F408960

General Info

Members Datasets Scaffolds Average Seq Length
327 231 654 259

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000031|Ga0496121_0000031_128360_129256
Length 298
Sequence LGGAAAVAFIGGTFLVDPALPLRPVIMARIPVWVIHFRDRDMVAMWNDPSRYEDVPRPIVGVGNDYPPSFELDWHQHRRGQLLYAARGVVVVSTPHGVWVAPPERAVWTPGGCPHAVRMVGAVSTRSVLIMPTAHGGLGDGNKVIQISPLLRHLLEEACHIPPEYDEQGRDGKVMDLLLAELGAAPTVPLAVPFPQHGALAKACHAFLENPTPHETIDQWCDDLGMGRRAFTRLFRRETGLSFGAWRQQACILAALPRLARGDAVTAIAFDLGYDSASAFTTMFKRRVGVAPSHYRPG

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
208 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
209 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
214 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
215 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
219 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
220 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
221 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
222 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
223 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
224 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
225 2919085039 Luteibacter sp. 1214 Isolate Unclassified
226 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
227 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
228 2941471342 Luteibacter sp. 621 Isolate Unclassified
229 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
230 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
231 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.93
Nodule 1.83
Rhizoplane 1.22
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0000031 3300048924 Bacteria 384119
2 JGI24736J21556_1000543 3300001904 Bacteria 6994
3 JGI24737J22298_10006389 3300001990 Bacteria 4027
4 JGI24735J21928_10001226 3300002067 Bacteria 9111
5 JGI25151J46595_10000581 3300003187 Bacteria 32575
6 rootH1_10113867 3300003316 Bacteria 2258
7 rootH2_10225532 3300003320 Bacteria 1348
8 rootL2_10157376 3300003322 Bacteria 4647
9 rootH1_10279253 3300003323 Bacteria 2004
10 JGI25160J50197_1006121 3300003354 Bacteria 4908
11 Ga0070658_10253565 3300005327 Bacteria 1493
12 Ga0070676_10136602 3300005328 Unclassified 1556
13 Ga0070670_100098215 3300005331 Bacteria 2520
14 Ga0068869_100124898 3300005334 Bacteria 1972
15 Ga0068869_100397176 3300005334 Bacteria 1133
16 Ga0070666_10065566 3300005335 Bacteria 2464
17 Ga0068868_100383317 3300005338 Unclassified 1210
18 Ga0070660_100157637 3300005339 Bacteria 1828
19 Ga0070668_100005484 3300005347 Bacteria 9414
20 Ga0070668_100008165 3300005347 Bacteria 7774
21 Ga0070668_100020758 3300005347 Bacteria 4961
22 Ga0070669_100005300 3300005353 Bacteria 9310
23 Ga0070669_100028661 3300005353 Bacteria 4010
24 Ga0070675_100068495 3300005354 Bacteria 2939
25 Ga0070671_100008146 3300005355 Bacteria 8387
26 Ga0070688_100143971 3300005365 Bacteria 1622
27 Ga0070667_100029887 3300005367 Bacteria 4543
28 Ga0070667_100035024 3300005367 Bacteria 4204
29 Ga0070667_100057445 3300005367 Bacteria 3289
30 Ga0070667_100334089 3300005367 Bacteria 1370
31 Ga0070667_100477137 3300005367 Bacteria 1141
32 Ga0070678_100204789 3300005456 Bacteria 1631
33 Ga0068867_100137397 3300005459 Bacteria 1907
34 Ga0068853_100194433 3300005539 Bacteria 1844
35 Ga0068853_100479754 3300005539 Bacteria 1172
36 Ga0068853_100506222 3300005539 Bacteria 1140
37 Ga0070672_100312951 3300005543 Bacteria 1333
38 Ga0070672_100501957 3300005543 Bacteria 1049
39 Ga0070686_100084441 3300005544 Bacteria 2110
40 Ga0070665_100000370 3300005548 Bacteria 66870
41 Ga0070665_100007865 3300005548 Bacteria 10815
42 Ga0070665_100352024 3300005548 Bacteria 1478
43 Ga0068855_100163370 3300005563 Bacteria 2526
44 Ga0068855_100365553 3300005563 Bacteria 1587
45 Ga0068857_100168794 3300005577 Bacteria 1988
46 Ga0068854_100037981 3300005578 Bacteria 3384
47 Ga0068856_100030092 3300005614 Bacteria 5307
48 Ga0068856_100662679 3300005614 Bacteria 1064
49 Ga0068856_100707738 3300005614 Bacteria 1027
50 Ga0068852_100001648 3300005616 Bacteria 15244
51 Ga0068859_100217297 3300005617 Bacteria 1999
52 Ga0068864_100102616 3300005618 Bacteria 2538
53 Ga0068870_10018403 3300005840 Bacteria 3373
54 Ga0068863_100023810 3300005841 Bacteria 5844
55 Ga0068863_100245314 3300005841 Bacteria 1729
56 Ga0068860_100008650 3300005843 Bacteria 10142
57 Ga0068860_100009474 3300005843 Bacteria 9671
58 Ga0068862_100020132 3300005844 Bacteria 5573
59 Ga0068862_100050848 3300005844 Bacteria 3543
60 Ga0081455_10032540 3300005937 Bacteria 4698
61 Ga0070717_10103191 3300006028 Bacteria 2424
62 Ga0075365_10170441 3300006038 Bacteria 1519
63 Ga0075362_10000080 3300006177 Bacteria 26451
64 Ga0075369_10000237 3300006186 Bacteria 16397
65 Ga0075369_10014748 3300006186 Bacteria 3127
66 Ga0068871_100179979 3300006358 Bacteria 1816
67 Ga0075434_100181104 3300006871 Bacteria 2127
68 Ga0097620_100217282 3300006931 Bacteria 1999
69 Ga0079104_1012271 3300006946 Bacteria 2706
70 Ga0079104_1024993 3300006946 Bacteria 1566
71 Ga0099826_10138927 3300006948 Unclassified 1406
72 Ga0105251_10002762 3300009011 Bacteria 13404
73 Ga0105244_10004167 3300009036 Bacteria 10061
74 Ga0105244_10006907 3300009036 Bacteria 7279
75 Ga0105240_10000352 3300009093 Bacteria 86113
76 Ga0105240_10138839 3300009093 Bacteria 2908
77 Ga0105247_10028474 3300009101 Bacteria 3381
78 Ga0114129_10476970 3300009147 Bacteria 1633
79 Ga0105248_10015251 3300009177 Bacteria 8469
80 Ga0105237_10000580 3300009545 Bacteria 51217
81 Ga0105238_10122107 3300009551 Bacteria 2584
82 Ga0105249_10253514 3300009553 Bacteria 1745
83 Ga0105239_10000207 3300010375 Bacteria 86761
84 Ga0105239_10030044 3300010375 Bacteria 5976
85 Ga0105239_10440124 3300010375 Bacteria 1478
86 Ga0157370_10000224 3300013104 Bacteria 71976
87 Ga0157370_10015681 3300013104 Bacteria 7696
88 Ga0157369_10001302 3300013105 Bacteria 31025
89 Ga0157369_10001932 3300013105 Bacteria 24976
90 Ga0157374_10171882 3300013296 Bacteria 2114
91 Ga0157372_10030965 3300013307 Bacteria 5856
92 Ga0157372_10064326 3300013307 Bacteria 4116
93 Ga0157372_10098086 3300013307 Bacteria 3343
94 Ga0157375_10283090 3300013308 Bacteria 1821
95 Ga0163163_10235019 3300014325 Bacteria 1882
96 Ga0157376_10286012 3300014969 Bacteria 1555
97 Ga0157376_10609059 3300014969 Bacteria 1088
98 Ga0182005_1000015 3300015265 Bacteria 387565
99 Ga0213876_10059697 3300021384 Bacteria 2013
100 Ga0213875_10137432 3300021388 Bacteria 1143
101 Ga0209148_1001445 3300025254 Bacteria 12072
102 Ga0209455_1000554 3300025272 Bacteria 25250
103 Ga0209130_1000502 3300025284 Bacteria 39793
104 Ga0209025_1000077 3300025294 Bacteria 271958
105 Ga0209758_1002905 3300025297 Bacteria 16536
106 Ga0207426_1000576 3300025302 Bacteria 49162
107 Ga0209051_1004061 3300025303 Bacteria 9226
108 Ga0207710_10083624 3300025900 Bacteria 1484
109 Ga0207680_10357553 3300025903 Bacteria 1026
110 Ga0207647_10000005 3300025904 Bacteria 223490
111 Ga0207645_10213100 3300025907 Unclassified 1273
112 Ga0207643_10043434 3300025908 Bacteria 2536
113 Ga0207705_10000985 3300025909 Bacteria 23241
114 Ga0207705_10057958 3300025909 Bacteria 2795
115 Ga0207705_10161420 3300025909 Bacteria 1684
116 Ga0207695_10000434 3300025913 Bacteria 91902
117 Ga0207695_10070444 3300025913 Bacteria 3574
118 Ga0207671_10001606 3300025914 Bacteria 25701
119 Ga0207671_10002586 3300025914 Bacteria 19124
120 Ga0207657_10020164 3300025919 Bacteria 6307
121 Ga0207657_10210900 3300025919 Bacteria 1559
122 Ga0207681_10002183 3300025923 Bacteria 12476
123 Ga0207681_10172806 3300025923 Bacteria 1639
124 Ga0207694_10021024 3300025924 Bacteria 4940
125 Ga0207650_10249510 3300025925 Bacteria 1436
126 Ga0207650_10305583 3300025925 Unclassified 1300
127 Ga0207659_10407643 3300025926 Bacteria 1138
128 Ga0207659_10470057 3300025926 Bacteria 1061
129 Ga0207644_10001621 3300025931 Bacteria 14498
130 Ga0207644_10232533 3300025931 Bacteria 1465
131 Ga0207669_10208648 3300025937 Bacteria 1424
132 Ga0207691_10004484 3300025940 Bacteria 13524
133 Ga0207691_10285060 3300025940 Bacteria 1421
134 Ga0207711_10012402 3300025941 Bacteria 7085
135 Ga0207689_10002626 3300025942 Bacteria 16644
136 Ga0207667_10313438 3300025949 Bacteria 1602
137 Ga0207651_10473548 3300025960 Bacteria 1078
138 Ga0207712_10059064 3300025961 Bacteria 2713
139 Ga0207668_10002999 3300025972 Bacteria 9892
140 Ga0207668_10092363 3300025972 Bacteria 2227
141 Ga0207668_10205738 3300025972 Bacteria 1570
142 Ga0207640_10028999 3300025981 Bacteria 3391
143 Ga0207658_10071125 3300025986 Bacteria 2634
144 Ga0207658_10073038 3300025986 Bacteria 2603
145 Ga0207658_10436510 3300025986 Bacteria 1157
146 Ga0207658_10673598 3300025986 Bacteria 933
147 Ga0207703_10072925 3300026035 Bacteria 2839
148 Ga0207639_10373129 3300026041 Bacteria 1279
149 Ga0207639_10424739 3300026041 Bacteria 1202
150 Ga0207678_10015210 3300026067 Bacteria 6769
151 Ga0207678_10614795 3300026067 Bacteria 953
152 Ga0207702_10389320 3300026078 Bacteria 1342
153 Ga0207702_10648184 3300026078 Bacteria 1039
154 Ga0207641_10014158 3300026088 Bacteria 6537
155 Ga0207648_10008207 3300026089 Bacteria 10144
156 Ga0207648_10093620 3300026089 Bacteria 2627
157 Ga0207674_10030327 3300026116 Bacteria 5686
158 Ga0207683_10003373 3300026121 Bacteria 13926
159 Ga0207698_10020100 3300026142 Bacteria 4589
160 Ga0209281_1007820 3300027111 Bacteria 2648
161 Ga0268266_10000620 3300028379 Bacteria 48325
162 Ga0268266_10076557 3300028379 Bacteria 2908
163 Ga0268266_10614621 3300028379 Bacteria 1044
164 Ga0268265_10041917 3300028380 Bacteria 3392
165 Ga0268265_10068750 3300028380 Bacteria 2748
166 Ga0268264_10001864 3300028381 Bacteria 19166
167 Ga0268264_10011978 3300028381 Bacteria 7142
168 Ga0265327_10001427 3300031251 Bacteria 30362
169 Ga0307406_10114467 3300031901 Bacteria 1863
170 Ga0307411_10581442 3300032005 Bacteria 960
171 Ga0307510_10110123 3300033180 Bacteria 2500
172 Ga0373940_0014806 3300035088 Bacteria 1908
173 Ga0373946_0136561 3300035171 Bacteria 1133
174 Ga0373942_0022486 3300035207 Bacteria 1600
175 Ga0373947_0386833 3300035725 Bacteria 942
176 Ga0395905_0168130 3300037471 Bacteria 2060
177 Ga0436364_0802648 3300037853 Bacteria 1531
178 Ga0395901_0192979 3300038443 Bacteria 2136
179 Ga0436365_0498046 3300039437 Bacteria 6410
180 Ga0436365_0649409 3300039437 Bacteria 1755
181 Ga0436365_1439967 3300039437 Unclassified 1288
182 Ga0451577_0205402 3300042876 Bacteria 1778
183 Ga0466972_0003015 3300044658 Bacteria 8348
184 Ga0466972_0004698 3300044658 Bacteria 6841
185 Ga0453683_0027316 3300044673 Unclassified 3622
186 Ga0466965_0190914 3300044683 Bacteria 1083
187 Ga0466966_0021135 3300044684 Bacteria 4274
188 Ga0466961_0013508 3300044693 Bacteria 5229
189 Ga0466961_0064850 3300044693 Bacteria 2321
190 Ga0466963_0002648 3300044694 Bacteria 10065
191 Ga0466964_0072152 3300044706 Bacteria 1462
192 Ga0453684_0535796 3300044712 Bacteria 1291
193 Ga0466971_0002759 3300044719 Bacteria 7420
194 Ga0466971_0101548 3300044719 Bacteria 1322
195 Ga0466968_0013770 3300044735 Bacteria 3183
196 Ga0466968_0048780 3300044735 Bacteria 1802
197 Ga0466957_0039821 3300044842 Bacteria 2837
198 Ga0466960_0001005 3300044901 Bacteria 10075
199 Ga0466959_0002064 3300045049 Bacteria 12709
200 Ga0466959_0192036 3300045049 Bacteria 1425
201 Ga0466959_0222218 3300045049 Bacteria 1309
202 Ga0466958_0001950 3300045836 Bacteria 10124
203 Ga0466958_0041478 3300045836 Bacteria 2768
204 Ga0466967_0013750 3300045976 Bacteria 6271
205 Ga0495617_055120 3300046452 Bacteria 1319
206 Ga0495627_001304 3300046453 Bacteria 15211
207 Ga0495603_0007260 3300046455 Bacteria 6656
208 Ga0495591_000012 3300046458 Bacteria 274403
209 Ga0495638_0071801 3300046460 Bacteria 2117
210 Ga0495650_0002398 3300046471 Bacteria 15306
211 Ga0495594_0121351 3300046499 Bacteria 1477
212 Ga0495607_0004431 3300046501 Bacteria 10327
213 Ga0495606_0018719 3300046507 Bacteria 5182
214 Ga0495610_0060355 3300046512 Bacteria 1805
215 Ga0495616_0193947 3300046513 Bacteria 896
216 Ga0495620_0021160 3300046515 Bacteria 3163
217 Ga0495637_0024359 3300046520 Bacteria 2739
218 Ga0495643_0031941 3300046522 Bacteria 2926
219 Ga0495643_0115727 3300046522 Bacteria 1359
220 Ga0495654_0074759 3300046530 Bacteria 1600
221 Ga0495609_0092910 3300046538 Bacteria 1311
222 Ga0495597_0016977 3300046542 Bacteria 3431
223 Ga0495622_0002845 3300046557 Bacteria 8256
224 Ga0495668_0049899 3300046616 Bacteria 2321
225 Ga0495668_0052118 3300046616 Bacteria 2265
226 Ga0495625_0028331 3300046660 Bacteria 4202
227 Ga0495625_0150752 3300046660 Bacteria 1563
228 Ga0495658_0285173 3300046683 Bacteria 1043
229 Ga0495670_0072724 3300046691 Bacteria 1742
230 Ga0495649_0037499 3300046694 Bacteria 2661
231 Ga0495674_0034787 3300047319 Plasmid 4552
232 Ga0495672_0031336 3300047320 Bacteria 3321
233 Ga0495687_079655 3300047443 Bacteria 1287
234 Ga0495681_0001901 3300047470 Bacteria 15333
235 Ga0495686_0000090 3300047472 Bacteria 193179
236 Ga0495686_0000161 3300047472 Bacteria 126951
237 Ga0495686_0006543 3300047472 Bacteria 8892
238 Ga0495686_0162787 3300047472 Bacteria 1302
239 Ga0496104_0118575 3300048907 Plasmid 2541
240 Ga0496106_0231479 3300048909 Bacteria 1475
241 Ga0496109_0075834 3300048912 Bacteria 3092
242 Ga0496115_0285663 3300048918 Bacteria 1354
243 Ga0496116_0007360 3300048919 Bacteria 9782
244 Ga0496117_0010121 3300048920 Bacteria 8659
245 Ga0496117_0021697 3300048920 Bacteria 5183
246 Ga0496117_0041719 3300048920 Bacteria 3358
247 Ga0496118_0001107 3300048921 Bacteria 41821
248 Ga0496118_0001576 3300048921 Bacteria 33815
249 Ga0496118_0003667 3300048921 Bacteria 19069
250 Ga0496118_0005531 3300048921 Bacteria 14338
251 Ga0496118_0070032 3300048921 Bacteria 2535
252 Ga0496119_0029802 3300048922 Bacteria 3691
253 Ga0496119_0122738 3300048922 Bacteria 1426
254 Ga0496121_0000464 3300048924 Bacteria 79337
255 Ga0496121_0000496 3300048924 Bacteria 75156
256 Ga0496121_0001839 3300048924 Bacteria 34202
257 Ga0496121_0035174 3300048924 Bacteria 4494
258 Ga0496121_0137517 3300048924 Bacteria 1818
259 Ga0496121_0239932 3300048924 Bacteria 1264
260 Ga0496122_0028328 3300048925 Bacteria 4757
261 Ga0496122_0124938 3300048925 Bacteria 1649
262 Ga0496123_0013342 3300048926 Bacteria 6909
263 Ga0496123_0041905 3300048926 Bacteria 3168
264 Ga0496123_0046127 3300048926 Bacteria 2959
265 Ga0496124_0017314 3300048927 Bacteria 6794
266 Ga0496124_0042287 3300048927 Bacteria 3925
267 Ga0496124_0080820 3300048927 Bacteria 2674
268 Ga0496125_0004172 3300048928 Bacteria 16849
269 Ga0496125_0035727 3300048928 Bacteria 4353
270 Ga0496126_0000063 3300048929 Bacteria 256841
271 Ga0496126_0005027 3300048929 Bacteria 15387
272 Ga0496126_0007366 3300048929 Bacteria 12074
273 Ga0496126_0029927 3300048929 Bacteria 5167
274 Ga0496126_0066274 3300048929 Bacteria 3229
275 Ga0496126_0578151 3300048929 Bacteria 888
276 Ga0501033_0053878 3300049570 Bacteria 2978
277 Ga0501043_0040503 3300049579 Bacteria 3662
278 Ga0501047_0105127 3300049581 Bacteria 2704
279 Ga0501249_000507 3300049679 Bacteria 9478
280 Ga0501044_0038149 3300049823 Bacteria 5018
281 nmdc:mga03n38_5795_c1 3300050490 Bacteria 4241
282 nmdc:mga0yw44_216154_c1 3300050492 Bacteria 1269
283 nmdc:mga05p37_510992_c1 3300050507 Bacteria 1376
284 nmdc:mga0qj67_423528_c1 3300050509 Bacteria 1073
285 nmdc:mga06r32_25937_c1 3300050510 Bacteria 5458
286 nmdc:mga0sz30_544_c1 3300050516 Bacteria 14087
287 Ga0495601_0027329 3300053077 Bacteria 3527
288 Ga0500635_0031680 3300053080 Bacteria 1713
289 Ga0495619_0025949 3300053085 Bacteria 3767
290 Ga0500643_005065 3300053087 Bacteria 5765
291 Ga0500643_019177 3300053087 Bacteria 2257
292 Ga0500643_032112 3300053087 Bacteria 1596
293 Ga0500646_0043846 3300053090 Bacteria 1268
294 Ga0500651_0000538 3300053093 Bacteria 19288
295 Ga0500595_002891 3300053119 Bacteria 8233
296 Ga0500608_000890 3300053122 Bacteria 10771
297 Ga0500614_001488 3300053123 Bacteria 5584
298 Ga0500618_012298 3300053125 Bacteria 2243
299 Ga0500642_0001931 3300053130 Bacteria 6007
300 Ga0500652_021861 3300053131 Bacteria 2415
301 Ga0500655_000905 3300053133 Bacteria 5757
302 Ga0500564_002170 3300053138 Bacteria 7144
303 Ga0500590_002901 3300053148 Bacteria 7774
304 Ga0500590_003534 3300053148 Bacteria 7228
305 Ga0500622_0006976 3300053156 Bacteria 6468
306 Ga0500624_000121 3300053157 Bacteria 35470
307 Ga0500636_0005216 3300053177 Bacteria 7391
308 Ga0500636_0116334 3300053177 Bacteria 1505
309 Ga0500567_008380 3300053723 Bacteria 4888
310 Ga0500570_000470 3300053724 Bacteria 15608
311 Ga0500625_000034 3300053729 Bacteria 48891
312 Ga0501082_0074370 3300060353 Bacteria 2927
313 Ga0466962_0004566 3300061719 Bacteria 6645
314 2511435358 2511231035 Bacteria 5341610
315 2585259780 2582581305 Bacteria 4895574
316 2643834151 2643221563 Bacteria 4726935
317 2644055077 2643221608 Bacteria 4724829
318 2821449639 2821443989 Bacteria 7658172
319 2844538756 2844533157 Bacteria 7517899
320 2894819267 2894817345 Bacteria 4892941
321 2919088111 2919085039 Bacteria 4532964
322 2919142338 2919138771 Bacteria 5281312
323 2919455328 2919450847 Bacteria 5631160
324 2941475276 2941471342 Bacteria 5018624
325 2958128571 2958122699 Bacteria 7280457
326 2977873056 2977872689 Bacteria 7270173
327 8001849376 8001845381 Bacteria 5804942
328 Ga0496121_0000031
329 JGI24736J21556_1000543
330 JGI24737J22298_10006389
331 JGI24735J21928_10001226
332 JGI25151J46595_10000581
333 rootH1_10113867
334 rootH2_10225532
335 rootL2_10157376
336 rootH1_10279253
337 JGI25160J50197_1006121
338 Ga0070658_10253565
339 Ga0070676_10136602
340 Ga0070670_100098215
341 Ga0068869_100124898
342 Ga0068869_100397176
343 Ga0070666_10065566
344 Ga0068868_100383317
345 Ga0070660_100157637
346 Ga0070668_100005484
347 Ga0070668_100008165
348 Ga0070668_100020758
349 Ga0070669_100005300
350 Ga0070669_100028661
351 Ga0070675_100068495
352 Ga0070671_100008146
353 Ga0070688_100143971
354 Ga0070667_100029887
355 Ga0070667_100035024
356 Ga0070667_100057445
357 Ga0070667_100334089
358 Ga0070667_100477137
359 Ga0070678_100204789
360 Ga0068867_100137397
361 Ga0068853_100194433
362 Ga0068853_100479754
363 Ga0068853_100506222
364 Ga0070672_100312951
365 Ga0070672_100501957
366 Ga0070686_100084441
367 Ga0070665_100000370
368 Ga0070665_100007865
369 Ga0070665_100352024
370 Ga0068855_100163370
371 Ga0068855_100365553
372 Ga0068857_100168794
373 Ga0068854_100037981
374 Ga0068856_100030092
375 Ga0068856_100662679
376 Ga0068856_100707738
377 Ga0068852_100001648
378 Ga0068859_100217297
379 Ga0068864_100102616
380 Ga0068870_10018403
381 Ga0068863_100023810
382 Ga0068863_100245314
383 Ga0068860_100008650
384 Ga0068860_100009474
385 Ga0068862_100020132
386 Ga0068862_100050848
387 Ga0081455_10032540
388 Ga0070717_10103191
389 Ga0075365_10170441
390 Ga0075362_10000080
391 Ga0075369_10000237
392 Ga0075369_10014748
393 Ga0068871_100179979
394 Ga0075434_100181104
395 Ga0097620_100217282
396 Ga0079104_1012271
397 Ga0079104_1024993
398 Ga0099826_10138927
399 Ga0105251_10002762
400 Ga0105244_10004167
401 Ga0105244_10006907
402 Ga0105240_10000352
403 Ga0105240_10138839
404 Ga0105247_10028474
405 Ga0114129_10476970
406 Ga0105248_10015251
407 Ga0105237_10000580
408 Ga0105238_10122107
409 Ga0105249_10253514
410 Ga0105239_10000207
411 Ga0105239_10030044
412 Ga0105239_10440124
413 Ga0157370_10000224
414 Ga0157370_10015681
415 Ga0157369_10001302
416 Ga0157369_10001932
417 Ga0157374_10171882
418 Ga0157372_10030965
419 Ga0157372_10064326
420 Ga0157372_10098086
421 Ga0157375_10283090
422 Ga0163163_10235019
423 Ga0157376_10286012
424 Ga0157376_10609059
425 Ga0182005_1000015
426 Ga0213876_10059697
427 Ga0213875_10137432
428 Ga0209148_1001445
429 Ga0209455_1000554
430 Ga0209130_1000502
431 Ga0209025_1000077
432 Ga0209758_1002905
433 Ga0207426_1000576
434 Ga0209051_1004061
435 Ga0207710_10083624
436 Ga0207680_10357553
437 Ga0207647_10000005
438 Ga0207645_10213100
439 Ga0207643_10043434
440 Ga0207705_10000985
441 Ga0207705_10057958
442 Ga0207705_10161420
443 Ga0207695_10000434
444 Ga0207695_10070444
445 Ga0207671_10001606
446 Ga0207671_10002586
447 Ga0207657_10020164
448 Ga0207657_10210900
449 Ga0207681_10002183
450 Ga0207681_10172806
451 Ga0207694_10021024
452 Ga0207650_10249510
453 Ga0207650_10305583
454 Ga0207659_10407643
455 Ga0207659_10470057
456 Ga0207644_10001621
457 Ga0207644_10232533
458 Ga0207669_10208648
459 Ga0207691_10004484
460 Ga0207691_10285060
461 Ga0207711_10012402
462 Ga0207689_10002626
463 Ga0207667_10313438
464 Ga0207651_10473548
465 Ga0207712_10059064
466 Ga0207668_10002999
467 Ga0207668_10092363
468 Ga0207668_10205738
469 Ga0207640_10028999
470 Ga0207658_10071125
471 Ga0207658_10073038
472 Ga0207658_10436510
473 Ga0207658_10673598
474 Ga0207703_10072925
475 Ga0207639_10373129
476 Ga0207639_10424739
477 Ga0207678_10015210
478 Ga0207678_10614795
479 Ga0207702_10389320
480 Ga0207702_10648184
481 Ga0207641_10014158
482 Ga0207648_10008207
483 Ga0207648_10093620
484 Ga0207674_10030327
485 Ga0207683_10003373
486 Ga0207698_10020100
487 Ga0209281_1007820
488 Ga0268266_10000620
489 Ga0268266_10076557
490 Ga0268266_10614621
491 Ga0268265_10041917
492 Ga0268265_10068750
493 Ga0268264_10001864
494 Ga0268264_10011978
495 Ga0265327_10001427
496 Ga0307406_10114467
497 Ga0307411_10581442
498 Ga0307510_10110123
499 Ga0373940_0014806
500 Ga0373946_0136561
501 Ga0373942_0022486
502 Ga0373947_0386833
503 Ga0395905_0168130
504 Ga0436364_0802648
505 Ga0395901_0192979
506 Ga0436365_0498046
507 Ga0436365_0649409
508 Ga0436365_1439967
509 Ga0451577_0205402
510 Ga0466972_0003015
511 Ga0466972_0004698
512 Ga0453683_0027316
513 Ga0466965_0190914
514 Ga0466966_0021135
515 Ga0466961_0013508
516 Ga0466961_0064850
517 Ga0466963_0002648
518 Ga0466964_0072152
519 Ga0453684_0535796
520 Ga0466971_0002759
521 Ga0466971_0101548
522 Ga0466968_0013770
523 Ga0466968_0048780
524 Ga0466957_0039821
525 Ga0466960_0001005
526 Ga0466959_0002064
527 Ga0466959_0192036
528 Ga0466959_0222218
529 Ga0466958_0001950
530 Ga0466958_0041478
531 Ga0466967_0013750
532 Ga0495617_055120
533 Ga0495627_001304
534 Ga0495603_0007260
535 Ga0495591_000012
536 Ga0495638_0071801
537 Ga0495650_0002398
538 Ga0495594_0121351
539 Ga0495607_0004431
540 Ga0495606_0018719
541 Ga0495610_0060355
542 Ga0495616_0193947
543 Ga0495620_0021160
544 Ga0495637_0024359
545 Ga0495643_0031941
546 Ga0495643_0115727
547 Ga0495654_0074759
548 Ga0495609_0092910
549 Ga0495597_0016977
550 Ga0495622_0002845
551 Ga0495668_0049899
552 Ga0495668_0052118
553 Ga0495625_0028331
554 Ga0495625_0150752
555 Ga0495658_0285173
556 Ga0495670_0072724
557 Ga0495649_0037499
558 Ga0495674_0034787
559 Ga0495672_0031336
560 Ga0495687_079655
561 Ga0495681_0001901
562 Ga0495686_0000090
563 Ga0495686_0000161
564 Ga0495686_0006543
565 Ga0495686_0162787
566 Ga0496104_0118575
567 Ga0496106_0231479
568 Ga0496109_0075834
569 Ga0496115_0285663
570 Ga0496116_0007360
571 Ga0496117_0010121
572 Ga0496117_0021697
573 Ga0496117_0041719
574 Ga0496118_0001107
575 Ga0496118_0001576
576 Ga0496118_0003667
577 Ga0496118_0005531
578 Ga0496118_0070032
579 Ga0496119_0029802
580 Ga0496119_0122738
581 Ga0496121_0000464
582 Ga0496121_0000496
583 Ga0496121_0001839
584 Ga0496121_0035174
585 Ga0496121_0137517
586 Ga0496121_0239932
587 Ga0496122_0028328
588 Ga0496122_0124938
589 Ga0496123_0013342
590 Ga0496123_0041905
591 Ga0496123_0046127
592 Ga0496124_0017314
593 Ga0496124_0042287
594 Ga0496124_0080820
595 Ga0496125_0004172
596 Ga0496125_0035727
597 Ga0496126_0000063
598 Ga0496126_0005027
599 Ga0496126_0007366
600 Ga0496126_0029927
601 Ga0496126_0066274
602 Ga0496126_0578151
603 Ga0501033_0053878
604 Ga0501043_0040503
605 Ga0501047_0105127
606 Ga0501249_000507
607 Ga0501044_0038149
608 nmdc:mga03n38_5795_c1
609 nmdc:mga0yw44_216154_c1
610 nmdc:mga05p37_510992_c1
611 nmdc:mga0qj67_423528_c1
612 nmdc:mga06r32_25937_c1
613 nmdc:mga0sz30_544_c1
614 Ga0495601_0027329
615 Ga0500635_0031680
616 Ga0495619_0025949
617 Ga0500643_005065
618 Ga0500643_019177
619 Ga0500643_032112
620 Ga0500646_0043846
621 Ga0500651_0000538
622 Ga0500595_002891
623 Ga0500608_000890
624 Ga0500614_001488
625 Ga0500618_012298
626 Ga0500642_0001931
627 Ga0500652_021861
628 Ga0500655_000905
629 Ga0500564_002170
630 Ga0500590_002901
631 Ga0500590_003534
632 Ga0500622_0006976
633 Ga0500624_000121
634 Ga0500636_0005216
635 Ga0500636_0116334
636 Ga0500567_008380
637 Ga0500570_000470
638 Ga0500625_000034
639 Ga0501082_0074370
640 Ga0466962_0004566
641 2511435358
642 2585259780
643 2643834151
644 2644055077
645 2821449639
646 2844538756
647 2894819267
648 2919088111
649 2919142338
650 2919455328
651 2941475276
652 2958128571
653 2977873056
654 8001849376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

220

298

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

208

248

0.89

PF02311

AraC_binding

AraC-like ligand binding domain

60

184

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.9223 16 87
2ea7-assembly1.cif.gz_A crystal structure of adzuki bean 7s globulin-1 0.9189 20 88
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9127 158 254
2eaa-assembly1.cif.gz_A crystal structure of adzuki bean 7s globulin-3 0.9098 20 88
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.9086 14 89
ID Description Score Start End Superfamily
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9418 17 103 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9351 18 87 2.60.120.10
af_P76241_154_259_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9284 151 252 1.10.10.60
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9161 14 88 2.60.120.10
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9149 157 253 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W5MRT5-F1-model_v4 AraC-like DNA-binding protein 0.9827 7 255 GO:0003700
GO:0043565
AF-A0A4P7QT15-F1-model_v4 deleted 0.9819 8 253
AF-A0A553ASZ6-F1-model_v4 AraC family transcriptional regulator 0.9785 7 252 GO:0003700
GO:0043565
AF-A0A380WDG6-F1-model_v4 Regulatory protein soxS 0.9736 7 252 GO:0003700
GO:0043565
AF-A0A6I4TWW0-F1-model_v4 Helix-turn-helix domain-containing protein 0.9729 1 253 GO:0003700
GO:0043565

Map