1 3300050494 Bacteria 19918
272 nmdc:mga04h51_81_c1 3300050495 Bacteria 30329
273 nmdc:mga07m45_17_c1 3300050496 Bacteria 140936
274 nmdc:mga07m45_30_c1 3300050496 Bacteria 85279
275 nmdc:mga07m45_37919_c1 3300050496 Bacteria 2688
276 nmdc:mga07m45_473_c1 3300050496 Bacteria 10557
277 nmdc:mga0sz30_17156_c1 3300050516 Bacteria 1721
278 nmdc:mga0sz30_5677_c1 3300050516 Bacteria 4589
279 nmdc:mga0sz30_78_c2 3300050516 Bacteria 28116
280 Ga0500643_008178 3300053087 Bacteria 4137
281 Ga0500607_000240 3300053121 Bacteria 51266
282 Ga0500608_000224 3300053122 Bacteria 22253
283 Ga0500559_0015761 3300053136 Bacteria 3192
284 Ga0500564_000656 3300053138 Bacteria 10676
285 Ga0500568_0026229 3300053139 Bacteria 2448
286 Ga0500616_0000074 3300053153 Bacteria 222910
287 Ga0500616_0004027 3300053153 Bacteria 10695
288 Ga0500622_0006886 3300053156 Bacteria 6522
289 Ga0500636_0061915 3300053177 Bacteria 2183
290 Ga0500625_000037 3300053729 Bacteria 44475
291 Ga0500552_000421 3300053733 Bacteria 3917
292 Ga0501084_0086564 3300054114 Bacteria 2631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0123462 Ga0373937_0123462_699_2057 421
2 3300049591 Ga0501075_0161250 Ga0501075_0161250_196_1515 422
3 3300036647 Ga0316582_0034477 Ga0316582_0034477_652_1947 426
4 3300036712 Ga0316584_0026398 Ga0316584_0026398_939_2234 426
5 3300013296 Ga0157374_10155193 Ga0157374_101551932 430
6 3300049686 Ga0501257_000001 Ga0501257_000001_38898_40196 432
7 3300036712 Ga0316584_0084018 Ga0316584_0084018_13_1338 434
8 3300014326 Ga0157380_10071815 Ga0157380_100718151 435
9 3300049571 Ga0501034_0000012 Ga0501034_0000012_6140_7501 436
10 iso_pu_bacteria 2786546940 2788437136 436
11 3300049744 Ga0501083_0004532 Ga0501083_0004532_1933_3321 437
12 3300005354 Ga0070675_100005379 Ga0070675_1000053797 438
13 3300005365 Ga0070688_100044936 Ga0070688_1000449362 438
14 3300005456 Ga0070678_100056657 Ga0070678_1000566572 438
15 3300005459 Ga0068867_100102628 Ga0068867_1001026282 438
16 3300005466 Ga0070685_10028263 Ga0070685_100282632 438
17 3300039062 Ga0400483_018242 Ga0400483_018242_5771_7147 438
18 3300046660 Ga0495625_0015263 Ga0495625_0015263_3431_4750 438
19 3300049568 Ga0501031_0128958 Ga0501031_0128958_302_1630 438
20 3300049823 Ga0501044_0183863 Ga0501044_0183863_15_1352 439
21 iso_pu_bacteria 2923525760 2923527367 439
22 3300049572 Ga0501036_0105384 Ga0501036_0105384_553_1923 440
23 iso_pu_bacteria 2919493220 2919493743 440
24 iso_pu_bacteria 2919534386 2919536599 440
25 iso_pu_bacteria 2919543075 2919545626 440
26 3300003320 rootH2_10012658 rootH2_1001265889 441
27 3300048916 Ga0496113_0116976 Ga0496113_0116976_484_1845 441
28 3300049574 Ga0501038_0000500 Ga0501038_0000500_6131_7483 441
29 3300028800 Ga0265338_10043333 Ga0265338_100433334 443
30 3300049589 Ga0501073_0003752 Ga0501073_0003752_8865_10298 443
31 3300049742 Ga0501080_0052905 Ga0501080_0052905_660_2093 443
32 3300049744 Ga0501083_0001453 Ga0501083_0001453_13408_14799 443
33 3300049823 Ga0501044_0001887 Ga0501044_0001887_5179_6570 443
34 3300031731 Ga0307405_10016515 Ga0307405_100165153 444
35 3300031911 Ga0307412_10000866 Ga0307412_100008668 444
36 3300032004 Ga0307414_10002587 Ga0307414_100025873 444
37 3300046512 Ga0495610_0001553 Ga0495610_0001553_11243_12580 444
38 3300046515 Ga0495620_0010179 Ga0495620_0010179_1520_2857 444
39 3300048917 Ga0496114_0016581 Ga0496114_0016581_3183_4598 444
40 3300048918 Ga0496115_0058098 Ga0496115_0058098_653_2068 444
41 3300005329 Ga0070683_100211797 Ga0070683_1002117972 445
42 3300005330 Ga0070690_100005887 Ga0070690_1000058875 445
43 3300005331 Ga0070670_100020715 Ga0070670_1000207153 445
44 3300005338 Ga0068868_100010709 Ga0068868_1000107092 445
45 3300005340 Ga0070689_100009668 Ga0070689_1000096686 445
46 3300005367 Ga0070667_100001223 Ga0070667_1000012234 445
47 3300005544 Ga0070686_100013313 Ga0070686_1000133133 445
48 3300005564 Ga0070664_100000900 Ga0070664_10000090015 445
49 3300005615 Ga0070702_100007747 Ga0070702_1000077473 445
50 3300005617 Ga0068859_100003052 Ga0068859_1000030529 445
51 3300005842 Ga0068858_100057350 Ga0068858_1000573502 445
52 3300005843 Ga0068860_100009817 Ga0068860_1000098175 445
53 3300006237 Ga0097621_100012010 Ga0097621_1000120103 445
54 3300006358 Ga0068871_100061054 Ga0068871_1000610542 445
55 3300006931 Ga0097620_100003052 Ga0097620_1000030529 445
56 3300009098 Ga0105245_10003339 Ga0105245_100033398 445
57 3300009101 Ga0105247_10001474 Ga0105247_100014746 445
58 3300009148 Ga0105243_10122182 Ga0105243_101221822 445
59 3300009177 Ga0105248_10010752 Ga0105248_100107527 445
60 3300009551 Ga0105238_10006007 Ga0105238_100060078 445
61 3300013296 Ga0157374_10003995 Ga0157374_100039957 445
62 3300013308 Ga0157375_10001697 Ga0157375_100016974 445
63 3300014325 Ga0163163_10004421 Ga0163163_100044214 445
64 3300014968 Ga0157379_10002963 Ga0157379_100029637 445
65 3300014969 Ga0157376_10052737 Ga0157376_100527372 445
66 3300025936 Ga0207670_10021273 Ga0207670_100212733 445
67 3300025945 Ga0207679_10068565 Ga0207679_100685652 445
68 3300025986 Ga0207658_10064520 Ga0207658_100645202 445
69 3300026035 Ga0207703_10023384 Ga0207703_100233842 445
70 3300026088 Ga0207641_10004134 Ga0207641_100041349 445
71 3300026095 Ga0207676_10025068 Ga0207676_100250683 445
72 3300028379 Ga0268266_10038776 Ga0268266_100387763 445
73 3300035691 Ga0373931_0025365 Ga0373931_0025365_252_1661 445
74 3300042876 Ga0451577_0009299 Ga0451577_0009299_3684_5039 445
75 3300044712 Ga0453684_0119751 Ga0453684_0119751_1691_3046 445
76 3300045051 Ga0451576_0023332 Ga0451576_0023332_1024_2433 445
77 3300048912 Ga0496109_0007421 Ga0496109_0007421_5791_7200 445
78 3300048913 Ga0496110_0188285 Ga0496110_0188285_29_1402 445
79 3300048914 Ga0496111_0040413 Ga0496111_0040413_1914_3287 445
80 3300048915 Ga0496112_0006325 Ga0496112_0006325_6691_8100 445
81 3300036712 Ga0316584_0014068 Ga0316584_0014068_1314_2681 446
82 3300037588 Ga0316581_0003288 Ga0316581_0003288_402_1769 446
83 3300039062 Ga0400483_062144 Ga0400483_062144_8059_9429 446
84 iso_pu_bacteria 2840878972 2840884037 446
85 3300044712 Ga0453684_0000838 Ga0453684_0000838_70847_72208 447
86 iso_pu_bacteria 2891048133 2891052261 447
87 3300005329 Ga0070683_100011322 Ga0070683_1000113224 448
88 3300005614 Ga0068856_100000776 Ga0068856_10000077623 448
89 3300005614 Ga0068856_100013718 Ga0068856_1000137184 448
90 3300025949 Ga0207667_10115765 Ga0207667_101157652 448
91 3300026078 Ga0207702_10018238 Ga0207702_100182385 448
92 3300026078 Ga0207702_10059451 Ga0207702_100594513 448
93 3300033541 Ga0316596_1002523 Ga0316596_10025235 448
94 3300039062 Ga0400483_031978 Ga0400483_031978_85464_86840 448
95 3300039062 Ga0400483_192144 Ga0400483_192144_1642_3012 448
96 3300039062 Ga0400483_221680 Ga0400483_221680_92_1462 448
97 3300049569 Ga0501032_0007778 Ga0501032_0007778_1164_2543 448
98 3300049823 Ga0501044_0000032 Ga0501044_0000032_151119_152498 448
99 3300050516 nmdc:mga0sz30_17156_c1 nmdc:mga0sz30_17156_c1_58_1407 448
100 3300039062 Ga0400483_144965 Ga0400483_144965_29100_30479 449
101 iso_pu_bacteria 2738541317 2738945698 449
102 iso_pu_bacteria 2846952575 2846957004 449
103 iso_pu_bacteria 2848858292 2848861508 449
104 iso_pu_bacteria 2913308742 2913310620 449
105 3300005295 Ga0065707_10083905 Ga0065707_100839056 450
106 3300005440 Ga0070705_100054996 Ga0070705_1000549961 450
107 3300028381 Ga0268264_10007130 Ga0268264_100071305 450
108 3300036712 Ga0316584_0014219 Ga0316584_0014219_313_1710 450
109 iso_pu_bacteria 2837651117 2837654342 450
110 3300005341 Ga0070691_10052180 Ga0070691_100521802 451
111 3300014326 Ga0157380_10168607 Ga0157380_101686072 451
112 3300036401 Ga0373937_0122471 Ga0373937_0122471_679_2070 451
113 3300039062 Ga0400483_148749 Ga0400483_148749_464_1864 451
114 3300046529 Ga0495652_0124169 Ga0495652_0124169_472_1941 451
115 3300046660 Ga0495625_0014725 Ga0495625_0014725_257_1624 451
116 3300049577 Ga0501041_0090088 Ga0501041_0090088_513_1874 451
117 iso_pu_bacteria 2837678835 2837679002 451
118 3300014968 Ga0157379_10078162 Ga0157379_100781621 452
119 3300039062 Ga0400483_113767 Ga0400483_113767_1129_2532 452
120 3300054114 Ga0501084_0086564 Ga0501084_0086564_1114_2547 452
121 iso_pu_bacteria 2597490356 2599102340 452
122 3300039062 Ga0400483_071737 Ga0400483_071737_285_1769 453
123 3300053153 Ga0500616_0000074 Ga0500616_0000074_46597_47973 453
124 3300005843 Ga0068860_100083230 Ga0068860_1000832302 454
125 3300006175 Ga0070712_100086488 Ga0070712_1000864882 454
126 3300009147 Ga0114129_10034549 Ga0114129_100345495 454
127 3300025915 Ga0207693_10085513 Ga0207693_100855132 454
128 3300025916 Ga0207663_10140522 Ga0207663_101405222 454
129 3300028381 Ga0268264_10066177 Ga0268264_100661772 454
130 3300033541 Ga0316596_1003043 Ga0316596_10030431 454
131 3300037068 Ga0373925_0024075 Ga0373925_0024075_1759_3186 454
132 iso_pu_bacteria 2511231221 2512035813 454
133 iso_pu_bacteria 2597489875 2597810577 454
134 3300005354 Ga0070675_100051956 Ga0070675_1000519562 455
135 3300005364 Ga0070673_100110931 Ga0070673_1001109312 455
136 3300005543 Ga0070672_100005632 Ga0070672_1000056322 455
137 3300005543 Ga0070672_100103764 Ga0070672_1001037642 455
138 3300005840 Ga0068870_10004252 Ga0068870_100042524 455
139 3300005841 Ga0068863_100147282 Ga0068863_1001472822 455
140 3300006237 Ga0097621_100076411 Ga0097621_1000764112 455
141 3300009093 Ga0105240_10267262 Ga0105240_102672622 455
142 3300025893 Ga0207682_10000460 Ga0207682_100004607 455
143 3300025926 Ga0207659_10023892 Ga0207659_100238922 455
144 3300025934 Ga0207686_10070370 Ga0207686_100703701 455
145 3300025940 Ga0207691_10003078 Ga0207691_1000307813 455
146 3300025940 Ga0207691_10091825 Ga0207691_100918252 455
147 3300025942 Ga0207689_10051691 Ga0207689_100516913 455
148 3300025960 Ga0207651_10024624 Ga0207651_100246242 455
149 3300026089 Ga0207648_10025130 Ga0207648_100251303 455
150 3300026118 Ga0207675_100084181 Ga0207675_1000841812 455
151 3300026118 Ga0207675_100102841 Ga0207675_1001028412 455
152 3300026121 Ga0207683_10021106 Ga0207683_100211064 455
153 3300031507 Ga0307509_10008486 Ga0307509_100084866 455
154 3300031995 Ga0307409_100077331 Ga0307409_1000773312 455
155 3300033541 Ga0316596_1002630 Ga0316596_10026303 455
156 3300035398 Ga0316574_0005375 Ga0316574_0005375_2533_3930 455
157 3300036647 Ga0316582_0064491 Ga0316582_0064491_139_1536 455
158 3300039062 Ga0400483_280444 Ga0400483_280444_114_1523 455
159 iso_pu_bacteria 2582581866 2585398051 455
160 iso_pu_bacteria 2838074704 2838077759 455
161 iso_pu_bacteria 2913295892 2913296717 455
162 3300045051 Ga0451576_0000449 Ga0451576_0000449_49974_51380 456
163 3300053733 Ga0500552_000421 Ga0500552_000421_2498_3883 456
164 iso_pu_bacteria 2657244999 2657683377 456
165 iso_pu_bacteria 2791355082 2792580456 456
166 iso_pu_bacteria 2802429268 2804754677 456
167 iso_pu_bacteria 2896384573 2896391873 456
168 iso_pu_bacteria 2920760137 2920764985 456
169 iso_pu_bacteria 8049293176 8049298507 456
170 iso_pu_bacteria 8054558443 8054563605 456
171 3300031691 Ga0316579_10038386 Ga0316579_100383861 457
172 3300033524 Ga0316592_1000294 Ga0316592_10002945 457
173 3300033541 Ga0316596_1000407 Ga0316596_10004072 457
174 3300036647 Ga0316582_0014450 Ga0316582_0014450_862_2259 457
175 3300036712 Ga0316584_0080571 Ga0316584_0080571_478_1875 457
176 3300037588 Ga0316581_0005685 Ga0316581_0005685_300_1697 457
177 3300042876 Ga0451577_0000091 Ga0451577_0000091_138326_139765 457
178 3300044712 Ga0453684_0000632 Ga0453684_0000632_4277_5716 457
179 iso_pu_bacteria 8054002106 8054003600 457
180 3300005355 Ga0070671_100028552 Ga0070671_1000285523 458
181 3300005842 Ga0068858_100001710 Ga0068858_1000017103 458
182 3300006177 Ga0075362_10000042 Ga0075362_100000427 458
183 3300006186 Ga0075369_10001319 Ga0075369_100013195 458
184 3300025931 Ga0207644_10005436 Ga0207644_100054365 458
185 3300025941 Ga0207711_10082036 Ga0207711_100820362 458
186 3300025972 Ga0207668_10166690 Ga0207668_101666901 458
187 3300032126 Ga0307415_100093597 Ga0307415_1000935972 458
188 3300033541 Ga0316596_1014933 Ga0316596_10149331 458
189 3300035692 Ga0373935_0062949 Ga0373935_0062949_839_2239 458
190 3300036647 Ga0316582_0003576 Ga0316582_0003576_2934_4340 458
191 3300037068 Ga0373925_0003815 Ga0373925_0003815_9818_11218 458
192 3300038726 Ga0400490_02808 Ga0400490_02808_2947_4353 458
193 3300038727 Ga0400491_23555 Ga0400491_23555_6443_7849 458
194 3300047472 Ga0495686_0056507 Ga0495686_0056507_275_1663 458
195 3300003215 JGI25153J46596_10000010 JGI25153J46596_10000010270 459
196 3300003323 rootH1_10267483 rootH1_102674832 459
197 3300003794 Ga0055531_10019110 Ga0055531_100191102 459
198 3300005844 Ga0068862_100006952 Ga0068862_1000069523 459
199 3300021320 Ga0214544_1007743 Ga0214544_10077438 459
200 3300021321 Ga0214542_1000082 Ga0214542_1000082107 459
201 3300021327 Ga0214543_1000075 Ga0214543_1000075107 459
202 3300025297 Ga0209758_1000033 Ga0209758_1000033413 459
203 3300025297 Ga0209758_1016919 Ga0209758_10169193 459
204 3300025298 Ga0209050_1004613 Ga0209050_10046134 459
205 3300025304 Ga0209257_1000237 Ga0209257_100023784 459
206 3300028380 Ga0268265_10008102 Ga0268265_100081022 459
207 3300031730 Ga0307516_10052291 Ga0307516_100522912 459
208 3300031995 Ga0307409_100053391 Ga0307409_1000533912 459
209 3300044712 Ga0453684_0054058 Ga0453684_0054058_1791_3215 459
210 3300044712 Ga0453684_0073999 Ga0453684_0073999_1163_2584 459
211 3300049587 Ga0501071_0057276 Ga0501071_0057276_12_1445 459
212 3300053139 Ga0500568_0026229 Ga0500568_0026229_599_2017 459
213 3300005327 Ga0070658_10000486 Ga0070658_100004866 460
214 3300005937 Ga0081455_10064098 Ga0081455_100640982 460
215 3300046453 Ga0495627_000799 Ga0495627_000799_15169_16560 460
216 3300046471 Ga0495650_0000565 Ga0495650_0000565_46300_47691 460
217 3300046523 Ga0495644_0005626 Ga0495644_0005626_2194_3588 460
218 3300046539 Ga0495621_0007641 Ga0495621_0007641_1137_2531 460
219 3300046615 Ga0495656_0015274 Ga0495656_0015274_1423_2817 460
220 3300046683 Ga0495658_0044903 Ga0495658_0044903_430_1824 460
221 3300047470 Ga0495681_0000014 Ga0495681_0000014_136731_138122 460
222 3300048917 Ga0496114_0010463 Ga0496114_0010463_2703_4091 460
223 3300048929 Ga0496126_0002855 Ga0496126_0002855_16259_17647 460
224 3300053153 Ga0500616_0004027 Ga0500616_0004027_8301_9695 460
225 iso_pu_bacteria 8005658619 8005662741 460
226 3300050496 nmdc:mga07m45_37919_c1 nmdc:mga07m45_37919_c1_432_1952 461
227 3300005295 Ga0065707_10133118 Ga0065707_101331181 462
228 3300049573 Ga0501037_0111545 Ga0501037_0111545_286_1719 462
229 3300049581 Ga0501047_0082802 Ga0501047_0082802_1068_2501 462
230 3300049744 Ga0501083_0013371 Ga0501083_0013371_88_1521 462
231 3300050496 nmdc:mga07m45_473_c1 nmdc:mga07m45_473_c1_3527_4927 462
232 3300053177 Ga0500636_0061915 Ga0500636_0061915_155_1618 462
233 iso_pu_bacteria 2739367664 2739650261 462
234 iso_pu_bacteria 2739367865 2740028734 462
235 3300035695 Ga0373927_0006067 Ga0373927_0006067_4326_5762 463
236 3300035725 Ga0373947_0023724 Ga0373947_0023724_1985_3421 463
237 3300037068 Ga0373925_0069798 Ga0373925_0069798_393_1829 463
238 iso_pu_bacteria 2508501009 2508541647 463
239 iso_pu_bacteria 8056681323 8056687272 463
240 3300005356 Ga0070674_100069854 Ga0070674_1000698542 464
241 3300005364 Ga0070673_100035714 Ga0070673_1000357143 464
242 3300005563 Ga0068855_100115257 Ga0068855_1001152572 464
243 3300005616 Ga0068852_100019858 Ga0068852_1000198583 464
244 3300009174 Ga0105241_10036769 Ga0105241_100367692 464
245 3300010375 Ga0105239_10153081 Ga0105239_101530812 464
246 3300013307 Ga0157372_10256815 Ga0157372_102568151 464
247 3300025907 Ga0207645_10015834 Ga0207645_100158343 464
248 3300025940 Ga0207691_10085255 Ga0207691_100852553 464
249 3300026023 Ga0207677_10060707 Ga0207677_100607072 464
250 3300026116 Ga0207674_10011136 Ga0207674_100111364 464
251 3300026121 Ga0207683_10038214 Ga0207683_100382142 464
252 3300035691 Ga0373931_0080347 Ga0373931_0080347_129_1553 464
253 3300049572 Ga0501036_0233542 Ga0501036_0233542_38_1459 464
254 3300049578 Ga0501042_0073526 Ga0501042_0073526_210_1631 464
255 3300049823 Ga0501044_0048823 Ga0501044_0048823_564_2003 464
256 3300005841 Ga0068863_100005703 Ga0068863_10000570310 465
257 3300005843 Ga0068860_100004891 Ga0068860_1000048915 465
258 3300005844 Ga0068862_100000095 Ga0068862_10000009531 465
259 3300006353 Ga0075370_10003519 Ga0075370_100035192 465
260 3300009553 Ga0105249_10000079 Ga0105249_100000798 465
261 3300025961 Ga0207712_10000030 Ga0207712_1000003077 465
262 3300026088 Ga0207641_10001899 Ga0207641_100018995 465
263 3300028380 Ga0268265_10000132 Ga0268265_1000013270 465
264 3300028381 Ga0268264_10000779 Ga0268264_1000077918 465
265 3300031456 Ga0307513_10000914 Ga0307513_1000091418 465
266 3300031456 Ga0307513_10014670 Ga0307513_100146707 465
267 3300031731 Ga0307405_10031886 Ga0307405_100318863 465
268 3300046462 Ga0495651_0050937 Ga0495651_0050937_406_1848 465
269 3300049571 Ga0501034_0197008 Ga0501034_0197008_375_1778 465
270 3300050489 nmdc:mga03683_53_c1 nmdc:mga03683_53_c1_40045_41535 465
271 3300050490 nmdc:mga03n38_2795_c1 nmdc:mga03n38_2795_c1_3735_5225 465
272 3300050516 nmdc:mga0sz30_78_c2 nmdc:mga0sz30_78_c2_20346_21836 465
273 3300053087 Ga0500643_008178 Ga0500643_008178_86_1498 465
274 3300053156 Ga0500622_0006886 Ga0500622_0006886_4781_6247 465
275 iso_pu_bacteria 2643221547 2643754609 465
276 3300005518 Ga0070699_100006662 Ga0070699_1000066627 466
277 3300005563 Ga0068855_100031451 Ga0068855_1000314514 466
278 3300005578 Ga0068854_100000459 Ga0068854_10000045924 466
279 3300005614 Ga0068856_100011271 Ga0068856_1000112715 466
280 3300005616 Ga0068852_100000231 Ga0068852_10000023125 466
281 3300006195 Ga0075366_10000086 Ga0075366_1000008630 466
282 3300006353 Ga0075370_10000026 Ga0075370_100000264 466
283 3300009093 Ga0105240_10013931 Ga0105240_1001393110 466
284 3300025904 Ga0207647_10016969 Ga0207647_100169693 466
285 3300025909 Ga0207705_10000004 Ga0207705_10000004166 466
286 3300025949 Ga0207667_10073620 Ga0207667_100736202 466
287 3300025981 Ga0207640_10000508 Ga0207640_100005085 466
288 3300026078 Ga0207702_10004366 Ga0207702_100043668 466
289 3300026142 Ga0207698_10000058 Ga0207698_1000005825 466
290 3300042436 Ga0439435_0006568 Ga0439435_0006568_229_1647 466
291 3300050496 nmdc:mga07m45_30_c1 nmdc:mga07m45_30_c1_28558_29970 466
292 3300005353 Ga0070669_100069163 Ga0070669_1000691632 467
293 3300006042 Ga0075368_10000041 Ga0075368_100000417 467
294 3300006177 Ga0075362_10001396 Ga0075362_100013965 467
295 3300006195 Ga0075366_10008795 Ga0075366_100087951 467
296 3300027866 Ga0209813_10000435 Ga0209813_100004357 467
297 3300050489 nmdc:mga03683_313_c1 nmdc:mga03683_313_c1_7546_8988 467
298 3300050490 nmdc:mga03n38_46312_c1 nmdc:mga03n38_46312_c1_411_1853 467
299 3300050491 nmdc:mga00v17_1428_c1 nmdc:mga00v17_1428_c1_9532_10974 467
300 3300050494 nmdc:mga06z11_282_c1 nmdc:mga06z11_282_c1_16330_17772 467
301 3300050495 nmdc:mga04h51_81_c1 nmdc:mga04h51_81_c1_5315_6757 467
302 3300050496 nmdc:mga07m45_17_c1 nmdc:mga07m45_17_c1_26421_27863 467
303 3300048926 Ga0496123_0090645 Ga0496123_0090645_112_1647 468
304 iso_pu_bacteria 2510917021 2511127388 468
305 iso_pu_bacteria 2896184354 2896185267 468
306 3300053121 Ga0500607_000240 Ga0500607_000240_16479_17894 469
307 3300053122 Ga0500608_000224 Ga0500608_000224_3179_4726 469
308 3300053136 Ga0500559_0015761 Ga0500559_0015761_1234_2781 469
309 3300053138 Ga0500564_000656 Ga0500564_000656_778_2325 469
310 3300053729 Ga0500625_000037 Ga0500625_000037_30270_31817 469
311 3300002459 JGI24751J29686_10000134 JGI24751J29686_1000013431 471
312 3300005616 Ga0068852_100098575 Ga0068852_1000985752 471
313 3300006058 Ga0075432_10001736 Ga0075432_100017364 471
314 3300025903 Ga0207680_10029494 Ga0207680_100294943 471
315 3300031616 Ga0307508_10034010 Ga0307508_100340103 471
316 3300005844 Ga0068862_100004950 Ga0068862_1000049504 472
317 3300031911 Ga0307412_10029158 Ga0307412_100291582 472
318 3300032004 Ga0307414_10031392 Ga0307414_100313922 472
319 3300046500 Ga0495596_0000313 Ga0495596_0000313_27586_29004 472
320 3300046506 Ga0495583_0012249 Ga0495583_0012249_2975_4393 472
321 3300046519 Ga0495632_0057373 Ga0495632_0057373_77_1495 472
322 3300046522 Ga0495643_0005754 Ga0495643_0005754_3701_5119 472
323 3300046660 Ga0495625_0058477 Ga0495625_0058477_1215_2633 472
324 3300050516 nmdc:mga0sz30_5677_c1 nmdc:mga0sz30_5677_c1_68_1510 472
325 3300050493 nmdc:mga0k408_5_c2 nmdc:mga0k408_5_c2_71926_73416 473
326 2162886007 SwRhRL2b_contig_539634 SwRhRL2b_0834.00010560 476
327 3300005289 Ga0065704_10000191 Ga0065704_10000191144 476

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

87

366

0.98

PF09084

NMT1

NMT1/THI5 like

101

168

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9263 47 460
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9216 47 460
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8982 47 462
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8939 47 462
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8429 50 412
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9253 47 435 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9008 47 435 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8812 134 271 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.869 135 266 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8515 51 337 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0F9KG26-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9952 63 381 GO:0005886
GO:0012505
AF-A0A0F9KG26-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9921 63 381 GO:0005886
GO:0012505
AF-A0A1J5QUN4-F1-model_v4 Bicarbonate transport ATP-binding protein CmpC (EC 3.6.3.-) 0.9624 50 413 GO:0005524
GO:0005886
GO:0012505
GO:0016787
AF-A0A3M3HDL5-F1-model_v4 deleted 0.9578 48 463
AF-A0A838WII5-F1-model_v4 ABC transporter substrate-binding protein 0.9575 48 337 GO:0005524
GO:0005886
GO:0006811
GO:0015112
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.77 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map