F408995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 237 | 292 | 464 |
Family's Representative Sequence
| Representative Sequence | 3300053122|Ga0500608_000224|Ga0500608_000224_3179_4726 |
| Length | 515 |
| Sequence | VVLPKDGQAQRLSIQHQLCVATSPPDLTIRSSRGGFFTLFTRHQGNGAMDGVRGIKRAIAATLLASVALAGCGKGSGDQAKPAASANGIEKPTLKLGFIKLTDIAPLVVAQEKGFFKDEGLTVTLEPQANWKVLLDGVTGGQLDGAHMLAGQVLASGAGIGSKVPLVTPFSLDINGKGVTVSNQVWDMIAPTLPKGPDGKVQMPISAEALKPVVAKFKAEGKPFKMGMVFPVSTHNYILRYWLAAGGLNPGYYLPADTAGVTGAEVQLSVTPPPQMPSTMEAGTINGYSVGEPWNQASVAKKIGVPIIVDPDIAGTTGDKVFGLTAEFAKKNPNTVKAITRALIRASMWLDADGGKNRPEAVKLLANSKYVGADEKVLMASMTGSFTFGAGDTRSTPEFNLFFNQQASYPFYSDGIWFLTQMRRWGQIPDDKSDQWYLDTVKSVYREDLYDEAAKSLVADGKAKAEDFPKTDGFRVYAHKAIDGVPFDAHKPAAYAASFTIGLKPGQKVTPAGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 5 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 6 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 7 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 8 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 9 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 10 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 11 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 12 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 13 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 14 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 15 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 16 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 17 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 18 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 19 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 20 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 21 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 22 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 23 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 24 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 25 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 26 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 27 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 28 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 29 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 30 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 31 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 32 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 101 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 102 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 161 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 164 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 165 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 166 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 167 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 170 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 171 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 210 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 222 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 223 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 224 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 225 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 226 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 229 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 230 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 231 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 234 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 235 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 236 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 237 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.46 |
| Metatranscriptomes | 1.83 |
| Isolates | 10.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.84 |
| Nodule | 2.75 |
| Rhizoplane | 2.45 |
| Rhizosphere | 68.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_539634 | 2162886007 | Bacteria | 21292 |
| 2 | JGI24751J29686_10000134 | 3300002459 | Bacteria | 37360 |
| 3 | JGI25153J46596_10000010 | 3300003215 | Bacteria | 337769 |
| 4 | rootH2_10012658 | 3300003320 | Bacteria | 82320 |
| 5 | rootH1_10267483 | 3300003323 | Bacteria | 4689 |
| 6 | Ga0055531_10019110 | 3300003794 | Bacteria | 2792 |
| 7 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 8 | Ga0065707_10083905 | 3300005295 | Bacteria | 8009 |
| 9 | Ga0065707_10133118 | 3300005295 | Bacteria | 1887 |
| 10 | Ga0070658_10000486 | 3300005327 | Bacteria | 34470 |
| 11 | Ga0070683_100011322 | 3300005329 | Bacteria | 7704 |
| 12 | Ga0070683_100211797 | 3300005329 | Bacteria | 1841 |
| 13 | Ga0070690_100005887 | 3300005330 | Bacteria | 6915 |
| 14 | Ga0070670_100020715 | 3300005331 | Bacteria | 5655 |
| 15 | Ga0068868_100010709 | 3300005338 | Bacteria | 6647 |
| 16 | Ga0070689_100009668 | 3300005340 | Bacteria | 6841 |
| 17 | Ga0070691_10052180 | 3300005341 | Bacteria | 1955 |
| 18 | Ga0070669_100069163 | 3300005353 | Bacteria | 2607 |
| 19 | Ga0070675_100005379 | 3300005354 | Bacteria | 9785 |
| 20 | Ga0070675_100051956 | 3300005354 | Bacteria | 3369 |
| 21 | Ga0070671_100028552 | 3300005355 | Bacteria | 4595 |
| 22 | Ga0070674_100069854 | 3300005356 | Bacteria | 2479 |
| 23 | Ga0070673_100035714 | 3300005364 | Bacteria | 3770 |
| 24 | Ga0070673_100110931 | 3300005364 | Bacteria | 2275 |
| 25 | Ga0070688_100044936 | 3300005365 | Bacteria | 2727 |
| 26 | Ga0070667_100001223 | 3300005367 | Bacteria | 23386 |
| 27 | Ga0070705_100054996 | 3300005440 | Bacteria | 2337 |
| 28 | Ga0070678_100056657 | 3300005456 | Bacteria | 2868 |
| 29 | Ga0068867_100102628 | 3300005459 | Bacteria | 2186 |
| 30 | Ga0070685_10028263 | 3300005466 | Bacteria | 3107 |
| 31 | Ga0070699_100006662 | 3300005518 | Bacteria | 10041 |
| 32 | Ga0070672_100005632 | 3300005543 | Bacteria | 8336 |
| 33 | Ga0070672_100103764 | 3300005543 | Bacteria | 2309 |
| 34 | Ga0070686_100013313 | 3300005544 | Bacteria | 4705 |
| 35 | Ga0068855_100031451 | 3300005563 | Bacteria | 6337 |
| 36 | Ga0068855_100115257 | 3300005563 | Bacteria | 3081 |
| 37 | Ga0070664_100000900 | 3300005564 | Bacteria | 23120 |
| 38 | Ga0068854_100000459 | 3300005578 | Bacteria | 25127 |
| 39 | Ga0068856_100000776 | 3300005614 | Bacteria | 34703 |
| 40 | Ga0068856_100011271 | 3300005614 | Bacteria | 8677 |
| 41 | Ga0068856_100013718 | 3300005614 | Bacteria | 7834 |
| 42 | Ga0070702_100007747 | 3300005615 | Bacteria | 5159 |
| 43 | Ga0068852_100000231 | 3300005616 | Bacteria | 37728 |
| 44 | Ga0068852_100019858 | 3300005616 | Bacteria | 5330 |
| 45 | Ga0068852_100098575 | 3300005616 | Bacteria | 2632 |
| 46 | Ga0068859_100003052 | 3300005617 | Bacteria | 16996 |
| 47 | Ga0068870_10004252 | 3300005840 | Bacteria | 6154 |
| 48 | Ga0068863_100005703 | 3300005841 | Bacteria | 12224 |
| 49 | Ga0068863_100147282 | 3300005841 | Bacteria | 2252 |
| 50 | Ga0068858_100001710 | 3300005842 | Bacteria | 22428 |
| 51 | Ga0068858_100057350 | 3300005842 | Bacteria | 3599 |
| 52 | Ga0068860_100004891 | 3300005843 | Bacteria | 13657 |
| 53 | Ga0068860_100009817 | 3300005843 | Bacteria | 9501 |
| 54 | Ga0068860_100083230 | 3300005843 | Bacteria | 3043 |
| 55 | Ga0068862_100000095 | 3300005844 | Bacteria | 105957 |
| 56 | Ga0068862_100004950 | 3300005844 | Bacteria | 11216 |
| 57 | Ga0068862_100006952 | 3300005844 | Bacteria | 9389 |
| 58 | Ga0081455_10064098 | 3300005937 | Bacteria | 3079 |
| 59 | Ga0075368_10000041 | 3300006042 | Bacteria | 29722 |
| 60 | Ga0075432_10001736 | 3300006058 | Bacteria | 7174 |
| 61 | Ga0070712_100086488 | 3300006175 | Bacteria | 2285 |
| 62 | Ga0075362_10000042 | 3300006177 | Bacteria | 45768 |
| 63 | Ga0075362_10001396 | 3300006177 | Bacteria | 7673 |
| 64 | Ga0075369_10001319 | 3300006186 | Bacteria | 8437 |
| 65 | Ga0075366_10000086 | 3300006195 | Bacteria | 36542 |
| 66 | Ga0075366_10008795 | 3300006195 | Bacteria | 5623 |
| 67 | Ga0097621_100012010 | 3300006237 | Bacteria | 6409 |
| 68 | Ga0097621_100076411 | 3300006237 | Bacteria | 2778 |
| 69 | Ga0075370_10000026 | 3300006353 | Bacteria | 51806 |
| 70 | Ga0075370_10003519 | 3300006353 | Bacteria | 7469 |
| 71 | Ga0068871_100061054 | 3300006358 | Bacteria | 3077 |
| 72 | Ga0097620_100003052 | 3300006931 | Bacteria | 16996 |
| 73 | Ga0105240_10013931 | 3300009093 | Bacteria | 11008 |
| 74 | Ga0105240_10267262 | 3300009093 | Bacteria | 1971 |
| 75 | Ga0105245_10003339 | 3300009098 | Bacteria | 14395 |
| 76 | Ga0105247_10001474 | 3300009101 | Bacteria | 16937 |
| 77 | Ga0114129_10034549 | 3300009147 | Bacteria | 7142 |
| 78 | Ga0105243_10122182 | 3300009148 | Bacteria | 2197 |
| 79 | Ga0105241_10036769 | 3300009174 | Bacteria | 3686 |
| 80 | Ga0105248_10010752 | 3300009177 | Bacteria | 10102 |
| 81 | Ga0105238_10006007 | 3300009551 | Bacteria | 12035 |
| 82 | Ga0105249_10000079 | 3300009553 | Bacteria | 139904 |
| 83 | Ga0105239_10153081 | 3300010375 | Bacteria | 2574 |
| 84 | Ga0157374_10003995 | 3300013296 | Bacteria | 12394 |
| 85 | Ga0157374_10155193 | 3300013296 | Bacteria | 2227 |
| 86 | Ga0157372_10256815 | 3300013307 | Bacteria | 2029 |
| 87 | Ga0157375_10001697 | 3300013308 | Bacteria | 18902 |
| 88 | Ga0163163_10004421 | 3300014325 | Bacteria | 11982 |
| 89 | Ga0157380_10071815 | 3300014326 | Bacteria | 2801 |
| 90 | Ga0157380_10168607 | 3300014326 | Bacteria | 1910 |
| 91 | Ga0157379_10002963 | 3300014968 | Bacteria | 14324 |
| 92 | Ga0157379_10078162 | 3300014968 | Bacteria | 2963 |
| 93 | Ga0157376_10052737 | 3300014969 | Bacteria | 3383 |
| 94 | Ga0214544_1007743 | 3300021320 | Bacteria | 18523 |
| 95 | Ga0214542_1000082 | 3300021321 | Bacteria | 120825 |
| 96 | Ga0214543_1000075 | 3300021327 | Bacteria | 120861 |
| 97 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 98 | Ga0209758_1016919 | 3300025297 | Bacteria | 3670 |
| 99 | Ga0209050_1004613 | 3300025298 | Bacteria | 9204 |
| 100 | Ga0209257_1000237 | 3300025304 | Bacteria | 128812 |
| 101 | Ga0207682_10000460 | 3300025893 | Bacteria | 18816 |
| 102 | Ga0207680_10029494 | 3300025903 | Bacteria | 3083 |
| 103 | Ga0207647_10016969 | 3300025904 | Bacteria | 4957 |
| 104 | Ga0207645_10015834 | 3300025907 | Bacteria | 4997 |
| 105 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 106 | Ga0207693_10085513 | 3300025915 | Bacteria | 2470 |
| 107 | Ga0207663_10140522 | 3300025916 | Bacteria | 1681 |
| 108 | Ga0207659_10023892 | 3300025926 | Bacteria | 4087 |
| 109 | Ga0207644_10005436 | 3300025931 | Bacteria | 8307 |
| 110 | Ga0207686_10070370 | 3300025934 | Bacteria | 2248 |
| 111 | Ga0207670_10021273 | 3300025936 | Bacteria | 4000 |
| 112 | Ga0207691_10003078 | 3300025940 | Bacteria | 16275 |
| 113 | Ga0207691_10085255 | 3300025940 | Bacteria | 2835 |
| 114 | Ga0207691_10091825 | 3300025940 | Bacteria | 2719 |
| 115 | Ga0207711_10082036 | 3300025941 | Bacteria | 2818 |
| 116 | Ga0207689_10051691 | 3300025942 | Bacteria | 3387 |
| 117 | Ga0207679_10068565 | 3300025945 | Bacteria | 2665 |
| 118 | Ga0207667_10073620 | 3300025949 | Bacteria | 3549 |
| 119 | Ga0207667_10115765 | 3300025949 | Bacteria | 2763 |
| 120 | Ga0207651_10024624 | 3300025960 | Bacteria | 3727 |
| 121 | Ga0207712_10000030 | 3300025961 | Bacteria | 216514 |
| 122 | Ga0207668_10166690 | 3300025972 | Bacteria | 1723 |
| 123 | Ga0207640_10000508 | 3300025981 | Bacteria | 23527 |
| 124 | Ga0207658_10064520 | 3300025986 | Bacteria | 2747 |
| 125 | Ga0207677_10060707 | 3300026023 | Bacteria | 2615 |
| 126 | Ga0207703_10023384 | 3300026035 | Bacteria | 4853 |
| 127 | Ga0207702_10004366 | 3300026078 | Bacteria | 12605 |
| 128 | Ga0207702_10018238 | 3300026078 | Bacteria | 5806 |
| 129 | Ga0207702_10059451 | 3300026078 | Bacteria | 3255 |
| 130 | Ga0207641_10001899 | 3300026088 | Bacteria | 20063 |
| 131 | Ga0207641_10004134 | 3300026088 | Bacteria | 12647 |
| 132 | Ga0207648_10025130 | 3300026089 | Bacteria | 5311 |
| 133 | Ga0207676_10025068 | 3300026095 | Bacteria | 4422 |
| 134 | Ga0207674_10011136 | 3300026116 | Bacteria | 10115 |
| 135 | Ga0207675_100084181 | 3300026118 | Bacteria | 2984 |
| 136 | Ga0207675_100102841 | 3300026118 | Bacteria | 2692 |
| 137 | Ga0207683_10021106 | 3300026121 | Bacteria | 5574 |
| 138 | Ga0207683_10038214 | 3300026121 | Bacteria | 4182 |
| 139 | Ga0207698_10000058 | 3300026142 | Bacteria | 78048 |
| 140 | Ga0209813_10000435 | 3300027866 | Bacteria | 10213 |
| 141 | Ga0268266_10038776 | 3300028379 | Bacteria | 4056 |
| 142 | Ga0268265_10000132 | 3300028380 | Bacteria | 95410 |
| 143 | Ga0268265_10008102 | 3300028380 | Bacteria | 7101 |
| 144 | Ga0268264_10000779 | 3300028381 | Bacteria | 35038 |
| 145 | Ga0268264_10007130 | 3300028381 | Bacteria | 9367 |
| 146 | Ga0268264_10066177 | 3300028381 | Bacteria | 3047 |
| 147 | Ga0265338_10043333 | 3300028800 | Bacteria | 4176 |
| 148 | Ga0307513_10000914 | 3300031456 | Bacteria | 42646 |
| 149 | Ga0307513_10014670 | 3300031456 | Bacteria | 9538 |
| 150 | Ga0307509_10008486 | 3300031507 | Bacteria | 13080 |
| 151 | Ga0307508_10034010 | 3300031616 | Bacteria | 4596 |
| 152 | Ga0316579_10038386 | 3300031691 | Bacteria | 2214 |
| 153 | Ga0307516_10052291 | 3300031730 | Bacteria | 3999 |
| 154 | Ga0307405_10016515 | 3300031731 | Bacteria | 4028 |
| 155 | Ga0307405_10031886 | 3300031731 | Bacteria | 3108 |
| 156 | Ga0307412_10000866 | 3300031911 | Bacteria | 17389 |
| 157 | Ga0307412_10029158 | 3300031911 | Bacteria | 3461 |
| 158 | Ga0307409_100053391 | 3300031995 | Bacteria | 3105 |
| 159 | Ga0307409_100077331 | 3300031995 | Bacteria | 2673 |
| 160 | Ga0307414_10002587 | 3300032004 | Bacteria | 9520 |
| 161 | Ga0307414_10031392 | 3300032004 | Bacteria | 3484 |
| 162 | Ga0307415_100093597 | 3300032126 | Bacteria | 2183 |
| 163 | Ga0316592_1000294 | 3300033524 | Bacteria | 6357 |
| 164 | Ga0316596_1000407 | 3300033541 | Bacteria | 7145 |
| 165 | Ga0316596_1002523 | 3300033541 | Bacteria | 3918 |
| 166 | Ga0316596_1002630 | 3300033541 | Bacteria | 3850 |
| 167 | Ga0316596_1003043 | 3300033541 | Bacteria | 3643 |
| 168 | Ga0316596_1014933 | 3300033541 | Bacteria | 1932 |
| 169 | Ga0316574_0005375 | 3300035398 | Bacteria | 6827 |
| 170 | Ga0373931_0025365 | 3300035691 | Bacteria | 3011 |
| 171 | Ga0373931_0080347 | 3300035691 | Bacteria | 1798 |
| 172 | Ga0373935_0062949 | 3300035692 | Bacteria | 2377 |
| 173 | Ga0373927_0006067 | 3300035695 | Bacteria | 8278 |
| 174 | Ga0373947_0023724 | 3300035725 | Bacteria | 3571 |
| 175 | Ga0373937_0122471 | 3300036401 | Bacteria | 2424 |
| 176 | Ga0373937_0123462 | 3300036401 | Bacteria | 2414 |
| 177 | Ga0316582_0003576 | 3300036647 | Bacteria | 7655 |
| 178 | Ga0316582_0014450 | 3300036647 | Bacteria | 4480 |
| 179 | Ga0316582_0034477 | 3300036647 | Bacteria | 3118 |
| 180 | Ga0316582_0064491 | 3300036647 | Bacteria | 2356 |
| 181 | Ga0316584_0014068 | 3300036712 | Bacteria | 5682 |
| 182 | Ga0316584_0014219 | 3300036712 | Bacteria | 5660 |
| 183 | Ga0316584_0026398 | 3300036712 | Bacteria | 4270 |
| 184 | Ga0316584_0080571 | 3300036712 | Bacteria | 2439 |
| 185 | Ga0316584_0084018 | 3300036712 | Bacteria | 2384 |
| 186 | Ga0373925_0003815 | 3300037068 | Bacteria | 11568 |
| 187 | Ga0373925_0024075 | 3300037068 | Bacteria | 4444 |
| 188 | Ga0373925_0069798 | 3300037068 | Bacteria | 2655 |
| 189 | Ga0316581_0003288 | 3300037588 | Bacteria | 4007 |
| 190 | Ga0316581_0005685 | 3300037588 | Bacteria | 3264 |
| 191 | Ga0400490_02808 | 3300038726 | Bacteria | 16281 |
| 192 | Ga0400491_23555 | 3300038727 | Bacteria | 9874 |
| 193 | Ga0400483_018242 | 3300039062 | Bacteria | 11628 |
| 194 | Ga0400483_031978 | 3300039062 | Bacteria | 104878 |
| 195 | Ga0400483_062144 | 3300039062 | Bacteria | 10878 |
| 196 | Ga0400483_071737 | 3300039062 | Bacteria | 4871 |
| 197 | Ga0400483_113767 | 3300039062 | Bacteria | 3088 |
| 198 | Ga0400483_144965 | 3300039062 | Bacteria | 108715 |
| 199 | Ga0400483_148749 | 3300039062 | Bacteria | 1985 |
| 200 | Ga0400483_192144 | 3300039062 | Bacteria | 3637 |
| 201 | Ga0400483_221680 | 3300039062 | Bacteria | 2072 |
| 202 | Ga0400483_280444 | 3300039062 | Bacteria | 1639 |
| 203 | Ga0439435_0006568 | 3300042436 | Bacteria | 2618 |
| 204 | Ga0451577_0000091 | 3300042876 | Bacteria | 201647 |
| 205 | Ga0451577_0009299 | 3300042876 | Bacteria | 9473 |
| 206 | Ga0453684_0000632 | 3300044712 | Bacteria | 127568 |
| 207 | Ga0453684_0000838 | 3300044712 | Bacteria | 103849 |
| 208 | Ga0453684_0054058 | 3300044712 | Bacteria | 5235 |
| 209 | Ga0453684_0073999 | 3300044712 | Bacteria | 4292 |
| 210 | Ga0453684_0119751 | 3300044712 | Bacteria | 3181 |
| 211 | Ga0451576_0000449 | 3300045051 | Bacteria | 93533 |
| 212 | Ga0451576_0023332 | 3300045051 | Bacteria | 6699 |
| 213 | Ga0495627_000799 | 3300046453 | Bacteria | 23006 |
| 214 | Ga0495651_0050937 | 3300046462 | Bacteria | 3194 |
| 215 | Ga0495650_0000565 | 3300046471 | Bacteria | 52077 |
| 216 | Ga0495596_0000313 | 3300046500 | Bacteria | 31894 |
| 217 | Ga0495583_0012249 | 3300046506 | Bacteria | 4867 |
| 218 | Ga0495610_0001553 | 3300046512 | Bacteria | 20242 |
| 219 | Ga0495620_0010179 | 3300046515 | Bacteria | 4967 |
| 220 | Ga0495632_0057373 | 3300046519 | Bacteria | 1900 |
| 221 | Ga0495643_0005754 | 3300046522 | Bacteria | 8294 |
| 222 | Ga0495644_0005626 | 3300046523 | Bacteria | 4888 |
| 223 | Ga0495652_0124169 | 3300046529 | Bacteria | 2054 |
| 224 | Ga0495621_0007641 | 3300046539 | Bacteria | 3209 |
| 225 | Ga0495656_0015274 | 3300046615 | Bacteria | 2896 |
| 226 | Ga0495625_0014725 | 3300046660 | Bacteria | 6226 |
| 227 | Ga0495625_0015263 | 3300046660 | Bacteria | 6092 |
| 228 | Ga0495625_0058477 | 3300046660 | Bacteria | 2739 |
| 229 | Ga0495658_0044903 | 3300046683 | Bacteria | 2477 |
| 230 | Ga0495681_0000014 | 3300047470 | Bacteria | 184395 |
| 231 | Ga0495686_0056507 | 3300047472 | Bacteria | 2452 |
| 232 | Ga0496109_0007421 | 3300048912 | Bacteria | 9281 |
| 233 | Ga0496110_0188285 | 3300048913 | Bacteria | 1874 |
| 234 | Ga0496111_0040413 | 3300048914 | Bacteria | 3346 |
| 235 | Ga0496112_0006325 | 3300048915 | Bacteria | 10399 |
| 236 | Ga0496113_0116976 | 3300048916 | Bacteria | 2081 |
| 237 | Ga0496114_0010463 | 3300048917 | Bacteria | 7382 |
| 238 | Ga0496114_0016581 | 3300048917 | Bacteria | 5938 |
| 239 | Ga0496115_0058098 | 3300048918 | Bacteria | 3112 |
| 240 | Ga0496123_0090645 | 3300048926 | Bacteria | 1817 |
| 241 | Ga0496126_0002855 | 3300048929 | Bacteria | 22592 |
| 242 | Ga0501031_0128958 | 3300049568 | Bacteria | 1652 |
| 243 | Ga0501032_0007778 | 3300049569 | Bacteria | 7817 |
| 244 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 245 | Ga0501034_0197008 | 3300049571 | Bacteria | 1974 |
| 246 | Ga0501036_0105384 | 3300049572 | Bacteria | 2385 |
| 247 | Ga0501036_0233542 | 3300049572 | Bacteria | 1543 |
| 248 | Ga0501037_0111545 | 3300049573 | Bacteria | 1970 |
| 249 | Ga0501038_0000500 | 3300049574 | Bacteria | 34410 |
| 250 | Ga0501041_0090088 | 3300049577 | Bacteria | 1894 |
| 251 | Ga0501042_0073526 | 3300049578 | Bacteria | 2445 |
| 252 | Ga0501047_0082802 | 3300049581 | Bacteria | 3084 |
| 253 | Ga0501071_0057276 | 3300049587 | Bacteria | 2816 |
| 254 | Ga0501073_0003752 | 3300049589 | Bacteria | 11419 |
| 255 | Ga0501075_0161250 | 3300049591 | Bacteria | 1711 |
| 256 | Ga0501257_000001 | 3300049686 | Bacteria | 74809 |
| 257 | Ga0501080_0052905 | 3300049742 | Bacteria | 3780 |
| 258 | Ga0501083_0001453 | 3300049744 | Bacteria | 16170 |
| 259 | Ga0501083_0004532 | 3300049744 | Bacteria | 9816 |
| 260 | Ga0501083_0013371 | 3300049744 | Bacteria | 5737 |
| 261 | Ga0501044_0000032 | 3300049823 | Bacteria | 169439 |
| 262 | Ga0501044_0001887 | 3300049823 | Bacteria | 24285 |
| 263 | Ga0501044_0048823 | 3300049823 | Bacteria | 4370 |
| 264 | Ga0501044_0183863 | 3300049823 | Bacteria | 2056 |
| 265 | nmdc:mga03683_313_c1 | 3300050489 | Bacteria | 13884 |
| 266 | nmdc:mga03683_53_c1 | 3300050489 | Bacteria | 47904 |
| 267 | nmdc:mga03n38_2795_c1 | 3300050490 | Bacteria | 5482 |
| 268 | nmdc:mga03n38_46312_c1 | 3300050490 | Bacteria | 1920 |
| 269 | nmdc:mga00v17_1428_c1 | 3300050491 | Bacteria | 12538 |
| 270 | nmdc:mga0k408_5_c2 | 3300050493 | Bacteria | 142245 |
| 271 | nmdc:mga06z11_282_c1 | 3300050494 | Bacteria | 19918 |
| 272 | nmdc:mga04h51_81_c1 | 3300050495 | Bacteria | 30329 |
| 273 | nmdc:mga07m45_17_c1 | 3300050496 | Bacteria | 140936 |
| 274 | nmdc:mga07m45_30_c1 | 3300050496 | Bacteria | 85279 |
| 275 | nmdc:mga07m45_37919_c1 | 3300050496 | Bacteria | 2688 |
| 276 | nmdc:mga07m45_473_c1 | 3300050496 | Bacteria | 10557 |
| 277 | nmdc:mga0sz30_17156_c1 | 3300050516 | Bacteria | 1721 |
| 278 | nmdc:mga0sz30_5677_c1 | 3300050516 | Bacteria | 4589 |
| 279 | nmdc:mga0sz30_78_c2 | 3300050516 | Bacteria | 28116 |
| 280 | Ga0500643_008178 | 3300053087 | Bacteria | 4137 |
| 281 | Ga0500607_000240 | 3300053121 | Bacteria | 51266 |
| 282 | Ga0500608_000224 | 3300053122 | Bacteria | 22253 |
| 283 | Ga0500559_0015761 | 3300053136 | Bacteria | 3192 |
| 284 | Ga0500564_000656 | 3300053138 | Bacteria | 10676 |
| 285 | Ga0500568_0026229 | 3300053139 | Bacteria | 2448 |
| 286 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 287 | Ga0500616_0004027 | 3300053153 | Bacteria | 10695 |
| 288 | Ga0500622_0006886 | 3300053156 | Bacteria | 6522 |
| 289 | Ga0500636_0061915 | 3300053177 | Bacteria | 2183 |
| 290 | Ga0500625_000037 | 3300053729 | Bacteria | 44475 |
| 291 | Ga0500552_000421 | 3300053733 | Bacteria | 3917 |
| 292 | Ga0501084_0086564 | 3300054114 | Bacteria | 2631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0123462 | Ga0373937_0123462_699_2057 | 421 |
| 2 | 3300049591 | Ga0501075_0161250 | Ga0501075_0161250_196_1515 | 422 |
| 3 | 3300036647 | Ga0316582_0034477 | Ga0316582_0034477_652_1947 | 426 |
| 4 | 3300036712 | Ga0316584_0026398 | Ga0316584_0026398_939_2234 | 426 |
| 5 | 3300013296 | Ga0157374_10155193 | Ga0157374_101551932 | 430 |
| 6 | 3300049686 | Ga0501257_000001 | Ga0501257_000001_38898_40196 | 432 |
| 7 | 3300036712 | Ga0316584_0084018 | Ga0316584_0084018_13_1338 | 434 |
| 8 | 3300014326 | Ga0157380_10071815 | Ga0157380_100718151 | 435 |
| 9 | 3300049571 | Ga0501034_0000012 | Ga0501034_0000012_6140_7501 | 436 |
| 10 | iso_pu_bacteria | 2786546940 | 2788437136 | 436 |
| 11 | 3300049744 | Ga0501083_0004532 | Ga0501083_0004532_1933_3321 | 437 |
| 12 | 3300005354 | Ga0070675_100005379 | Ga0070675_1000053797 | 438 |
| 13 | 3300005365 | Ga0070688_100044936 | Ga0070688_1000449362 | 438 |
| 14 | 3300005456 | Ga0070678_100056657 | Ga0070678_1000566572 | 438 |
| 15 | 3300005459 | Ga0068867_100102628 | Ga0068867_1001026282 | 438 |
| 16 | 3300005466 | Ga0070685_10028263 | Ga0070685_100282632 | 438 |
| 17 | 3300039062 | Ga0400483_018242 | Ga0400483_018242_5771_7147 | 438 |
| 18 | 3300046660 | Ga0495625_0015263 | Ga0495625_0015263_3431_4750 | 438 |
| 19 | 3300049568 | Ga0501031_0128958 | Ga0501031_0128958_302_1630 | 438 |
| 20 | 3300049823 | Ga0501044_0183863 | Ga0501044_0183863_15_1352 | 439 |
| 21 | iso_pu_bacteria | 2923525760 | 2923527367 | 439 |
| 22 | 3300049572 | Ga0501036_0105384 | Ga0501036_0105384_553_1923 | 440 |
| 23 | iso_pu_bacteria | 2919493220 | 2919493743 | 440 |
| 24 | iso_pu_bacteria | 2919534386 | 2919536599 | 440 |
| 25 | iso_pu_bacteria | 2919543075 | 2919545626 | 440 |
| 26 | 3300003320 | rootH2_10012658 | rootH2_1001265889 | 441 |
| 27 | 3300048916 | Ga0496113_0116976 | Ga0496113_0116976_484_1845 | 441 |
| 28 | 3300049574 | Ga0501038_0000500 | Ga0501038_0000500_6131_7483 | 441 |
| 29 | 3300028800 | Ga0265338_10043333 | Ga0265338_100433334 | 443 |
| 30 | 3300049589 | Ga0501073_0003752 | Ga0501073_0003752_8865_10298 | 443 |
| 31 | 3300049742 | Ga0501080_0052905 | Ga0501080_0052905_660_2093 | 443 |
| 32 | 3300049744 | Ga0501083_0001453 | Ga0501083_0001453_13408_14799 | 443 |
| 33 | 3300049823 | Ga0501044_0001887 | Ga0501044_0001887_5179_6570 | 443 |
| 34 | 3300031731 | Ga0307405_10016515 | Ga0307405_100165153 | 444 |
| 35 | 3300031911 | Ga0307412_10000866 | Ga0307412_100008668 | 444 |
| 36 | 3300032004 | Ga0307414_10002587 | Ga0307414_100025873 | 444 |
| 37 | 3300046512 | Ga0495610_0001553 | Ga0495610_0001553_11243_12580 | 444 |
| 38 | 3300046515 | Ga0495620_0010179 | Ga0495620_0010179_1520_2857 | 444 |
| 39 | 3300048917 | Ga0496114_0016581 | Ga0496114_0016581_3183_4598 | 444 |
| 40 | 3300048918 | Ga0496115_0058098 | Ga0496115_0058098_653_2068 | 444 |
| 41 | 3300005329 | Ga0070683_100211797 | Ga0070683_1002117972 | 445 |
| 42 | 3300005330 | Ga0070690_100005887 | Ga0070690_1000058875 | 445 |
| 43 | 3300005331 | Ga0070670_100020715 | Ga0070670_1000207153 | 445 |
| 44 | 3300005338 | Ga0068868_100010709 | Ga0068868_1000107092 | 445 |
| 45 | 3300005340 | Ga0070689_100009668 | Ga0070689_1000096686 | 445 |
| 46 | 3300005367 | Ga0070667_100001223 | Ga0070667_1000012234 | 445 |
| 47 | 3300005544 | Ga0070686_100013313 | Ga0070686_1000133133 | 445 |
| 48 | 3300005564 | Ga0070664_100000900 | Ga0070664_10000090015 | 445 |
| 49 | 3300005615 | Ga0070702_100007747 | Ga0070702_1000077473 | 445 |
| 50 | 3300005617 | Ga0068859_100003052 | Ga0068859_1000030529 | 445 |
| 51 | 3300005842 | Ga0068858_100057350 | Ga0068858_1000573502 | 445 |
| 52 | 3300005843 | Ga0068860_100009817 | Ga0068860_1000098175 | 445 |
| 53 | 3300006237 | Ga0097621_100012010 | Ga0097621_1000120103 | 445 |
| 54 | 3300006358 | Ga0068871_100061054 | Ga0068871_1000610542 | 445 |
| 55 | 3300006931 | Ga0097620_100003052 | Ga0097620_1000030529 | 445 |
| 56 | 3300009098 | Ga0105245_10003339 | Ga0105245_100033398 | 445 |
| 57 | 3300009101 | Ga0105247_10001474 | Ga0105247_100014746 | 445 |
| 58 | 3300009148 | Ga0105243_10122182 | Ga0105243_101221822 | 445 |
| 59 | 3300009177 | Ga0105248_10010752 | Ga0105248_100107527 | 445 |
| 60 | 3300009551 | Ga0105238_10006007 | Ga0105238_100060078 | 445 |
| 61 | 3300013296 | Ga0157374_10003995 | Ga0157374_100039957 | 445 |
| 62 | 3300013308 | Ga0157375_10001697 | Ga0157375_100016974 | 445 |
| 63 | 3300014325 | Ga0163163_10004421 | Ga0163163_100044214 | 445 |
| 64 | 3300014968 | Ga0157379_10002963 | Ga0157379_100029637 | 445 |
| 65 | 3300014969 | Ga0157376_10052737 | Ga0157376_100527372 | 445 |
| 66 | 3300025936 | Ga0207670_10021273 | Ga0207670_100212733 | 445 |
| 67 | 3300025945 | Ga0207679_10068565 | Ga0207679_100685652 | 445 |
| 68 | 3300025986 | Ga0207658_10064520 | Ga0207658_100645202 | 445 |
| 69 | 3300026035 | Ga0207703_10023384 | Ga0207703_100233842 | 445 |
| 70 | 3300026088 | Ga0207641_10004134 | Ga0207641_100041349 | 445 |
| 71 | 3300026095 | Ga0207676_10025068 | Ga0207676_100250683 | 445 |
| 72 | 3300028379 | Ga0268266_10038776 | Ga0268266_100387763 | 445 |
| 73 | 3300035691 | Ga0373931_0025365 | Ga0373931_0025365_252_1661 | 445 |
| 74 | 3300042876 | Ga0451577_0009299 | Ga0451577_0009299_3684_5039 | 445 |
| 75 | 3300044712 | Ga0453684_0119751 | Ga0453684_0119751_1691_3046 | 445 |
| 76 | 3300045051 | Ga0451576_0023332 | Ga0451576_0023332_1024_2433 | 445 |
| 77 | 3300048912 | Ga0496109_0007421 | Ga0496109_0007421_5791_7200 | 445 |
| 78 | 3300048913 | Ga0496110_0188285 | Ga0496110_0188285_29_1402 | 445 |
| 79 | 3300048914 | Ga0496111_0040413 | Ga0496111_0040413_1914_3287 | 445 |
| 80 | 3300048915 | Ga0496112_0006325 | Ga0496112_0006325_6691_8100 | 445 |
| 81 | 3300036712 | Ga0316584_0014068 | Ga0316584_0014068_1314_2681 | 446 |
| 82 | 3300037588 | Ga0316581_0003288 | Ga0316581_0003288_402_1769 | 446 |
| 83 | 3300039062 | Ga0400483_062144 | Ga0400483_062144_8059_9429 | 446 |
| 84 | iso_pu_bacteria | 2840878972 | 2840884037 | 446 |
| 85 | 3300044712 | Ga0453684_0000838 | Ga0453684_0000838_70847_72208 | 447 |
| 86 | iso_pu_bacteria | 2891048133 | 2891052261 | 447 |
| 87 | 3300005329 | Ga0070683_100011322 | Ga0070683_1000113224 | 448 |
| 88 | 3300005614 | Ga0068856_100000776 | Ga0068856_10000077623 | 448 |
| 89 | 3300005614 | Ga0068856_100013718 | Ga0068856_1000137184 | 448 |
| 90 | 3300025949 | Ga0207667_10115765 | Ga0207667_101157652 | 448 |
| 91 | 3300026078 | Ga0207702_10018238 | Ga0207702_100182385 | 448 |
| 92 | 3300026078 | Ga0207702_10059451 | Ga0207702_100594513 | 448 |
| 93 | 3300033541 | Ga0316596_1002523 | Ga0316596_10025235 | 448 |
| 94 | 3300039062 | Ga0400483_031978 | Ga0400483_031978_85464_86840 | 448 |
| 95 | 3300039062 | Ga0400483_192144 | Ga0400483_192144_1642_3012 | 448 |
| 96 | 3300039062 | Ga0400483_221680 | Ga0400483_221680_92_1462 | 448 |
| 97 | 3300049569 | Ga0501032_0007778 | Ga0501032_0007778_1164_2543 | 448 |
| 98 | 3300049823 | Ga0501044_0000032 | Ga0501044_0000032_151119_152498 | 448 |
| 99 | 3300050516 | nmdc:mga0sz30_17156_c1 | nmdc:mga0sz30_17156_c1_58_1407 | 448 |
| 100 | 3300039062 | Ga0400483_144965 | Ga0400483_144965_29100_30479 | 449 |
| 101 | iso_pu_bacteria | 2738541317 | 2738945698 | 449 |
| 102 | iso_pu_bacteria | 2846952575 | 2846957004 | 449 |
| 103 | iso_pu_bacteria | 2848858292 | 2848861508 | 449 |
| 104 | iso_pu_bacteria | 2913308742 | 2913310620 | 449 |
| 105 | 3300005295 | Ga0065707_10083905 | Ga0065707_100839056 | 450 |
| 106 | 3300005440 | Ga0070705_100054996 | Ga0070705_1000549961 | 450 |
| 107 | 3300028381 | Ga0268264_10007130 | Ga0268264_100071305 | 450 |
| 108 | 3300036712 | Ga0316584_0014219 | Ga0316584_0014219_313_1710 | 450 |
| 109 | iso_pu_bacteria | 2837651117 | 2837654342 | 450 |
| 110 | 3300005341 | Ga0070691_10052180 | Ga0070691_100521802 | 451 |
| 111 | 3300014326 | Ga0157380_10168607 | Ga0157380_101686072 | 451 |
| 112 | 3300036401 | Ga0373937_0122471 | Ga0373937_0122471_679_2070 | 451 |
| 113 | 3300039062 | Ga0400483_148749 | Ga0400483_148749_464_1864 | 451 |
| 114 | 3300046529 | Ga0495652_0124169 | Ga0495652_0124169_472_1941 | 451 |
| 115 | 3300046660 | Ga0495625_0014725 | Ga0495625_0014725_257_1624 | 451 |
| 116 | 3300049577 | Ga0501041_0090088 | Ga0501041_0090088_513_1874 | 451 |
| 117 | iso_pu_bacteria | 2837678835 | 2837679002 | 451 |
| 118 | 3300014968 | Ga0157379_10078162 | Ga0157379_100781621 | 452 |
| 119 | 3300039062 | Ga0400483_113767 | Ga0400483_113767_1129_2532 | 452 |
| 120 | 3300054114 | Ga0501084_0086564 | Ga0501084_0086564_1114_2547 | 452 |
| 121 | iso_pu_bacteria | 2597490356 | 2599102340 | 452 |
| 122 | 3300039062 | Ga0400483_071737 | Ga0400483_071737_285_1769 | 453 |
| 123 | 3300053153 | Ga0500616_0000074 | Ga0500616_0000074_46597_47973 | 453 |
| 124 | 3300005843 | Ga0068860_100083230 | Ga0068860_1000832302 | 454 |
| 125 | 3300006175 | Ga0070712_100086488 | Ga0070712_1000864882 | 454 |
| 126 | 3300009147 | Ga0114129_10034549 | Ga0114129_100345495 | 454 |
| 127 | 3300025915 | Ga0207693_10085513 | Ga0207693_100855132 | 454 |
| 128 | 3300025916 | Ga0207663_10140522 | Ga0207663_101405222 | 454 |
| 129 | 3300028381 | Ga0268264_10066177 | Ga0268264_100661772 | 454 |
| 130 | 3300033541 | Ga0316596_1003043 | Ga0316596_10030431 | 454 |
| 131 | 3300037068 | Ga0373925_0024075 | Ga0373925_0024075_1759_3186 | 454 |
| 132 | iso_pu_bacteria | 2511231221 | 2512035813 | 454 |
| 133 | iso_pu_bacteria | 2597489875 | 2597810577 | 454 |
| 134 | 3300005354 | Ga0070675_100051956 | Ga0070675_1000519562 | 455 |
| 135 | 3300005364 | Ga0070673_100110931 | Ga0070673_1001109312 | 455 |
| 136 | 3300005543 | Ga0070672_100005632 | Ga0070672_1000056322 | 455 |
| 137 | 3300005543 | Ga0070672_100103764 | Ga0070672_1001037642 | 455 |
| 138 | 3300005840 | Ga0068870_10004252 | Ga0068870_100042524 | 455 |
| 139 | 3300005841 | Ga0068863_100147282 | Ga0068863_1001472822 | 455 |
| 140 | 3300006237 | Ga0097621_100076411 | Ga0097621_1000764112 | 455 |
| 141 | 3300009093 | Ga0105240_10267262 | Ga0105240_102672622 | 455 |
| 142 | 3300025893 | Ga0207682_10000460 | Ga0207682_100004607 | 455 |
| 143 | 3300025926 | Ga0207659_10023892 | Ga0207659_100238922 | 455 |
| 144 | 3300025934 | Ga0207686_10070370 | Ga0207686_100703701 | 455 |
| 145 | 3300025940 | Ga0207691_10003078 | Ga0207691_1000307813 | 455 |
| 146 | 3300025940 | Ga0207691_10091825 | Ga0207691_100918252 | 455 |
| 147 | 3300025942 | Ga0207689_10051691 | Ga0207689_100516913 | 455 |
| 148 | 3300025960 | Ga0207651_10024624 | Ga0207651_100246242 | 455 |
| 149 | 3300026089 | Ga0207648_10025130 | Ga0207648_100251303 | 455 |
| 150 | 3300026118 | Ga0207675_100084181 | Ga0207675_1000841812 | 455 |
| 151 | 3300026118 | Ga0207675_100102841 | Ga0207675_1001028412 | 455 |
| 152 | 3300026121 | Ga0207683_10021106 | Ga0207683_100211064 | 455 |
| 153 | 3300031507 | Ga0307509_10008486 | Ga0307509_100084866 | 455 |
| 154 | 3300031995 | Ga0307409_100077331 | Ga0307409_1000773312 | 455 |
| 155 | 3300033541 | Ga0316596_1002630 | Ga0316596_10026303 | 455 |
| 156 | 3300035398 | Ga0316574_0005375 | Ga0316574_0005375_2533_3930 | 455 |
| 157 | 3300036647 | Ga0316582_0064491 | Ga0316582_0064491_139_1536 | 455 |
| 158 | 3300039062 | Ga0400483_280444 | Ga0400483_280444_114_1523 | 455 |
| 159 | iso_pu_bacteria | 2582581866 | 2585398051 | 455 |
| 160 | iso_pu_bacteria | 2838074704 | 2838077759 | 455 |
| 161 | iso_pu_bacteria | 2913295892 | 2913296717 | 455 |
| 162 | 3300045051 | Ga0451576_0000449 | Ga0451576_0000449_49974_51380 | 456 |
| 163 | 3300053733 | Ga0500552_000421 | Ga0500552_000421_2498_3883 | 456 |
| 164 | iso_pu_bacteria | 2657244999 | 2657683377 | 456 |
| 165 | iso_pu_bacteria | 2791355082 | 2792580456 | 456 |
| 166 | iso_pu_bacteria | 2802429268 | 2804754677 | 456 |
| 167 | iso_pu_bacteria | 2896384573 | 2896391873 | 456 |
| 168 | iso_pu_bacteria | 2920760137 | 2920764985 | 456 |
| 169 | iso_pu_bacteria | 8049293176 | 8049298507 | 456 |
| 170 | iso_pu_bacteria | 8054558443 | 8054563605 | 456 |
| 171 | 3300031691 | Ga0316579_10038386 | Ga0316579_100383861 | 457 |
| 172 | 3300033524 | Ga0316592_1000294 | Ga0316592_10002945 | 457 |
| 173 | 3300033541 | Ga0316596_1000407 | Ga0316596_10004072 | 457 |
| 174 | 3300036647 | Ga0316582_0014450 | Ga0316582_0014450_862_2259 | 457 |
| 175 | 3300036712 | Ga0316584_0080571 | Ga0316584_0080571_478_1875 | 457 |
| 176 | 3300037588 | Ga0316581_0005685 | Ga0316581_0005685_300_1697 | 457 |
| 177 | 3300042876 | Ga0451577_0000091 | Ga0451577_0000091_138326_139765 | 457 |
| 178 | 3300044712 | Ga0453684_0000632 | Ga0453684_0000632_4277_5716 | 457 |
| 179 | iso_pu_bacteria | 8054002106 | 8054003600 | 457 |
| 180 | 3300005355 | Ga0070671_100028552 | Ga0070671_1000285523 | 458 |
| 181 | 3300005842 | Ga0068858_100001710 | Ga0068858_1000017103 | 458 |
| 182 | 3300006177 | Ga0075362_10000042 | Ga0075362_100000427 | 458 |
| 183 | 3300006186 | Ga0075369_10001319 | Ga0075369_100013195 | 458 |
| 184 | 3300025931 | Ga0207644_10005436 | Ga0207644_100054365 | 458 |
| 185 | 3300025941 | Ga0207711_10082036 | Ga0207711_100820362 | 458 |
| 186 | 3300025972 | Ga0207668_10166690 | Ga0207668_101666901 | 458 |
| 187 | 3300032126 | Ga0307415_100093597 | Ga0307415_1000935972 | 458 |
| 188 | 3300033541 | Ga0316596_1014933 | Ga0316596_10149331 | 458 |
| 189 | 3300035692 | Ga0373935_0062949 | Ga0373935_0062949_839_2239 | 458 |
| 190 | 3300036647 | Ga0316582_0003576 | Ga0316582_0003576_2934_4340 | 458 |
| 191 | 3300037068 | Ga0373925_0003815 | Ga0373925_0003815_9818_11218 | 458 |
| 192 | 3300038726 | Ga0400490_02808 | Ga0400490_02808_2947_4353 | 458 |
| 193 | 3300038727 | Ga0400491_23555 | Ga0400491_23555_6443_7849 | 458 |
| 194 | 3300047472 | Ga0495686_0056507 | Ga0495686_0056507_275_1663 | 458 |
| 195 | 3300003215 | JGI25153J46596_10000010 | JGI25153J46596_10000010270 | 459 |
| 196 | 3300003323 | rootH1_10267483 | rootH1_102674832 | 459 |
| 197 | 3300003794 | Ga0055531_10019110 | Ga0055531_100191102 | 459 |
| 198 | 3300005844 | Ga0068862_100006952 | Ga0068862_1000069523 | 459 |
| 199 | 3300021320 | Ga0214544_1007743 | Ga0214544_10077438 | 459 |
| 200 | 3300021321 | Ga0214542_1000082 | Ga0214542_1000082107 | 459 |
| 201 | 3300021327 | Ga0214543_1000075 | Ga0214543_1000075107 | 459 |
| 202 | 3300025297 | Ga0209758_1000033 | Ga0209758_1000033413 | 459 |
| 203 | 3300025297 | Ga0209758_1016919 | Ga0209758_10169193 | 459 |
| 204 | 3300025298 | Ga0209050_1004613 | Ga0209050_10046134 | 459 |
| 205 | 3300025304 | Ga0209257_1000237 | Ga0209257_100023784 | 459 |
| 206 | 3300028380 | Ga0268265_10008102 | Ga0268265_100081022 | 459 |
| 207 | 3300031730 | Ga0307516_10052291 | Ga0307516_100522912 | 459 |
| 208 | 3300031995 | Ga0307409_100053391 | Ga0307409_1000533912 | 459 |
| 209 | 3300044712 | Ga0453684_0054058 | Ga0453684_0054058_1791_3215 | 459 |
| 210 | 3300044712 | Ga0453684_0073999 | Ga0453684_0073999_1163_2584 | 459 |
| 211 | 3300049587 | Ga0501071_0057276 | Ga0501071_0057276_12_1445 | 459 |
| 212 | 3300053139 | Ga0500568_0026229 | Ga0500568_0026229_599_2017 | 459 |
| 213 | 3300005327 | Ga0070658_10000486 | Ga0070658_100004866 | 460 |
| 214 | 3300005937 | Ga0081455_10064098 | Ga0081455_100640982 | 460 |
| 215 | 3300046453 | Ga0495627_000799 | Ga0495627_000799_15169_16560 | 460 |
| 216 | 3300046471 | Ga0495650_0000565 | Ga0495650_0000565_46300_47691 | 460 |
| 217 | 3300046523 | Ga0495644_0005626 | Ga0495644_0005626_2194_3588 | 460 |
| 218 | 3300046539 | Ga0495621_0007641 | Ga0495621_0007641_1137_2531 | 460 |
| 219 | 3300046615 | Ga0495656_0015274 | Ga0495656_0015274_1423_2817 | 460 |
| 220 | 3300046683 | Ga0495658_0044903 | Ga0495658_0044903_430_1824 | 460 |
| 221 | 3300047470 | Ga0495681_0000014 | Ga0495681_0000014_136731_138122 | 460 |
| 222 | 3300048917 | Ga0496114_0010463 | Ga0496114_0010463_2703_4091 | 460 |
| 223 | 3300048929 | Ga0496126_0002855 | Ga0496126_0002855_16259_17647 | 460 |
| 224 | 3300053153 | Ga0500616_0004027 | Ga0500616_0004027_8301_9695 | 460 |
| 225 | iso_pu_bacteria | 8005658619 | 8005662741 | 460 |
| 226 | 3300050496 | nmdc:mga07m45_37919_c1 | nmdc:mga07m45_37919_c1_432_1952 | 461 |
| 227 | 3300005295 | Ga0065707_10133118 | Ga0065707_101331181 | 462 |
| 228 | 3300049573 | Ga0501037_0111545 | Ga0501037_0111545_286_1719 | 462 |
| 229 | 3300049581 | Ga0501047_0082802 | Ga0501047_0082802_1068_2501 | 462 |
| 230 | 3300049744 | Ga0501083_0013371 | Ga0501083_0013371_88_1521 | 462 |
| 231 | 3300050496 | nmdc:mga07m45_473_c1 | nmdc:mga07m45_473_c1_3527_4927 | 462 |
| 232 | 3300053177 | Ga0500636_0061915 | Ga0500636_0061915_155_1618 | 462 |
| 233 | iso_pu_bacteria | 2739367664 | 2739650261 | 462 |
| 234 | iso_pu_bacteria | 2739367865 | 2740028734 | 462 |
| 235 | 3300035695 | Ga0373927_0006067 | Ga0373927_0006067_4326_5762 | 463 |
| 236 | 3300035725 | Ga0373947_0023724 | Ga0373947_0023724_1985_3421 | 463 |
| 237 | 3300037068 | Ga0373925_0069798 | Ga0373925_0069798_393_1829 | 463 |
| 238 | iso_pu_bacteria | 2508501009 | 2508541647 | 463 |
| 239 | iso_pu_bacteria | 8056681323 | 8056687272 | 463 |
| 240 | 3300005356 | Ga0070674_100069854 | Ga0070674_1000698542 | 464 |
| 241 | 3300005364 | Ga0070673_100035714 | Ga0070673_1000357143 | 464 |
| 242 | 3300005563 | Ga0068855_100115257 | Ga0068855_1001152572 | 464 |
| 243 | 3300005616 | Ga0068852_100019858 | Ga0068852_1000198583 | 464 |
| 244 | 3300009174 | Ga0105241_10036769 | Ga0105241_100367692 | 464 |
| 245 | 3300010375 | Ga0105239_10153081 | Ga0105239_101530812 | 464 |
| 246 | 3300013307 | Ga0157372_10256815 | Ga0157372_102568151 | 464 |
| 247 | 3300025907 | Ga0207645_10015834 | Ga0207645_100158343 | 464 |
| 248 | 3300025940 | Ga0207691_10085255 | Ga0207691_100852553 | 464 |
| 249 | 3300026023 | Ga0207677_10060707 | Ga0207677_100607072 | 464 |
| 250 | 3300026116 | Ga0207674_10011136 | Ga0207674_100111364 | 464 |
| 251 | 3300026121 | Ga0207683_10038214 | Ga0207683_100382142 | 464 |
| 252 | 3300035691 | Ga0373931_0080347 | Ga0373931_0080347_129_1553 | 464 |
| 253 | 3300049572 | Ga0501036_0233542 | Ga0501036_0233542_38_1459 | 464 |
| 254 | 3300049578 | Ga0501042_0073526 | Ga0501042_0073526_210_1631 | 464 |
| 255 | 3300049823 | Ga0501044_0048823 | Ga0501044_0048823_564_2003 | 464 |
| 256 | 3300005841 | Ga0068863_100005703 | Ga0068863_10000570310 | 465 |
| 257 | 3300005843 | Ga0068860_100004891 | Ga0068860_1000048915 | 465 |
| 258 | 3300005844 | Ga0068862_100000095 | Ga0068862_10000009531 | 465 |
| 259 | 3300006353 | Ga0075370_10003519 | Ga0075370_100035192 | 465 |
| 260 | 3300009553 | Ga0105249_10000079 | Ga0105249_100000798 | 465 |
| 261 | 3300025961 | Ga0207712_10000030 | Ga0207712_1000003077 | 465 |
| 262 | 3300026088 | Ga0207641_10001899 | Ga0207641_100018995 | 465 |
| 263 | 3300028380 | Ga0268265_10000132 | Ga0268265_1000013270 | 465 |
| 264 | 3300028381 | Ga0268264_10000779 | Ga0268264_1000077918 | 465 |
| 265 | 3300031456 | Ga0307513_10000914 | Ga0307513_1000091418 | 465 |
| 266 | 3300031456 | Ga0307513_10014670 | Ga0307513_100146707 | 465 |
| 267 | 3300031731 | Ga0307405_10031886 | Ga0307405_100318863 | 465 |
| 268 | 3300046462 | Ga0495651_0050937 | Ga0495651_0050937_406_1848 | 465 |
| 269 | 3300049571 | Ga0501034_0197008 | Ga0501034_0197008_375_1778 | 465 |
| 270 | 3300050489 | nmdc:mga03683_53_c1 | nmdc:mga03683_53_c1_40045_41535 | 465 |
| 271 | 3300050490 | nmdc:mga03n38_2795_c1 | nmdc:mga03n38_2795_c1_3735_5225 | 465 |
| 272 | 3300050516 | nmdc:mga0sz30_78_c2 | nmdc:mga0sz30_78_c2_20346_21836 | 465 |
| 273 | 3300053087 | Ga0500643_008178 | Ga0500643_008178_86_1498 | 465 |
| 274 | 3300053156 | Ga0500622_0006886 | Ga0500622_0006886_4781_6247 | 465 |
| 275 | iso_pu_bacteria | 2643221547 | 2643754609 | 465 |
| 276 | 3300005518 | Ga0070699_100006662 | Ga0070699_1000066627 | 466 |
| 277 | 3300005563 | Ga0068855_100031451 | Ga0068855_1000314514 | 466 |
| 278 | 3300005578 | Ga0068854_100000459 | Ga0068854_10000045924 | 466 |
| 279 | 3300005614 | Ga0068856_100011271 | Ga0068856_1000112715 | 466 |
| 280 | 3300005616 | Ga0068852_100000231 | Ga0068852_10000023125 | 466 |
| 281 | 3300006195 | Ga0075366_10000086 | Ga0075366_1000008630 | 466 |
| 282 | 3300006353 | Ga0075370_10000026 | Ga0075370_100000264 | 466 |
| 283 | 3300009093 | Ga0105240_10013931 | Ga0105240_1001393110 | 466 |
| 284 | 3300025904 | Ga0207647_10016969 | Ga0207647_100169693 | 466 |
| 285 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004166 | 466 |
| 286 | 3300025949 | Ga0207667_10073620 | Ga0207667_100736202 | 466 |
| 287 | 3300025981 | Ga0207640_10000508 | Ga0207640_100005085 | 466 |
| 288 | 3300026078 | Ga0207702_10004366 | Ga0207702_100043668 | 466 |
| 289 | 3300026142 | Ga0207698_10000058 | Ga0207698_1000005825 | 466 |
| 290 | 3300042436 | Ga0439435_0006568 | Ga0439435_0006568_229_1647 | 466 |
| 291 | 3300050496 | nmdc:mga07m45_30_c1 | nmdc:mga07m45_30_c1_28558_29970 | 466 |
| 292 | 3300005353 | Ga0070669_100069163 | Ga0070669_1000691632 | 467 |
| 293 | 3300006042 | Ga0075368_10000041 | Ga0075368_100000417 | 467 |
| 294 | 3300006177 | Ga0075362_10001396 | Ga0075362_100013965 | 467 |
| 295 | 3300006195 | Ga0075366_10008795 | Ga0075366_100087951 | 467 |
| 296 | 3300027866 | Ga0209813_10000435 | Ga0209813_100004357 | 467 |
| 297 | 3300050489 | nmdc:mga03683_313_c1 | nmdc:mga03683_313_c1_7546_8988 | 467 |
| 298 | 3300050490 | nmdc:mga03n38_46312_c1 | nmdc:mga03n38_46312_c1_411_1853 | 467 |
| 299 | 3300050491 | nmdc:mga00v17_1428_c1 | nmdc:mga00v17_1428_c1_9532_10974 | 467 |
| 300 | 3300050494 | nmdc:mga06z11_282_c1 | nmdc:mga06z11_282_c1_16330_17772 | 467 |
| 301 | 3300050495 | nmdc:mga04h51_81_c1 | nmdc:mga04h51_81_c1_5315_6757 | 467 |
| 302 | 3300050496 | nmdc:mga07m45_17_c1 | nmdc:mga07m45_17_c1_26421_27863 | 467 |
| 303 | 3300048926 | Ga0496123_0090645 | Ga0496123_0090645_112_1647 | 468 |
| 304 | iso_pu_bacteria | 2510917021 | 2511127388 | 468 |
| 305 | iso_pu_bacteria | 2896184354 | 2896185267 | 468 |
| 306 | 3300053121 | Ga0500607_000240 | Ga0500607_000240_16479_17894 | 469 |
| 307 | 3300053122 | Ga0500608_000224 | Ga0500608_000224_3179_4726 | 469 |
| 308 | 3300053136 | Ga0500559_0015761 | Ga0500559_0015761_1234_2781 | 469 |
| 309 | 3300053138 | Ga0500564_000656 | Ga0500564_000656_778_2325 | 469 |
| 310 | 3300053729 | Ga0500625_000037 | Ga0500625_000037_30270_31817 | 469 |
| 311 | 3300002459 | JGI24751J29686_10000134 | JGI24751J29686_1000013431 | 471 |
| 312 | 3300005616 | Ga0068852_100098575 | Ga0068852_1000985752 | 471 |
| 313 | 3300006058 | Ga0075432_10001736 | Ga0075432_100017364 | 471 |
| 314 | 3300025903 | Ga0207680_10029494 | Ga0207680_100294943 | 471 |
| 315 | 3300031616 | Ga0307508_10034010 | Ga0307508_100340103 | 471 |
| 316 | 3300005844 | Ga0068862_100004950 | Ga0068862_1000049504 | 472 |
| 317 | 3300031911 | Ga0307412_10029158 | Ga0307412_100291582 | 472 |
| 318 | 3300032004 | Ga0307414_10031392 | Ga0307414_100313922 | 472 |
| 319 | 3300046500 | Ga0495596_0000313 | Ga0495596_0000313_27586_29004 | 472 |
| 320 | 3300046506 | Ga0495583_0012249 | Ga0495583_0012249_2975_4393 | 472 |
| 321 | 3300046519 | Ga0495632_0057373 | Ga0495632_0057373_77_1495 | 472 |
| 322 | 3300046522 | Ga0495643_0005754 | Ga0495643_0005754_3701_5119 | 472 |
| 323 | 3300046660 | Ga0495625_0058477 | Ga0495625_0058477_1215_2633 | 472 |
| 324 | 3300050516 | nmdc:mga0sz30_5677_c1 | nmdc:mga0sz30_5677_c1_68_1510 | 472 |
| 325 | 3300050493 | nmdc:mga0k408_5_c2 | nmdc:mga0k408_5_c2_71926_73416 | 473 |
| 326 | 2162886007 | SwRhRL2b_contig_539634 | SwRhRL2b_0834.00010560 | 476 |
| 327 | 3300005289 | Ga0065704_10000191 | Ga0065704_10000191144 | 476 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.9263 | 47 | 460 |
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.9216 | 47 | 460 |
| 2i49-assembly1.cif.gz_A | crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 | 0.8982 | 47 | 462 |
| 2i49-assembly1.cif.gz_A | crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 | 0.8939 | 47 | 462 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8429 | 50 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9253 | 47 | 435 | 3.40.190.10 |
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9008 | 47 | 435 | 3.40.190.10 |
| 2g29A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8812 | 134 | 271 | 3.40.190.10 |
| 2i4cA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.869 | 135 | 266 | 3.40.190.10 |
| 2x7qA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8515 | 51 | 337 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F9KG26-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9952 | 63 | 381 |
GO:0005886
GO:0012505 |
| AF-A0A0F9KG26-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9921 | 63 | 381 |
GO:0005886
GO:0012505 |
| AF-A0A1J5QUN4-F1-model_v4 | Bicarbonate transport ATP-binding protein CmpC (EC 3.6.3.-) | 0.9624 | 50 | 413 |
GO:0005524
GO:0005886 GO:0012505 GO:0016787 |
| AF-A0A3M3HDL5-F1-model_v4 | deleted | 0.9578 | 48 | 463 |
|
| AF-A0A838WII5-F1-model_v4 | ABC transporter substrate-binding protein | 0.9575 | 48 | 337 |
GO:0005524
GO:0005886 GO:0006811 GO:0015112 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar