F408985

General Info

Members Datasets Scaffolds Average Seq Length
327 210 654 142

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_338149_c1|nmdc:mga06r32_338149_c1_607_1125
Length 172
Sequence MWPGDRRHHALSHSHLHGQDVAPGAAYAGAVSDDNGSRPARVEDVHELALAMPHTTVEYGTGDNPIYQVGGKSFIFFRNPRPDAVDPDTGERYPDVIVFWVESEADKQALVQNEASPFFTTAHFDGHPSVLLRASRIGELTWDELAEMVQDAWLSRASARRAAAWLSAHPPA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 16.51
Rhizosphere 78.29
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_338149_c1 3300050510 Bacteria 1490
2 Ga0070683_100764057 3300005329 Bacteria 926
3 Ga0070680_100712950 3300005336 Bacteria 863
4 Ga0070682_100020438 3300005337 Bacteria 3895
5 Ga0070682_100258388 3300005337 Unclassified 1259
6 Ga0068868_100186176 3300005338 Bacteria 1725
7 Ga0070660_100226982 3300005339 Bacteria 1519
8 Ga0070691_10276097 3300005341 Bacteria 910
9 Ga0070687_100080494 3300005343 Bacteria 1776
10 Ga0070661_100521762 3300005344 Bacteria 953
11 Ga0070668_100000781 3300005347 Bacteria 21972
12 Ga0070669_100212401 3300005353 Bacteria 1527
13 Ga0070675_100147986 3300005354 Bacteria 2012
14 Ga0070667_100830404 3300005367 Bacteria 859
15 Ga0070709_10794735 3300005434 Unclassified 742
16 Ga0070714_100059932 3300005435 Bacteria 3265
17 Ga0070713_100413615 3300005436 Bacteria 1261
18 Ga0070713_100972999 3300005436 Bacteria 818
19 Ga0070681_11102388 3300005458 Bacteria 715
20 Ga0070685_10347642 3300005466 Bacteria 1013
21 Ga0070706_100018449 3300005467 Bacteria 6434
22 Ga0070698_100194303 3300005471 Bacteria 1966
23 Ga0070684_100001453 3300005535 Bacteria 17087
24 Ga0070684_100404589 3300005535 Bacteria 1259
25 Ga0068853_100474262 3300005539 Bacteria 1179
26 Ga0070665_100096157 3300005548 Bacteria 2967
27 Ga0070665_100239572 3300005548 Bacteria 1815
28 Ga0070665_100313425 3300005548 Bacteria 1573
29 Ga0068855_100063650 3300005563 Bacteria 4304
30 Ga0068857_100010452 3300005577 Bacteria 8067
31 Ga0068856_100041335 3300005614 Bacteria 4531
32 Ga0070702_100977248 3300005615 Bacteria 668
33 Ga0068852_100607760 3300005616 Unclassified 1098
34 Ga0068864_100050091 3300005618 Bacteria 3594
35 Ga0068864_101077724 3300005618 Bacteria 799
36 Ga0068861_100113045 3300005719 Bacteria 2178
37 Ga0068863_100026115 3300005841 Bacteria 5572
38 Ga0068858_100033463 3300005842 Bacteria 4770
39 Ga0070717_10319856 3300006028 Bacteria 1382
40 Ga0075365_10163241 3300006038 Bacteria 1553
41 Ga0070712_101214868 3300006175 Bacteria 656
42 Ga0068871_100193274 3300006358 Bacteria 1754
43 Ga0075428_100038415 3300006844 Bacteria 5268
44 Ga0075430_100030580 3300006846 Bacteria 4573
45 Ga0075430_100401151 3300006846 Bacteria 1132
46 Ga0075431_100032592 3300006847 Bacteria 5369
47 Ga0075431_100051675 3300006847 Bacteria 4238
48 Ga0075431_100261269 3300006847 Bacteria 1757
49 Ga0075429_100005848 3300006880 Bacteria 10614
50 Ga0075429_100625563 3300006880 Bacteria 943
51 Ga0068865_100026604 3300006881 Bacteria 3816
52 Ga0105245_10739723 3300009098 Bacteria 1019
53 Ga0114129_10011055 3300009147 Bacteria 12858
54 Ga0114129_10028864 3300009147 Bacteria 7860
55 Ga0114129_10223565 3300009147 Bacteria 2539
56 Ga0114129_10361498 3300009147 Bacteria 1921
57 Ga0105242_10219428 3300009176 Bacteria 1699
58 Ga0105242_10247148 3300009176 Bacteria 1606
59 Ga0105248_10323705 3300009177 Bacteria 1736
60 Ga0105248_10423098 3300009177 Bacteria 1500
61 Ga0105248_10880547 3300009177 Bacteria 1011
62 Ga0105237_10352969 3300009545 Bacteria 1475
63 Ga0105237_10907761 3300009545 Bacteria 888
64 Ga0105238_10805137 3300009551 Bacteria 955
65 Ga0105238_11264608 3300009551 Bacteria 763
66 Ga0105238_11294832 3300009551 Bacteria 755
67 Ga0105249_10027261 3300009553 Bacteria 5155
68 Ga0105249_10734878 3300009553 Bacteria 1048
69 Ga0105239_10002517 3300010375 Bacteria 23310
70 Ga0105239_10952276 3300010375 Bacteria 986
71 Ga0105246_10003135 3300011119 Bacteria 10041
72 Ga0157371_10047688 3300013102 Bacteria 3046
73 Ga0157370_10296102 3300013104 Bacteria 1494
74 Ga0157369_10124929 3300013105 Bacteria 2729
75 Ga0157369_10524483 3300013105 Bacteria 1225
76 Ga0157374_11486973 3300013296 Bacteria 701
77 Ga0157374_11544572 3300013296 Bacteria 687
78 Ga0163162_10350865 3300013306 Bacteria 1608
79 Ga0163162_10518735 3300013306 Bacteria 1321
80 Ga0163162_11386338 3300013306 Unclassified 800
81 Ga0163162_11556777 3300013306 Bacteria 754
82 Ga0157372_10020972 3300013307 Bacteria 7054
83 Ga0157372_10622015 3300013307 Bacteria 1258
84 Ga0157372_12008193 3300013307 Bacteria 665
85 Ga0157375_10071350 3300013308 Bacteria 3486
86 Ga0163163_10057398 3300014325 Bacteria 3849
87 Ga0163163_10097126 3300014325 Bacteria 2966
88 Ga0163163_10914515 3300014325 Bacteria 941
89 Ga0157377_10058769 3300014745 Bacteria 2190
90 Ga0157379_10041216 3300014968 Bacteria 4122
91 Ga0157376_10755397 3300014969 Bacteria 982
92 Ga0157376_11720299 3300014969 Unclassified 663
93 Ga0213875_10002613 3300021388 Bacteria 10689
94 Ga0224712_10149424 3300022467 Unclassified 1034
95 Ga0207642_10503135 3300025899 Bacteria 742
96 Ga0207688_10065298 3300025901 Bacteria 2056
97 Ga0207705_10223275 3300025909 Bacteria 1431
98 Ga0207684_10020576 3300025910 Bacteria 5638
99 Ga0207707_10213298 3300025912 Bacteria 1681
100 Ga0207671_10357492 3300025914 Bacteria 1159
101 Ga0207660_10606811 3300025917 Bacteria 891
102 Ga0207662_10031924 3300025918 Bacteria 3062
103 Ga0207657_10172796 3300025919 Bacteria 1750
104 Ga0207681_10372588 3300025923 Bacteria 1148
105 Ga0207694_11685576 3300025924 Bacteria 534
106 Ga0207664_10346121 3300025929 Bacteria 1315
107 Ga0207709_10308352 3300025935 Bacteria 1180
108 Ga0207704_10559159 3300025938 Bacteria 931
109 Ga0207711_10285548 3300025941 Bacteria 1520
110 Ga0207661_10047357 3300025944 Bacteria 3412
111 Ga0207661_10211505 3300025944 Bacteria 1710
112 Ga0207679_11602618 3300025945 Bacteria 597
113 Ga0207712_10090209 3300025961 Bacteria 2255
114 Ga0207712_10378702 3300025961 Bacteria 1184
115 Ga0207668_10002270 3300025972 Bacteria 11220
116 Ga0207668_10573839 3300025972 Bacteria 980
117 Ga0207658_10727285 3300025986 Bacteria 898
118 Ga0207677_10047961 3300026023 Bacteria 2872
119 Ga0207703_10126955 3300026035 Bacteria 2197
120 Ga0207639_10323270 3300026041 Bacteria 1370
121 Ga0207702_10685706 3300026078 Bacteria 1009
122 Ga0207702_10812323 3300026078 Bacteria 924
123 Ga0207641_10019575 3300026088 Bacteria 5557
124 Ga0207676_10134009 3300026095 Bacteria 2111
125 Ga0207676_10276797 3300026095 Bacteria 1522
126 Ga0207674_10005161 3300026116 Bacteria 15569
127 Ga0207675_100187862 3300026118 Bacteria 1981
128 Ga0207683_10072047 3300026121 Bacteria 3056
129 Ga0207698_12065553 3300026142 Bacteria 584
130 Ga0207698_12234549 3300026142 Unclassified 560
131 Ga0268266_10226616 3300028379 Bacteria 1720
132 Ga0268266_10546955 3300028379 Bacteria 1109
133 Ga0268264_10038437 3300028381 Bacteria 3951
134 Ga0307515_10079627 3300028794 Bacteria 4288
135 Ga0307513_10117427 3300031456 Bacteria 2638
136 Ga0307513_10228557 3300031456 Bacteria 1675
137 Ga0307508_10000627 3300031616 Bacteria 42456
138 Ga0307508_10013698 3300031616 Bacteria 7405
139 Ga0307516_10022998 3300031730 Bacteria 6395
140 Ga0307516_10034173 3300031730 Bacteria 5112
141 Ga0307405_10801064 3300031731 Bacteria 789
142 Ga0307410_11367461 3300031852 Bacteria 621
143 Ga0307406_10237498 3300031901 Bacteria 1365
144 Ga0307406_11460555 3300031901 Bacteria 601
145 Ga0307407_10158107 3300031903 Bacteria 1480
146 Ga0307407_10225849 3300031903 Bacteria 1269
147 Ga0307416_100242436 3300032002 Bacteria 1748
148 Ga0307416_101909103 3300032002 Bacteria 697
149 Ga0307507_10112189 3300033179 Bacteria 2222
150 Ga0373938_0129040 3300034957 Bacteria 658
151 Ga0373926_0002469 3300035083 Bacteria 5864
152 Ga0373934_0243784 3300035086 Bacteria 743
153 Ga0373944_0152103 3300035089 Bacteria 816
154 Ga0373932_0094689 3300035112 Bacteria 964
155 Ga0373941_0026194 3300035115 Bacteria 1691
156 Ga0373945_0045747 3300035116 Bacteria 1595
157 Ga0373943_0562923 3300035170 Bacteria 669
158 Ga0373946_0256181 3300035171 Bacteria 855
159 Ga0373942_0000084 3300035207 Bacteria 20309
160 Ga0373935_0001212 3300035692 Bacteria 14220
161 Ga0373935_0323724 3300035692 Bacteria 1094
162 Ga0373947_0000027 3300035725 Bacteria 81186
163 Ga0373947_0067811 3300035725 Bacteria 2180
164 Ga0373925_0587014 3300037068 Bacteria 917
165 Ga0395899_0215730 3300037312 Bacteria 1331
166 Ga0395900_0314786 3300037418 Bacteria 1547
167 Ga0395898_0152000 3300037466 Bacteria 2214
168 Ga0395905_0276352 3300037471 Bacteria 1565
169 Ga0436364_1422884 3300037853 Bacteria 63821
170 Ga0395901_0021388 3300038443 Bacteria 6628
171 Ga0395901_0191528 3300038443 Bacteria 2144
172 Ga0436362_0858723 3300039453 Bacteria 1805
173 Ga0451843_1160304 3300041509 Bacteria 1304
174 Ga0451843_1193484 3300041509 Bacteria 1024
175 Ga0466972_0033752 3300044658 Bacteria 2510
176 Ga0466961_0043587 3300044693 Bacteria 2873
177 Ga0466961_0219690 3300044693 Bacteria 1171
178 Ga0466961_0276204 3300044693 Bacteria 1029
179 Ga0466963_1265651 3300044694 Bacteria 518
180 Ga0466964_0064725 3300044706 Bacteria 1530
181 Ga0466964_0138922 3300044706 Bacteria 1115
182 Ga0466971_0199164 3300044719 Bacteria 945
183 Ga0466971_0663684 3300044719 Bacteria 523
184 Ga0466968_0415006 3300044735 Bacteria 661
185 Ga0466970_0001961 3300044765 Bacteria 9953
186 Ga0466970_0020106 3300044765 Bacteria 3465
187 Ga0466970_0079239 3300044765 Bacteria 1773
188 Ga0466970_0091442 3300044765 Bacteria 1652
189 Ga0466960_0050439 3300044901 Bacteria 2006
190 Ga0466959_0075972 3300045049 Bacteria 2426
191 Ga0466967_0060611 3300045976 Bacteria 3354
192 Ga0466967_0184354 3300045976 Bacteria 1970
193 Ga0466967_0233668 3300045976 Bacteria 1751
194 Ga0466967_0253290 3300045976 Bacteria 1682
195 Ga0466967_0314134 3300045976 Bacteria 1510
196 Ga0466967_0398323 3300045976 Bacteria 1339
197 Ga0466967_0590529 3300045976 Bacteria 1095
198 Ga0466967_1178411 3300045976 Bacteria 763
199 Ga0495592_0590210 3300046454 Bacteria 679
200 Ga0495603_0072279 3300046455 Bacteria 2027
201 Ga0495629_0892810 3300046459 Bacteria 583
202 Ga0495638_0084674 3300046460 Bacteria 1919
203 Ga0495651_0617713 3300046462 Bacteria 682
204 Ga0495639_0183349 3300046475 Bacteria 1020
205 Ga0495662_0096868 3300046476 Bacteria 1442
206 Ga0495662_0322248 3300046476 Bacteria 760
207 Ga0495618_0093258 3300046514 Bacteria 1925
208 Ga0495628_1030143 3300046516 Bacteria 565
209 Ga0495630_0320578 3300046517 Bacteria 1185
210 Ga0495630_0746491 3300046517 Bacteria 748
211 Ga0495666_0122485 3300046526 Bacteria 1217
212 Ga0495640_0039730 3300046533 Bacteria 3299
213 Ga0495645_0045481 3300046543 Bacteria 3203
214 Ga0495645_0263165 3300046543 Bacteria 1141
215 Ga0495668_0000269 3300046616 Bacteria 73430
216 Ga0495634_0673081 3300046642 Bacteria 596
217 Ga0495625_0001474 3300046660 Bacteria 28440
218 Ga0495635_0148049 3300046663 Bacteria 1598
219 Ga0495599_0440167 3300046678 Bacteria 773
220 Ga0495647_0045644 3300046681 Bacteria 1684
221 Ga0495658_0044291 3300046683 Bacteria 2493
222 Ga0495613_0033695 3300046689 Bacteria 3804
223 Ga0495624_0132632 3300046690 Bacteria 1527
224 Ga0495624_0227038 3300046690 Bacteria 1131
225 Ga0495600_0063203 3300046809 Bacteria 2419
226 Ga0495581_0292332 3300047315 Bacteria 952
227 Ga0495683_0038116 3300047323 Bacteria 2434
228 Ga0495684_0314340 3300047471 Bacteria 1121
229 Ga0495593_0030494 3300047673 Bacteria 2951
230 Ga0495602_0357313 3300048088 Bacteria 1053
231 Ga0495614_0154236 3300048089 Bacteria 1025
232 Ga0495626_0000434 3300048091 Bacteria 42623
233 Ga0496100_0111746 3300048903 Bacteria 1899
234 Ga0496100_0200755 3300048903 Bacteria 1453
235 Ga0496101_0006093 3300048904 Bacteria 7745
236 Ga0496101_0063133 3300048904 Bacteria 2695
237 Ga0496101_0065584 3300048904 Bacteria 2647
238 Ga0496101_0721956 3300048904 Bacteria 787
239 Ga0496102_0032549 3300048905 Bacteria 4684
240 Ga0496102_0063529 3300048905 Bacteria 3381
241 Ga0496102_0130231 3300048905 Bacteria 2354
242 Ga0496102_0142091 3300048905 Bacteria 2251
243 Ga0496103_0006577 3300048906 Bacteria 6933
244 Ga0496103_0279913 3300048906 Bacteria 1073
245 Ga0496104_0002251 3300048907 Bacteria 16644
246 Ga0496104_0217707 3300048907 Bacteria 1822
247 Ga0496104_0899927 3300048907 Bacteria 790
248 Ga0496104_1005942 3300048907 Bacteria 738
249 Ga0496105_0055928 3300048908 Bacteria 3257
250 Ga0496105_0504256 3300048908 Bacteria 950
251 Ga0496105_0731786 3300048908 Bacteria 757
252 Ga0496105_0753179 3300048908 Bacteria 744
253 Ga0496105_1207658 3300048908 Unclassified 556
254 Ga0496106_0007976 3300048909 Bacteria 7823
255 Ga0496106_0064317 3300048909 Bacteria 2790
256 Ga0496106_0175430 3300048909 Bacteria 1700
257 Ga0496106_0761579 3300048909 Bacteria 769
258 Ga0496107_0057422 3300048910 Bacteria 2813
259 Ga0496107_0138400 3300048910 Bacteria 1799
260 Ga0496108_0011417 3300048911 Bacteria 7221
261 Ga0496108_0257817 3300048911 Bacteria 1517
262 Ga0496108_0364653 3300048911 Unclassified 1261
263 Ga0496108_0949168 3300048911 Bacteria 736
264 Ga0496109_0019594 3300048912 Bacteria 5967
265 Ga0496109_0026144 3300048912 Bacteria 5204
266 Ga0496109_0031020 3300048912 Bacteria 4793
267 Ga0496109_0050537 3300048912 Bacteria 3786
268 Ga0496109_0531040 3300048912 Bacteria 1110
269 Ga0496109_0795610 3300048912 Bacteria 884
270 Ga0496110_0209160 3300048913 Bacteria 1773
271 Ga0496110_0231306 3300048913 Bacteria 1681
272 Ga0496112_0019257 3300048915 Bacteria 6438
273 Ga0496112_0057612 3300048915 Bacteria 3825
274 Ga0496112_0253637 3300048915 Bacteria 1710
275 Ga0496112_0359422 3300048915 Bacteria 1398
276 Ga0496112_1392006 3300048915 Unclassified 616
277 Ga0496113_0387501 3300048916 Bacteria 1122
278 Ga0496113_0698643 3300048916 Bacteria 809
279 Ga0496113_0899537 3300048916 Bacteria 700
280 Ga0496113_1131011 3300048916 Bacteria 613
281 Ga0496114_0005285 3300048917 Bacteria 10086
282 Ga0496114_0020679 3300048917 Bacteria 5342
283 Ga0496114_0135368 3300048917 Bacteria 2130
284 Ga0496114_0411013 3300048917 Bacteria 1198
285 Ga0496114_1122931 3300048917 Bacteria 671
286 Ga0496115_0012735 3300048918 Bacteria 6338
287 Ga0501038_0104192 3300049574 Bacteria 2358
288 Ga0501039_0633353 3300049575 Bacteria 837
289 Ga0501041_0220487 3300049577 Bacteria 1190
290 Ga0501042_0167597 3300049578 Bacteria 1585
291 Ga0501043_0207476 3300049579 Bacteria 1519
292 Ga0501067_0020972 3300049583 Bacteria 3615
293 Ga0501069_0361622 3300049585 Bacteria 856
294 Ga0501070_0071318 3300049586 Unclassified 2876
295 Ga0501071_0243154 3300049587 Bacteria 1357
296 Ga0501072_0285929 3300049588 Bacteria 1311
297 Ga0501072_0467386 3300049588 Bacteria 999
298 Ga0501073_0069227 3300049589 Bacteria 2459
299 Ga0501074_0165217 3300049590 Bacteria 1580
300 Ga0501075_0099366 3300049591 Bacteria 2210
301 Ga0501075_0175603 3300049591 Bacteria 1635
302 Ga0501075_1102056 3300049591 Bacteria 603
303 Ga0501077_0007575 3300049593 Bacteria 6699
304 Ga0501208_092648 3300049655 Bacteria 637
305 Ga0501079_0024087 3300049741 Unclassified 4670
306 Ga0501080_0027153 3300049742 Bacteria 5324
307 Ga0501080_0066914 3300049742 Bacteria 3342
308 Ga0501083_0174263 3300049744 Bacteria 1406
309 Ga0501045_0063800 3300049824 Unclassified 2704
310 nmdc:mga05p37_1049687_c1 3300050507 Bacteria 860
311 nmdc:mga05p37_248157_c1 3300050507 Bacteria 2136
312 nmdc:mga05p37_5776_c1 3300050507 Bacteria 14551
313 nmdc:mga09592_190285_c1 3300050508 Bacteria 1776
314 nmdc:mga09592_35421_c1 3300050508 Bacteria 4179
315 nmdc:mga0qj67_16573_c1 3300050509 Bacteria 5593
316 nmdc:mga0qj67_244923_c1 3300050509 Bacteria 1454
317 nmdc:mga0qj67_384589_c1 3300050509 Bacteria 1133
318 nmdc:mga0qj67_4966_c1 3300050509 Bacteria 9666
319 nmdc:mga06r32_11177_c1 3300050510 Bacteria 8087
320 nmdc:mga06r32_48851_c1 3300050510 Bacteria 4046
321 Ga0495619_0058350 3300053085 Bacteria 2562
322 Ga0500643_051975 3300053087 Bacteria 1169
323 Ga0500583_0201836 3300053092 Bacteria 988
324 Ga0500651_0041675 3300053093 Bacteria 2894
325 Ga0500641_0060891 3300053096 Bacteria 1571
326 Ga0501084_0016236 3300054114 Bacteria 6182
327 Ga0466962_0065495 3300061719 Bacteria 1735
328 nmdc:mga06r32_338149_c1
329 Ga0070683_100764057
330 Ga0070680_100712950
331 Ga0070682_100020438
332 Ga0070682_100258388
333 Ga0068868_100186176
334 Ga0070660_100226982
335 Ga0070691_10276097
336 Ga0070687_100080494
337 Ga0070661_100521762
338 Ga0070668_100000781
339 Ga0070669_100212401
340 Ga0070675_100147986
341 Ga0070667_100830404
342 Ga0070709_10794735
343 Ga0070714_100059932
344 Ga0070713_100413615
345 Ga0070713_100972999
346 Ga0070681_11102388
347 Ga0070685_10347642
348 Ga0070706_100018449
349 Ga0070698_100194303
350 Ga0070684_100001453
351 Ga0070684_100404589
352 Ga0068853_100474262
353 Ga0070665_100096157
354 Ga0070665_100239572
355 Ga0070665_100313425
356 Ga0068855_100063650
357 Ga0068857_100010452
358 Ga0068856_100041335
359 Ga0070702_100977248
360 Ga0068852_100607760
361 Ga0068864_100050091
362 Ga0068864_101077724
363 Ga0068861_100113045
364 Ga0068863_100026115
365 Ga0068858_100033463
366 Ga0070717_10319856
367 Ga0075365_10163241
368 Ga0070712_101214868
369 Ga0068871_100193274
370 Ga0075428_100038415
371 Ga0075430_100030580
372 Ga0075430_100401151
373 Ga0075431_100032592
374 Ga0075431_100051675
375 Ga0075431_100261269
376 Ga0075429_100005848
377 Ga0075429_100625563
378 Ga0068865_100026604
379 Ga0105245_10739723
380 Ga0114129_10011055
381 Ga0114129_10028864
382 Ga0114129_10223565
383 Ga0114129_10361498
384 Ga0105242_10219428
385 Ga0105242_10247148
386 Ga0105248_10323705
387 Ga0105248_10423098
388 Ga0105248_10880547
389 Ga0105237_10352969
390 Ga0105237_10907761
391 Ga0105238_10805137
392 Ga0105238_11264608
393 Ga0105238_11294832
394 Ga0105249_10027261
395 Ga0105249_10734878
396 Ga0105239_10002517
397 Ga0105239_10952276
398 Ga0105246_10003135
399 Ga0157371_10047688
400 Ga0157370_10296102
401 Ga0157369_10124929
402 Ga0157369_10524483
403 Ga0157374_11486973
404 Ga0157374_11544572
405 Ga0163162_10350865
406 Ga0163162_10518735
407 Ga0163162_11386338
408 Ga0163162_11556777
409 Ga0157372_10020972
410 Ga0157372_10622015
411 Ga0157372_12008193
412 Ga0157375_10071350
413 Ga0163163_10057398
414 Ga0163163_10097126
415 Ga0163163_10914515
416 Ga0157377_10058769
417 Ga0157379_10041216
418 Ga0157376_10755397
419 Ga0157376_11720299
420 Ga0213875_10002613
421 Ga0224712_10149424
422 Ga0207642_10503135
423 Ga0207688_10065298
424 Ga0207705_10223275
425 Ga0207684_10020576
426 Ga0207707_10213298
427 Ga0207671_10357492
428 Ga0207660_10606811
429 Ga0207662_10031924
430 Ga0207657_10172796
431 Ga0207681_10372588
432 Ga0207694_11685576
433 Ga0207664_10346121
434 Ga0207709_10308352
435 Ga0207704_10559159
436 Ga0207711_10285548
437 Ga0207661_10047357
438 Ga0207661_10211505
439 Ga0207679_11602618
440 Ga0207712_10090209
441 Ga0207712_10378702
442 Ga0207668_10002270
443 Ga0207668_10573839
444 Ga0207658_10727285
445 Ga0207677_10047961
446 Ga0207703_10126955
447 Ga0207639_10323270
448 Ga0207702_10685706
449 Ga0207702_10812323
450 Ga0207641_10019575
451 Ga0207676_10134009
452 Ga0207676_10276797
453 Ga0207674_10005161
454 Ga0207675_100187862
455 Ga0207683_10072047
456 Ga0207698_12065553
457 Ga0207698_12234549
458 Ga0268266_10226616
459 Ga0268266_10546955
460 Ga0268264_10038437
461 Ga0307515_10079627
462 Ga0307513_10117427
463 Ga0307513_10228557
464 Ga0307508_10000627
465 Ga0307508_10013698
466 Ga0307516_10022998
467 Ga0307516_10034173
468 Ga0307405_10801064
469 Ga0307410_11367461
470 Ga0307406_10237498
471 Ga0307406_11460555
472 Ga0307407_10158107
473 Ga0307407_10225849
474 Ga0307416_100242436
475 Ga0307416_101909103
476 Ga0307507_10112189
477 Ga0373938_0129040
478 Ga0373926_0002469
479 Ga0373934_0243784
480 Ga0373944_0152103
481 Ga0373932_0094689
482 Ga0373941_0026194
483 Ga0373945_0045747
484 Ga0373943_0562923
485 Ga0373946_0256181
486 Ga0373942_0000084
487 Ga0373935_0001212
488 Ga0373935_0323724
489 Ga0373947_0000027
490 Ga0373947_0067811
491 Ga0373925_0587014
492 Ga0395899_0215730
493 Ga0395900_0314786
494 Ga0395898_0152000
495 Ga0395905_0276352
496 Ga0436364_1422884
497 Ga0395901_0021388
498 Ga0395901_0191528
499 Ga0436362_0858723
500 Ga0451843_1160304
501 Ga0451843_1193484
502 Ga0466972_0033752
503 Ga0466961_0043587
504 Ga0466961_0219690
505 Ga0466961_0276204
506 Ga0466963_1265651
507 Ga0466964_0064725
508 Ga0466964_0138922
509 Ga0466971_0199164
510 Ga0466971_0663684
511 Ga0466968_0415006
512 Ga0466970_0001961
513 Ga0466970_0020106
514 Ga0466970_0079239
515 Ga0466970_0091442
516 Ga0466960_0050439
517 Ga0466959_0075972
518 Ga0466967_0060611
519 Ga0466967_0184354
520 Ga0466967_0233668
521 Ga0466967_0253290
522 Ga0466967_0314134
523 Ga0466967_0398323
524 Ga0466967_0590529
525 Ga0466967_1178411
526 Ga0495592_0590210
527 Ga0495603_0072279
528 Ga0495629_0892810
529 Ga0495638_0084674
530 Ga0495651_0617713
531 Ga0495639_0183349
532 Ga0495662_0096868
533 Ga0495662_0322248
534 Ga0495618_0093258
535 Ga0495628_1030143
536 Ga0495630_0320578
537 Ga0495630_0746491
538 Ga0495666_0122485
539 Ga0495640_0039730
540 Ga0495645_0045481
541 Ga0495645_0263165
542 Ga0495668_0000269
543 Ga0495634_0673081
544 Ga0495625_0001474
545 Ga0495635_0148049
546 Ga0495599_0440167
547 Ga0495647_0045644
548 Ga0495658_0044291
549 Ga0495613_0033695
550 Ga0495624_0132632
551 Ga0495624_0227038
552 Ga0495600_0063203
553 Ga0495581_0292332
554 Ga0495683_0038116
555 Ga0495684_0314340
556 Ga0495593_0030494
557 Ga0495602_0357313
558 Ga0495614_0154236
559 Ga0495626_0000434
560 Ga0496100_0111746
561 Ga0496100_0200755
562 Ga0496101_0006093
563 Ga0496101_0063133
564 Ga0496101_0065584
565 Ga0496101_0721956
566 Ga0496102_0032549
567 Ga0496102_0063529
568 Ga0496102_0130231
569 Ga0496102_0142091
570 Ga0496103_0006577
571 Ga0496103_0279913
572 Ga0496104_0002251
573 Ga0496104_0217707
574 Ga0496104_0899927
575 Ga0496104_1005942
576 Ga0496105_0055928
577 Ga0496105_0504256
578 Ga0496105_0731786
579 Ga0496105_0753179
580 Ga0496105_1207658
581 Ga0496106_0007976
582 Ga0496106_0064317
583 Ga0496106_0175430
584 Ga0496106_0761579
585 Ga0496107_0057422
586 Ga0496107_0138400
587 Ga0496108_0011417
588 Ga0496108_0257817
589 Ga0496108_0364653
590 Ga0496108_0949168
591 Ga0496109_0019594
592 Ga0496109_0026144
593 Ga0496109_0031020
594 Ga0496109_0050537
595 Ga0496109_0531040
596 Ga0496109_0795610
597 Ga0496110_0209160
598 Ga0496110_0231306
599 Ga0496112_0019257
600 Ga0496112_0057612
601 Ga0496112_0253637
602 Ga0496112_0359422
603 Ga0496112_1392006
604 Ga0496113_0387501
605 Ga0496113_0698643
606 Ga0496113_0899537
607 Ga0496113_1131011
608 Ga0496114_0005285
609 Ga0496114_0020679
610 Ga0496114_0135368
611 Ga0496114_0411013
612 Ga0496114_1122931
613 Ga0496115_0012735
614 Ga0501038_0104192
615 Ga0501039_0633353
616 Ga0501041_0220487
617 Ga0501042_0167597
618 Ga0501043_0207476
619 Ga0501067_0020972
620 Ga0501069_0361622
621 Ga0501070_0071318
622 Ga0501071_0243154
623 Ga0501072_0285929
624 Ga0501072_0467386
625 Ga0501073_0069227
626 Ga0501074_0165217
627 Ga0501075_0099366
628 Ga0501075_0175603
629 Ga0501075_1102056
630 Ga0501077_0007575
631 Ga0501208_092648
632 Ga0501079_0024087
633 Ga0501080_0027153
634 Ga0501080_0066914
635 Ga0501083_0174263
636 Ga0501045_0063800
637 nmdc:mga05p37_1049687_c1
638 nmdc:mga05p37_248157_c1
639 nmdc:mga05p37_5776_c1
640 nmdc:mga09592_190285_c1
641 nmdc:mga09592_35421_c1
642 nmdc:mga0qj67_16573_c1
643 nmdc:mga0qj67_244923_c1
644 nmdc:mga0qj67_384589_c1
645 nmdc:mga0qj67_4966_c1
646 nmdc:mga06r32_11177_c1
647 nmdc:mga06r32_48851_c1
648 Ga0495619_0058350
649 Ga0500643_051975
650 Ga0500583_0201836
651 Ga0500651_0041675
652 Ga0500641_0060891
653 Ga0501084_0016236
654 Ga0466962_0065495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

50

155

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vb0-assembly6.cif.gz_H crystal structure of fosfomycin resistance protein fosa3 0.6745 8 41
5vb0-assembly2.cif.gz_C crystal structure of fosfomycin resistance protein fosa3 0.6598 8 41
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.6562 10 42
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.655 10 42
5vb0-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosa3 0.6517 8 41
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8234 11 131 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8048 11 131 3.30.70.1230
af_Q6A070_1241_1469_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7954 110 134 1.25.10.10
af_I1KEB1_1_116_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.7842 22 47 2.90.10.10
af_Q9Y4F4_1232_1385_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7516 110 140 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7V072-F1-model_v4 YjbR protein 0.9773 5 138
AF-A0A7W7MVX9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9769 66 140
AF-A0A7K3M9Q7-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9737 3 140
AF-A0A542ZEP5-F1-model_v4 Uncharacterized protein 0.9714 6 108
AF-A0A495QYV3-F1-model_v4 YjbR protein 0.971 5 140

Map