F408901

General Info

Members Datasets Scaffolds Average Seq Length
327 172 321 84

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0071883|Ga0466966_0071883_1746_2027
Length 93
Sequence VTAAADQSKTIKLRYFAWVRERIGKAEEEIAPPADIATVAELMAWLAGRGEEYAYAFENPKVIRAAIDRNHVRGEARIEGAGEIAFFPPMTGG

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
4 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
5 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
6 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0.92
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 0.61
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004845 3300005327 Bacteria 10959
2 Ga0070658_10889551 3300005327 Bacteria 774
3 Ga0070658_10951303 3300005327 Bacteria 747
4 Ga0070658_11475474 3300005327 Bacteria 590
5 Ga0070680_100016581 3300005336 Bacteria 5797
6 Ga0070680_100058316 3300005336 Bacteria 3157
7 Ga0070680_100476571 3300005336 Bacteria 1067
8 Ga0070660_100031436 3300005339 Bacteria 3987
9 Ga0070660_100288517 3300005339 Bacteria 1344
10 Ga0070659_100166507 3300005366 Bacteria 1804
11 Ga0070709_11695836 3300005434 Bacteria 516
12 Ga0070714_100107552 3300005435 Bacteria 2465
13 Ga0070714_101195609 3300005435 Bacteria 742
14 Ga0070714_101977293 3300005435 Bacteria 569
15 Ga0070713_100097711 3300005436 Bacteria 2538
16 Ga0070713_100225420 3300005436 Bacteria 1702
17 Ga0070711_100653202 3300005439 Bacteria 882
18 Ga0070711_100752106 3300005439 Bacteria 824
19 Ga0070708_100042175 3300005445 Bacteria 4004
20 Ga0070663_101289496 3300005455 Bacteria 644
21 Ga0070681_10102118 3300005458 Bacteria 2813
22 Ga0070681_10259588 3300005458 Bacteria 1649
23 Ga0070681_10389300 3300005458 Bacteria 1305
24 Ga0070698_100354428 3300005471 Bacteria 1399
25 Ga0070679_100063111 3300005530 Bacteria 3693
26 Ga0070679_100145056 3300005530 Bacteria 2352
27 Ga0070679_100213740 3300005530 Bacteria 1891
28 Ga0070679_100852032 3300005530 Bacteria 855
29 Ga0070679_101475744 3300005530 Bacteria 627
30 Ga0068853_100386396 3300005539 Bacteria 1308
31 Ga0070695_100959990 3300005545 Bacteria 693
32 Ga0068855_100019111 3300005563 Bacteria 8234
33 Ga0068855_100073458 3300005563 Bacteria 3973
34 Ga0068855_100098216 3300005563 Bacteria 3374
35 Ga0068855_100189377 3300005563 Bacteria 2322
36 Ga0068855_100276194 3300005563 Bacteria 1867
37 Ga0068857_100199867 3300005577 Bacteria 1822
38 Ga0068854_100324783 3300005578 Bacteria 1252
39 Ga0068856_100059449 3300005614 Bacteria 3775
40 Ga0068856_101688818 3300005614 Bacteria 646
41 Ga0068852_100109518 3300005616 Bacteria 2508
42 Ga0068852_100291466 3300005616 Bacteria 1577
43 Ga0068852_101136793 3300005616 Bacteria 801
44 Ga0068852_101610324 3300005616 Bacteria 672
45 Ga0081539_10045823 3300005985 Bacteria 2511
46 Ga0070717_10611031 3300006028 Bacteria 989
47 Ga0070717_11623319 3300006028 Bacteria 586
48 Ga0075365_10271769 3300006038 Bacteria 1192
49 Ga0075364_10970684 3300006051 Bacteria 578
50 Ga0075362_10447342 3300006177 Bacteria 656
51 Ga0099795_10017362 3300007788 Bacteria 2293
52 Ga0105240_10074406 3300009093 Bacteria 4193
53 Ga0105240_10673129 3300009093 Bacteria 1132
54 Ga0105240_11924716 3300009093 Bacteria 615
55 Ga0105245_11923733 3300009098 Bacteria 645
56 Ga0099796_10121529 3300010159 Bacteria 1004
57 Ga0157371_10292938 3300013102 Bacteria 1177
58 Ga0157371_10845113 3300013102 Bacteria 692
59 Ga0157370_10141527 3300013104 Bacteria 2241
60 Ga0157370_10187197 3300013104 Bacteria 1922
61 Ga0157369_12124276 3300013105 Bacteria 569
62 Ga0157369_12293701 3300013105 Bacteria 547
63 Ga0157372_10682141 3300013307 Bacteria 1196
64 Ga0157372_13457824 3300013307 Bacteria 502
65 Ga0157377_11587418 3300014745 Bacteria 523
66 Ga0206356_11251027 3300020070 Bacteria 1626
67 Ga0206353_10760961 3300020082 Bacteria 809
68 Ga0213872_10117593 3300021361 Bacteria 1177
69 Ga0213874_10139457 3300021377 Bacteria 838
70 Ga0213876_10079616 3300021384 Bacteria 1732
71 Ga0213876_10089228 3300021384 Bacteria 1633
72 Ga0213875_10000142 3300021388 Bacteria 77423
73 Ga0207699_10256387 3300025906 Bacteria 1207
74 Ga0207699_10650071 3300025906 Bacteria 770
75 Ga0207705_10015260 3300025909 Bacteria 5516
76 Ga0207705_10060367 3300025909 Bacteria 2739
77 Ga0207705_10131577 3300025909 Bacteria 1862
78 Ga0207705_10680837 3300025909 Bacteria 800
79 Ga0207707_10113243 3300025912 Bacteria 2371
80 Ga0207707_10231320 3300025912 Bacteria 1608
81 Ga0207695_10368027 3300025913 Bacteria 1324
82 Ga0207695_10887426 3300025913 Bacteria 771
83 Ga0207663_10300688 3300025916 Bacteria 1199
84 Ga0207660_10105793 3300025917 Bacteria 2109
85 Ga0207660_10355859 3300025917 Bacteria 1174
86 Ga0207660_10466453 3300025917 Bacteria 1022
87 Ga0207657_10042819 3300025919 Bacteria 3992
88 Ga0207657_10206456 3300025919 Bacteria 1578
89 Ga0207649_10637637 3300025920 Bacteria 822
90 Ga0207652_10031909 3300025921 Bacteria 4424
91 Ga0207652_10299410 3300025921 Bacteria 1452
92 Ga0207652_10555930 3300025921 Bacteria 1031
93 Ga0207694_10016005 3300025924 Bacteria 5660
94 Ga0207687_11522302 3300025927 Bacteria 574
95 Ga0207700_10167284 3300025928 Bacteria 1831
96 Ga0207700_10178448 3300025928 Bacteria 1777
97 Ga0207700_10389795 3300025928 Bacteria 1219
98 Ga0207664_10046624 3300025929 Bacteria 3403
99 Ga0207664_10138626 3300025929 Bacteria 2055
100 Ga0207690_10464779 3300025932 Bacteria 1019
101 Ga0207667_10011279 3300025949 Bacteria 10393
102 Ga0207667_10023894 3300025949 Bacteria 6724
103 Ga0207667_10105426 3300025949 Bacteria 2908
104 Ga0207667_10271563 3300025949 Bacteria 1733
105 Ga0207667_12020977 3300025949 Bacteria 536
106 Ga0207640_10247636 3300025981 Bacteria 1381
107 Ga0207640_11718026 3300025981 Bacteria 567
108 Ga0207639_10421258 3300026041 Bacteria 1207
109 Ga0207702_10139768 3300026078 Bacteria 2190
110 Ga0207702_10320016 3300026078 Bacteria 1477
111 Ga0207674_10107760 3300026116 Bacteria 2763
112 Ga0207698_10394576 3300026142 Bacteria 1320
113 Ga0207698_10642748 3300026142 Bacteria 1050
114 Ga0209179_1000935 3300027512 Bacteria 3302
115 Ga0268265_11946317 3300028380 Bacteria 595
116 Ga0307515_10907539 3300028794 Bacteria 513
117 Ga0265338_10020213 3300028800 Bacteria 7016
118 Ga0265762_1185789 3300030760 Bacteria 514
119 Ga0265330_10010747 3300031235 Bacteria 4307
120 Ga0265332_10002647 3300031238 Bacteria 8993
121 Ga0265332_10051450 3300031238 Bacteria 1769
122 Ga0265328_10442144 3300031239 Bacteria 513
123 Ga0265320_10028578 3300031240 Bacteria 2894
124 Ga0265320_10033467 3300031240 Bacteria 2623
125 Ga0265325_10021353 3300031241 Bacteria 3557
126 Ga0265325_10039410 3300031241 Bacteria 2488
127 Ga0265325_10217321 3300031241 Bacteria 876
128 Ga0265329_10064469 3300031242 Bacteria 1159
129 Ga0265340_10004018 3300031247 Bacteria 8265
130 Ga0265340_10016838 3300031247 Bacteria 3781
131 Ga0265339_10001246 3300031249 Bacteria 19148
132 Ga0265339_10003260 3300031249 Bacteria 11369
133 Ga0265339_10009125 3300031249 Bacteria 6263
134 Ga0265339_10578257 3300031249 Bacteria 516
135 Ga0265331_10027092 3300031250 Bacteria 2876
136 Ga0265331_10524224 3300031250 Bacteria 534
137 Ga0265316_10051098 3300031344 Bacteria 3248
138 Ga0265316_10112760 3300031344 Bacteria 2058
139 Ga0265316_10286273 3300031344 Bacteria 1203
140 Ga0265313_10000144 3300031595 Bacteria 73810
141 Ga0265313_10015602 3300031595 Bacteria 4411
142 Ga0316579_10083821 3300031691 Bacteria 1520
143 Ga0265314_10040213 3300031711 Bacteria 3358
144 Ga0265314_10198774 3300031711 Bacteria 1187
145 Ga0265314_10350754 3300031711 Bacteria 812
146 Ga0265342_10000281 3300031712 Bacteria 57398
147 Ga0265342_10004131 3300031712 Bacteria 11554
148 Ga0265342_10024159 3300031712 Bacteria 3838
149 Ga0265342_10326030 3300031712 Bacteria 804
150 Ga0265342_10407474 3300031712 Bacteria 701
151 Ga0316576_10056577 3300031727 Bacteria 2865
152 Ga0316578_10034986 3300031728 Bacteria 2886
153 Ga0307412_12102815 3300031911 Bacteria 524
154 Ga0373944_0149962 3300035089 Bacteria 821
155 Ga0373936_0140256 3300035113 Bacteria 1043
156 Ga0373943_0173744 3300035170 Bacteria 1180
157 Ga0373946_0104520 3300035171 Bacteria 1274
158 Ga0316574_0003845 3300035398 Bacteria 7799
159 Ga0373927_0013109 3300035695 Bacteria 5513
160 Ga0373927_0655928 3300035695 Bacteria 693
161 Ga0373927_0903329 3300035695 Bacteria 583
162 Ga0373947_0140413 3300035725 Bacteria 1549
163 Ga0373947_1213394 3300035725 Bacteria 514
164 Ga0316582_0177317 3300036647 Bacteria 1449
165 Ga0316582_0282197 3300036647 Bacteria 1140
166 Ga0316582_1175701 3300036647 Bacteria 522
167 Ga0316584_0024204 3300036712 Bacteria 4442
168 Ga0373925_0015144 3300037068 Bacteria 5575
169 Ga0373925_0056939 3300037068 Bacteria 2929
170 Ga0395899_0010394 3300037312 Bacteria 7131
171 Ga0395900_0019559 3300037418 Bacteria 6903
172 Ga0395900_0721384 3300037418 Bacteria 929
173 Ga0395898_0006242 3300037466 Bacteria 12763
174 Ga0436364_0266668 3300037853 Bacteria 753
175 Ga0436364_0822664 3300037853 Bacteria 1255
176 Ga0436364_0922366 3300037853 Bacteria 562
177 Ga0436364_1465979 3300037853 Bacteria 23307
178 Ga0395901_0017949 3300038443 Bacteria 7222
179 Ga0395901_1014965 3300038443 Bacteria 805
180 Ga0436365_1101668 3300039437 Bacteria 807
181 Ga0436365_1511595 3300039437 Bacteria 733
182 Ga0436365_1667852 3300039437 Bacteria 1625
183 Ga0436365_1799143 3300039437 Bacteria 2212
184 Ga0436360_0554845 3300039438 Bacteria 716
185 Ga0436361_0121842 3300039447 Bacteria 1529
186 Ga0436361_0133689 3300039447 Bacteria 775
187 Ga0436361_0510482 3300039447 Bacteria 1142
188 Ga0436361_0649230 3300039447 Bacteria 1036
189 Ga0436363_0641229 3300039450 Bacteria 1175
190 Ga0436363_0908613 3300039450 Bacteria 1654
191 Ga0436362_0971045 3300039453 Bacteria 1045
192 Ga0466969_0422465 3300044656 Bacteria 606
193 Ga0466966_0071883 3300044684 Bacteria 2167
194 Ga0466966_0409025 3300044684 Unclassified 815
195 Ga0466961_0268432 3300044693 Bacteria 1046
196 Ga0466963_0014372 3300044694 Bacteria 4881
197 Ga0466963_0072999 3300044694 Bacteria 2312
198 Ga0466963_0196123 3300044694 Bacteria 1411
199 Ga0466963_0353351 3300044694 Bacteria 1035
200 Ga0466963_1223185 3300044694 Bacteria 528
201 Ga0466964_0044198 3300044706 Bacteria 1809
202 Ga0466971_0110204 3300044719 Bacteria 1270
203 Ga0466971_0113201 3300044719 Bacteria 1253
204 Ga0466971_0229497 3300044719 Bacteria 881
205 Ga0466957_0086290 3300044842 Bacteria 1961
206 Ga0466957_0241950 3300044842 Bacteria 1197
207 Ga0466957_0617225 3300044842 Bacteria 760
208 Ga0466959_0098692 3300045049 Bacteria 2092
209 Ga0466958_0072123 3300045836 Bacteria 2115
210 Ga0466958_0095887 3300045836 Bacteria 1839
211 Ga0466958_0194272 3300045836 Bacteria 1290
212 Ga0466967_0258838 3300045976 Bacteria 1664
213 Ga0466967_0470046 3300045976 Bacteria 1231
214 Ga0495638_0061093 3300046460 Bacteria 2329
215 Ga0495632_0251846 3300046519 Bacteria 792
216 Ga0495640_0400201 3300046533 Bacteria 843
217 Ga0495667_0191601 3300046559 Bacteria 1310
218 Ga0495656_0716661 3300046615 Bacteria 539
219 Ga0495676_0185097 3300047321 Bacteria 1457
220 Ga0495684_0116766 3300047471 Bacteria 2012
221 Ga0496109_0606433 3300048912 Bacteria 1031
222 Ga0496109_1365803 3300048912 Bacteria 644
223 Ga0501031_0018852 3300049568 Bacteria 4492
224 Ga0501031_0964000 3300049568 Bacteria 545
225 Ga0501032_0060985 3300049569 Bacteria 2530
226 Ga0501032_0171129 3300049569 Bacteria 1424
227 Ga0501032_0682890 3300049569 Bacteria 651
228 Ga0501033_0028773 3300049570 Bacteria 4175
229 Ga0501033_0926546 3300049570 Bacteria 585
230 Ga0501034_0001246 3300049571 Bacteria 34606
231 Ga0501034_0172124 3300049571 Bacteria 2132
232 Ga0501034_0589754 3300049571 Bacteria 1018
233 Ga0501034_0757139 3300049571 Bacteria 866
234 Ga0501034_0837975 3300049571 Bacteria 810
235 Ga0501034_0885161 3300049571 Bacteria 781
236 Ga0501036_0171223 3300049572 Bacteria 1830
237 Ga0501036_0734922 3300049572 Bacteria 814
238 Ga0501037_0078339 3300049573 Bacteria 2398
239 Ga0501037_0241967 3300049573 Bacteria 1265
240 Ga0501038_0108253 3300049574 Bacteria 2304
241 Ga0501038_0154459 3300049574 Bacteria 1869
242 Ga0501038_0471660 3300049574 Bacteria 963
243 Ga0501038_1364134 3300049574 Bacteria 510
244 Ga0501039_0111466 3300049575 Bacteria 2139
245 Ga0501039_0356719 3300049575 Bacteria 1149
246 Ga0501039_0447048 3300049575 Bacteria 1015
247 Ga0501039_0514559 3300049575 Bacteria 940
248 Ga0501039_0582341 3300049575 Bacteria 877
249 Ga0501042_0145155 3300049578 Bacteria 1711
250 Ga0501042_0799967 3300049578 Bacteria 686
251 Ga0501043_0070588 3300049579 Bacteria 2744
252 Ga0501046_1074893 3300049580 Bacteria 556
253 Ga0501047_0007923 3300049581 Bacteria 10016
254 Ga0501047_0051134 3300049581 Bacteria 3991
255 Ga0501047_0078562 3300049581 Bacteria 3173
256 Ga0501047_0147611 3300049581 Bacteria 2228
257 Ga0501047_0189611 3300049581 Bacteria 1920
258 Ga0501048_0831685 3300049582 Bacteria 664
259 Ga0501048_1350536 3300049582 Bacteria 512
260 Ga0501068_0044005 3300049584 Bacteria 2687
261 Ga0501068_0241140 3300049584 Bacteria 1151
262 Ga0501069_0007682 3300049585 Bacteria 5658
263 Ga0501070_0007744 3300049586 Bacteria 9104
264 Ga0501070_0010886 3300049586 Bacteria 7683
265 Ga0501070_0017946 3300049586 Bacteria 5941
266 Ga0501070_0033303 3300049586 Bacteria 4311
267 Ga0501070_0141668 3300049586 Bacteria 1985
268 Ga0501070_0657319 3300049586 Bacteria 832
269 Ga0501071_0390029 3300049587 Bacteria 1063
270 Ga0501072_0003361 3300049588 Bacteria 12029
271 Ga0501072_0008218 3300049588 Bacteria 7925
272 Ga0501072_0517360 3300049588 Bacteria 944
273 Ga0501072_0857445 3300049588 Bacteria 710
274 Ga0501072_0986869 3300049588 Bacteria 657
275 Ga0501073_0019033 3300049589 Bacteria 4962
276 Ga0501073_0173192 3300049589 Bacteria 1494
277 Ga0501073_0329935 3300049589 Bacteria 1053
278 Ga0501073_0686349 3300049589 Bacteria 707
279 Ga0501075_0141558 3300049591 Bacteria 1833
280 Ga0501076_0029910 3300049592 Bacteria 4240
281 Ga0501079_0067949 3300049741 Bacteria 2751
282 Ga0501080_0022026 3300049742 Bacteria 5904
283 Ga0501080_0228116 3300049742 Bacteria 1703
284 Ga0501080_0368870 3300049742 Bacteria 1295
285 Ga0501080_0451898 3300049742 Bacteria 1152
286 Ga0501080_1591788 3300049742 Bacteria 553
287 Ga0501080_1741196 3300049742 Unclassified 525
288 Ga0501081_1212639 3300049743 Bacteria 572
289 Ga0501083_0009158 3300049744 Bacteria 6994
290 Ga0501083_0046198 3300049744 Bacteria 2944
291 Ga0501035_0000655 3300049822 Bacteria 38162
292 Ga0501044_0065928 3300049823 Bacteria 3693
293 Ga0501044_0078676 3300049823 Bacteria 3341
294 Ga0501044_0079496 3300049823 Bacteria 3323
295 Ga0501044_0119200 3300049823 Bacteria 2641
296 Ga0501044_0206320 3300049823 Bacteria 1921
297 Ga0501044_0211723 3300049823 Bacteria 1892
298 Ga0501044_0681146 3300049823 Bacteria 915
299 Ga0501044_0766874 3300049823 Bacteria 846
300 nmdc:mga03683_47862_c1 3300050489 Bacteria 1775
301 nmdc:mga00v17_473147_c1 3300050491 Bacteria 813
302 nmdc:mga0yw44_289752_c1 3300050492 Bacteria 1095
303 nmdc:mga05p37_780049_c1 3300050507 Bacteria 1049
304 nmdc:mga08y16_1187196_c1 3300050511 Bacteria 734
305 nmdc:mga0n895_232283_c1 3300050512 Bacteria 1872
306 Ga0495601_0229797 3300053077 Bacteria 1212
307 Ga0500610_0046490 3300053079 Bacteria 2254
308 Ga0495619_0064053 3300053085 Bacteria 2450
309 Ga0500651_0476953 3300053093 Bacteria 691
310 Ga0500641_0011677 3300053096 Bacteria 3192
311 Ga0500650_0227756 3300053098 Bacteria 842
312 Ga0500562_023113 3300053108 Bacteria 1622
313 Ga0500593_028321 3300053117 Bacteria 2503
314 Ga0500604_0132828 3300053151 Bacteria 838
315 Ga0590071_023951 3300059421 Bacteria 1446
316 Ga0501082_0009209 3300060353 Bacteria 8510
317 Ga0501082_0140560 3300060353 Bacteria 2095
318 Ga0466962_0022397 3300061719 Bacteria 3036
319 Ga0466962_0333458 3300061719 Bacteria 754
320 Ga0530510_0067106 3300061734 Bacteria 2602
321 Ga0530510_0758994 3300061734 Bacteria 740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_11587418 Ga0157377_115874182 75
2 iso_pu_bacteria 2522572158 2523102257 79
3 iso_pu_bacteria 2595698237 2596374572 79
4 iso_pu_bacteria 2889306138 2889310546 79
5 iso_pu_bacteria 2902405164 2902405783 79
6 iso_pu_bacteria 2928125067 2928125131 79
7 3300005327 Ga0070658_10004845 Ga0070658_100048456 83
8 3300005327 Ga0070658_10889551 Ga0070658_108895511 83
9 3300005327 Ga0070658_10951303 Ga0070658_109513032 83
10 3300005327 Ga0070658_11475474 Ga0070658_114754741 83
11 3300005336 Ga0070680_100016581 Ga0070680_1000165814 83
12 3300005336 Ga0070680_100058316 Ga0070680_1000583161 83
13 3300005336 Ga0070680_100476571 Ga0070680_1004765711 83
14 3300005339 Ga0070660_100031436 Ga0070660_1000314363 83
15 3300005339 Ga0070660_100288517 Ga0070660_1002885171 83
16 3300005366 Ga0070659_100166507 Ga0070659_1001665073 83
17 3300005434 Ga0070709_11695836 Ga0070709_116958361 83
18 3300005435 Ga0070714_100107552 Ga0070714_1001075523 83
19 3300005435 Ga0070714_101195609 Ga0070714_1011956092 83
20 3300005435 Ga0070714_101977293 Ga0070714_1019772931 83
21 3300005436 Ga0070713_100097711 Ga0070713_1000977113 83
22 3300005436 Ga0070713_100225420 Ga0070713_1002254202 83
23 3300005439 Ga0070711_100653202 Ga0070711_1006532022 83
24 3300005439 Ga0070711_100752106 Ga0070711_1007521062 83
25 3300005445 Ga0070708_100042175 Ga0070708_1000421752 83
26 3300005455 Ga0070663_101289496 Ga0070663_1012894961 83
27 3300005458 Ga0070681_10102118 Ga0070681_101021182 83
28 3300005458 Ga0070681_10259588 Ga0070681_102595883 83
29 3300005458 Ga0070681_10389300 Ga0070681_103893003 83
30 3300005471 Ga0070698_100354428 Ga0070698_1003544283 83
31 3300005530 Ga0070679_100063111 Ga0070679_1000631113 83
32 3300005530 Ga0070679_100145056 Ga0070679_1001450564 83
33 3300005530 Ga0070679_100213740 Ga0070679_1002137401 83
34 3300005530 Ga0070679_100852032 Ga0070679_1008520321 83
35 3300005530 Ga0070679_101475744 Ga0070679_1014757441 83
36 3300005539 Ga0068853_100386396 Ga0068853_1003863961 83
37 3300005545 Ga0070695_100959990 Ga0070695_1009599902 83
38 3300005563 Ga0068855_100019111 Ga0068855_1000191119 83
39 3300005563 Ga0068855_100073458 Ga0068855_1000734584 83
40 3300005563 Ga0068855_100098216 Ga0068855_1000982162 83
41 3300005563 Ga0068855_100189377 Ga0068855_1001893774 83
42 3300005563 Ga0068855_100276194 Ga0068855_1002761942 83
43 3300005577 Ga0068857_100199867 Ga0068857_1001998673 83
44 3300005578 Ga0068854_100324783 Ga0068854_1003247832 83
45 3300005614 Ga0068856_100059449 Ga0068856_1000594494 83
46 3300005614 Ga0068856_101688818 Ga0068856_1016888181 83
47 3300005616 Ga0068852_100109518 Ga0068852_1001095183 83
48 3300005616 Ga0068852_100291466 Ga0068852_1002914663 83
49 3300005616 Ga0068852_101136793 Ga0068852_1011367932 83
50 3300005616 Ga0068852_101610324 Ga0068852_1016103242 83
51 3300005985 Ga0081539_10045823 Ga0081539_100458234 83
52 3300006028 Ga0070717_10611031 Ga0070717_106110312 83
53 3300006028 Ga0070717_11623319 Ga0070717_116233192 83
54 3300006038 Ga0075365_10271769 Ga0075365_102717692 83
55 3300006051 Ga0075364_10970684 Ga0075364_109706842 83
56 3300006177 Ga0075362_10447342 Ga0075362_104473421 83
57 3300007788 Ga0099795_10017362 Ga0099795_100173623 83
58 3300009093 Ga0105240_10074406 Ga0105240_100744063 83
59 3300009093 Ga0105240_10673129 Ga0105240_106731291 83
60 3300009093 Ga0105240_11924716 Ga0105240_119247162 83
61 3300009098 Ga0105245_11923733 Ga0105245_119237332 83
62 3300010159 Ga0099796_10121529 Ga0099796_101215292 83
63 3300013102 Ga0157371_10292938 Ga0157371_102929381 83
64 3300013102 Ga0157371_10845113 Ga0157371_108451131 83
65 3300013104 Ga0157370_10141527 Ga0157370_101415271 83
66 3300013104 Ga0157370_10187197 Ga0157370_101871973 83
67 3300013105 Ga0157369_12124276 Ga0157369_121242761 83
68 3300013105 Ga0157369_12293701 Ga0157369_122937012 83
69 3300013307 Ga0157372_10682141 Ga0157372_106821412 83
70 3300013307 Ga0157372_13457824 Ga0157372_134578241 83
71 3300020070 Ga0206356_11251027 Ga0206356_112510273 83
72 3300020082 Ga0206353_10760961 Ga0206353_107609612 83
73 3300021361 Ga0213872_10117593 Ga0213872_101175933 83
74 3300021377 Ga0213874_10139457 Ga0213874_101394572 83
75 3300021384 Ga0213876_10079616 Ga0213876_100796163 83
76 3300021384 Ga0213876_10089228 Ga0213876_100892283 83
77 3300021388 Ga0213875_10000142 Ga0213875_1000014255 83
78 3300025906 Ga0207699_10256387 Ga0207699_102563873 83
79 3300025906 Ga0207699_10650071 Ga0207699_106500712 83
80 3300025909 Ga0207705_10015260 Ga0207705_100152603 83
81 3300025909 Ga0207705_10060367 Ga0207705_100603673 83
82 3300025909 Ga0207705_10131577 Ga0207705_101315772 83
83 3300025909 Ga0207705_10680837 Ga0207705_106808371 83
84 3300025912 Ga0207707_10113243 Ga0207707_101132434 83
85 3300025912 Ga0207707_10231320 Ga0207707_102313202 83
86 3300025913 Ga0207695_10368027 Ga0207695_103680272 83
87 3300025913 Ga0207695_10887426 Ga0207695_108874262 83
88 3300025916 Ga0207663_10300688 Ga0207663_103006884 83
89 3300025917 Ga0207660_10105793 Ga0207660_101057932 83
90 3300025917 Ga0207660_10355859 Ga0207660_103558591 83
91 3300025917 Ga0207660_10466453 Ga0207660_104664532 83
92 3300025919 Ga0207657_10042819 Ga0207657_100428193 83
93 3300025919 Ga0207657_10206456 Ga0207657_102064562 83
94 3300025920 Ga0207649_10637637 Ga0207649_106376371 83
95 3300025921 Ga0207652_10031909 Ga0207652_100319096 83
96 3300025921 Ga0207652_10299410 Ga0207652_102994103 83
97 3300025921 Ga0207652_10555930 Ga0207652_105559302 83
98 3300025924 Ga0207694_10016005 Ga0207694_100160055 83
99 3300025927 Ga0207687_11522302 Ga0207687_115223022 83
100 3300025928 Ga0207700_10167284 Ga0207700_101672844 83
101 3300025928 Ga0207700_10178448 Ga0207700_101784482 83
102 3300025928 Ga0207700_10389795 Ga0207700_103897952 83
103 3300025929 Ga0207664_10046624 Ga0207664_100466243 83
104 3300025929 Ga0207664_10138626 Ga0207664_101386263 83
105 3300025932 Ga0207690_10464779 Ga0207690_104647792 83
106 3300025949 Ga0207667_10011279 Ga0207667_100112796 83
107 3300025949 Ga0207667_10023894 Ga0207667_100238945 83
108 3300025949 Ga0207667_10105426 Ga0207667_101054264 83
109 3300025949 Ga0207667_10271563 Ga0207667_102715632 83
110 3300025949 Ga0207667_12020977 Ga0207667_120209771 83
111 3300025981 Ga0207640_10247636 Ga0207640_102476362 83
112 3300025981 Ga0207640_11718026 Ga0207640_117180262 83
113 3300026041 Ga0207639_10421258 Ga0207639_104212582 83
114 3300026078 Ga0207702_10139768 Ga0207702_101397682 83
115 3300026078 Ga0207702_10320016 Ga0207702_103200162 83
116 3300026116 Ga0207674_10107760 Ga0207674_101077603 83
117 3300026142 Ga0207698_10394576 Ga0207698_103945763 83
118 3300026142 Ga0207698_10642748 Ga0207698_106427482 83
119 3300027512 Ga0209179_1000935 Ga0209179_10009354 83
120 3300028380 Ga0268265_11946317 Ga0268265_119463172 83
121 3300028794 Ga0307515_10907539 Ga0307515_109075392 83
122 3300028800 Ga0265338_10020213 Ga0265338_100202138 83
123 3300030760 Ga0265762_1185789 Ga0265762_11857891 83
124 3300031235 Ga0265330_10010747 Ga0265330_100107473 83
125 3300031238 Ga0265332_10002647 Ga0265332_100026474 83
126 3300031238 Ga0265332_10051450 Ga0265332_100514502 83
127 3300031239 Ga0265328_10442144 Ga0265328_104421442 83
128 3300031240 Ga0265320_10028578 Ga0265320_100285781 83
129 3300031240 Ga0265320_10033467 Ga0265320_100334674 83
130 3300031241 Ga0265325_10021353 Ga0265325_100213534 83
131 3300031241 Ga0265325_10039410 Ga0265325_100394103 83
132 3300031241 Ga0265325_10217321 Ga0265325_102173212 83
133 3300031242 Ga0265329_10064469 Ga0265329_100644691 83
134 3300031247 Ga0265340_10004018 Ga0265340_100040182 83
135 3300031247 Ga0265340_10016838 Ga0265340_100168383 83
136 3300031249 Ga0265339_10001246 Ga0265339_1000124617 83
137 3300031249 Ga0265339_10003260 Ga0265339_100032604 83
138 3300031249 Ga0265339_10009125 Ga0265339_100091252 83
139 3300031249 Ga0265339_10578257 Ga0265339_105782572 83
140 3300031250 Ga0265331_10027092 Ga0265331_100270923 83
141 3300031250 Ga0265331_10524224 Ga0265331_105242241 83
142 3300031344 Ga0265316_10051098 Ga0265316_100510983 83
143 3300031344 Ga0265316_10112760 Ga0265316_101127601 83
144 3300031344 Ga0265316_10286273 Ga0265316_102862732 83
145 3300031595 Ga0265313_10000144 Ga0265313_1000014411 83
146 3300031595 Ga0265313_10015602 Ga0265313_100156023 83
147 3300031691 Ga0316579_10083821 Ga0316579_100838212 83
148 3300031711 Ga0265314_10040213 Ga0265314_100402135 83
149 3300031711 Ga0265314_10198774 Ga0265314_101987742 83
150 3300031711 Ga0265314_10350754 Ga0265314_103507542 83
151 3300031712 Ga0265342_10000281 Ga0265342_1000028127 83
152 3300031712 Ga0265342_10004131 Ga0265342_100041318 83
153 3300031712 Ga0265342_10024159 Ga0265342_100241593 83
154 3300031712 Ga0265342_10326030 Ga0265342_103260302 83
155 3300031712 Ga0265342_10407474 Ga0265342_104074741 83
156 3300031727 Ga0316576_10056577 Ga0316576_100565773 83
157 3300031728 Ga0316578_10034986 Ga0316578_100349863 83
158 3300031911 Ga0307412_12102815 Ga0307412_121028151 83
159 3300035089 Ga0373944_0149962 Ga0373944_0149962_425_685 83
160 3300035113 Ga0373936_0140256 Ga0373936_0140256_270_527 83
161 3300035170 Ga0373943_0173744 Ga0373943_0173744_778_1035 83
162 3300035171 Ga0373946_0104520 Ga0373946_0104520_759_1019 83
163 3300035398 Ga0316574_0003845 Ga0316574_0003845_7128_7394 83
164 3300035695 Ga0373927_0013109 Ga0373927_0013109_4631_4888 83
165 3300035695 Ga0373927_0655928 Ga0373927_0655928_211_468 83
166 3300035695 Ga0373927_0903329 Ga0373927_0903329_50_307 83
167 3300035725 Ga0373947_0140413 Ga0373947_0140413_1070_1327 83
168 3300035725 Ga0373947_1213394 Ga0373947_1213394_100_357 83
169 3300036647 Ga0316582_0177317 Ga0316582_0177317_603_854 83
170 3300036647 Ga0316582_0282197 Ga0316582_0282197_552_818 83
171 3300036647 Ga0316582_1175701 Ga0316582_1175701_61_321 83
172 3300036712 Ga0316584_0024204 Ga0316584_0024204_2059_2325 83
173 3300037068 Ga0373925_0015144 Ga0373925_0015144_4329_4586 83
174 3300037068 Ga0373925_0056939 Ga0373925_0056939_415_675 83
175 3300037312 Ga0395899_0010394 Ga0395899_0010394_960_1211 83
176 3300037418 Ga0395900_0019559 Ga0395900_0019559_2413_2664 83
177 3300037418 Ga0395900_0721384 Ga0395900_0721384_19_270 83
178 3300037466 Ga0395898_0006242 Ga0395898_0006242_2648_2899 83
179 3300037853 Ga0436364_0266668 Ga0436364_0266668_275_526 83
180 3300037853 Ga0436364_0822664 Ga0436364_0822664_224_481 83
181 3300037853 Ga0436364_0922366 Ga0436364_0922366_67_318 83
182 3300037853 Ga0436364_1465979 Ga0436364_1465979_17851_18102 83
183 3300038443 Ga0395901_0017949 Ga0395901_0017949_939_1190 83
184 3300038443 Ga0395901_1014965 Ga0395901_1014965_429_680 83
185 3300039437 Ga0436365_1101668 Ga0436365_1101668_343_594 83
186 3300039437 Ga0436365_1511595 Ga0436365_1511595_336_587 83
187 3300039437 Ga0436365_1667852 Ga0436365_1667852_823_1074 83
188 3300039437 Ga0436365_1799143 Ga0436365_1799143_709_960 83
189 3300039438 Ga0436360_0554845 Ga0436360_0554845_431_688 83
190 3300039447 Ga0436361_0121842 Ga0436361_0121842_41_298 83
191 3300039447 Ga0436361_0133689 Ga0436361_0133689_249_500 83
192 3300039447 Ga0436361_0510482 Ga0436361_0510482_473_730 83
193 3300039447 Ga0436361_0649230 Ga0436361_0649230_138_395 83
194 3300039450 Ga0436363_0641229 Ga0436363_0641229_656_907 83
195 3300039450 Ga0436363_0908613 Ga0436363_0908613_831_1082 83
196 3300039453 Ga0436362_0971045 Ga0436362_0971045_418_675 83
197 3300044656 Ga0466969_0422465 Ga0466969_0422465_45_296 83
198 3300044684 Ga0466966_0071883 Ga0466966_0071883_1746_2027 83
199 3300044684 Ga0466966_0409025 Ga0466966_0409025_172_423 83
200 3300044693 Ga0466961_0268432 Ga0466961_0268432_368_619 83
201 3300044694 Ga0466963_0014372 Ga0466963_0014372_2154_2405 83
202 3300044694 Ga0466963_0072999 Ga0466963_0072999_983_1264 83
203 3300044694 Ga0466963_0196123 Ga0466963_0196123_1054_1305 83
204 3300044694 Ga0466963_0353351 Ga0466963_0353351_316_567 83
205 3300044694 Ga0466963_1223185 Ga0466963_1223185_226_477 83
206 3300044706 Ga0466964_0044198 Ga0466964_0044198_605_856 83
207 3300044719 Ga0466971_0110204 Ga0466971_0110204_989_1240 83
208 3300044719 Ga0466971_0113201 Ga0466971_0113201_446_697 83
209 3300044719 Ga0466971_0229497 Ga0466971_0229497_567_848 83
210 3300044842 Ga0466957_0086290 Ga0466957_0086290_436_687 83
211 3300044842 Ga0466957_0241950 Ga0466957_0241950_637_888 83
212 3300044842 Ga0466957_0617225 Ga0466957_0617225_38_319 83
213 3300045049 Ga0466959_0098692 Ga0466959_0098692_1149_1430 83
214 3300045836 Ga0466958_0072123 Ga0466958_0072123_1051_1302 83
215 3300045836 Ga0466958_0095887 Ga0466958_0095887_1464_1715 83
216 3300045836 Ga0466958_0194272 Ga0466958_0194272_643_924 83
217 3300045976 Ga0466967_0258838 Ga0466967_0258838_606_857 83
218 3300045976 Ga0466967_0470046 Ga0466967_0470046_637_888 83
219 3300046460 Ga0495638_0061093 Ga0495638_0061093_118_369 83
220 3300046519 Ga0495632_0251846 Ga0495632_0251846_447_698 83
221 3300046533 Ga0495640_0400201 Ga0495640_0400201_30_287 83
222 3300046559 Ga0495667_0191601 Ga0495667_0191601_155_412 83
223 3300046615 Ga0495656_0716661 Ga0495656_0716661_215_466 83
224 3300047321 Ga0495676_0185097 Ga0495676_0185097_507_764 83
225 3300047471 Ga0495684_0116766 Ga0495684_0116766_16_273 83
226 3300048912 Ga0496109_0606433 Ga0496109_0606433_334_585 83
227 3300048912 Ga0496109_1365803 Ga0496109_1365803_259_510 83
228 3300049568 Ga0501031_0018852 Ga0501031_0018852_3061_3312 83
229 3300049568 Ga0501031_0964000 Ga0501031_0964000_25_276 83
230 3300049569 Ga0501032_0060985 Ga0501032_0060985_2117_2368 83
231 3300049569 Ga0501032_0171129 Ga0501032_0171129_1037_1288 83
232 3300049569 Ga0501032_0682890 Ga0501032_0682890_84_335 83
233 3300049570 Ga0501033_0028773 Ga0501033_0028773_3131_3382 83
234 3300049570 Ga0501033_0926546 Ga0501033_0926546_35_286 83
235 3300049571 Ga0501034_0001246 Ga0501034_0001246_3460_3711 83
236 3300049571 Ga0501034_0172124 Ga0501034_0172124_522_773 83
237 3300049571 Ga0501034_0589754 Ga0501034_0589754_527_778 83
238 3300049571 Ga0501034_0757139 Ga0501034_0757139_549_800 83
239 3300049571 Ga0501034_0837975 Ga0501034_0837975_15_266 83
240 3300049571 Ga0501034_0885161 Ga0501034_0885161_251_502 83
241 3300049572 Ga0501036_0171223 Ga0501036_0171223_870_1121 83
242 3300049572 Ga0501036_0734922 Ga0501036_0734922_314_565 83
243 3300049573 Ga0501037_0078339 Ga0501037_0078339_986_1237 83
244 3300049573 Ga0501037_0241967 Ga0501037_0241967_854_1105 83
245 3300049574 Ga0501038_0108253 Ga0501038_0108253_1037_1288 83
246 3300049574 Ga0501038_0154459 Ga0501038_0154459_331_582 83
247 3300049574 Ga0501038_0471660 Ga0501038_0471660_21_278 83
248 3300049574 Ga0501038_1364134 Ga0501038_1364134_240_491 83
249 3300049575 Ga0501039_0111466 Ga0501039_0111466_1558_1809 83
250 3300049575 Ga0501039_0356719 Ga0501039_0356719_762_1013 83
251 3300049575 Ga0501039_0447048 Ga0501039_0447048_473_724 83
252 3300049575 Ga0501039_0514559 Ga0501039_0514559_439_690 83
253 3300049575 Ga0501039_0582341 Ga0501039_0582341_489_740 83
254 3300049578 Ga0501042_0145155 Ga0501042_0145155_326_598 83
255 3300049578 Ga0501042_0799967 Ga0501042_0799967_93_344 83
256 3300049579 Ga0501043_0070588 Ga0501043_0070588_576_833 83
257 3300049580 Ga0501046_1074893 Ga0501046_1074893_41_292 83
258 3300049581 Ga0501047_0007923 Ga0501047_0007923_8607_8858 83
259 3300049581 Ga0501047_0051134 Ga0501047_0051134_995_1246 83
260 3300049581 Ga0501047_0078562 Ga0501047_0078562_2041_2298 83
261 3300049581 Ga0501047_0147611 Ga0501047_0147611_176_433 83
262 3300049581 Ga0501047_0189611 Ga0501047_0189611_236_487 83
263 3300049582 Ga0501048_0831685 Ga0501048_0831685_253_504 83
264 3300049582 Ga0501048_1350536 Ga0501048_1350536_206_457 83
265 3300049584 Ga0501068_0044005 Ga0501068_0044005_1467_1718 83
266 3300049584 Ga0501068_0241140 Ga0501068_0241140_40_291 83
267 3300049585 Ga0501069_0007682 Ga0501069_0007682_4625_4885 83
268 3300049586 Ga0501070_0007744 Ga0501070_0007744_6555_6815 83
269 3300049586 Ga0501070_0010886 Ga0501070_0010886_7338_7595 83
270 3300049586 Ga0501070_0017946 Ga0501070_0017946_232_492 83
271 3300049586 Ga0501070_0033303 Ga0501070_0033303_95_346 83
272 3300049586 Ga0501070_0141668 Ga0501070_0141668_1012_1263 83
273 3300049586 Ga0501070_0657319 Ga0501070_0657319_211_462 83
274 3300049587 Ga0501071_0390029 Ga0501071_0390029_517_768 83
275 3300049588 Ga0501072_0003361 Ga0501072_0003361_5299_5550 83
276 3300049588 Ga0501072_0008218 Ga0501072_0008218_309_581 83
277 3300049588 Ga0501072_0517360 Ga0501072_0517360_629_886 83
278 3300049588 Ga0501072_0857445 Ga0501072_0857445_67_318 83
279 3300049588 Ga0501072_0986869 Ga0501072_0986869_91_342 83
280 3300049589 Ga0501073_0019033 Ga0501073_0019033_2561_2812 83
281 3300049589 Ga0501073_0173192 Ga0501073_0173192_85_336 83
282 3300049589 Ga0501073_0329935 Ga0501073_0329935_317_577 83
283 3300049589 Ga0501073_0686349 Ga0501073_0686349_19_270 83
284 3300049591 Ga0501075_0141558 Ga0501075_0141558_211_483 83
285 3300049592 Ga0501076_0029910 Ga0501076_0029910_1281_1532 83
286 3300049741 Ga0501079_0067949 Ga0501079_0067949_1171_1422 83
287 3300049742 Ga0501080_0022026 Ga0501080_0022026_4548_4805 83
288 3300049742 Ga0501080_0228116 Ga0501080_0228116_1085_1336 83
289 3300049742 Ga0501080_0368870 Ga0501080_0368870_531_782 83
290 3300049742 Ga0501080_0451898 Ga0501080_0451898_482_733 83
291 3300049742 Ga0501080_1591788 Ga0501080_1591788_154_414 83
292 3300049742 Ga0501080_1741196 Ga0501080_1741196_236_496 83
293 3300049743 Ga0501081_1212639 Ga0501081_1212639_277_528 83
294 3300049744 Ga0501083_0009158 Ga0501083_0009158_5563_5814 83
295 3300049744 Ga0501083_0046198 Ga0501083_0046198_2084_2335 83
296 3300049822 Ga0501035_0000655 Ga0501035_0000655_19848_20108 83
297 3300049823 Ga0501044_0065928 Ga0501044_0065928_969_1220 83
298 3300049823 Ga0501044_0078676 Ga0501044_0078676_568_825 83
299 3300049823 Ga0501044_0079496 Ga0501044_0079496_1633_1884 83
300 3300049823 Ga0501044_0119200 Ga0501044_0119200_2341_2592 83
301 3300049823 Ga0501044_0206320 Ga0501044_0206320_413_664 83
302 3300049823 Ga0501044_0211723 Ga0501044_0211723_1156_1407 83
303 3300049823 Ga0501044_0681146 Ga0501044_0681146_433_684 83
304 3300049823 Ga0501044_0766874 Ga0501044_0766874_305_556 83
305 3300050489 nmdc:mga03683_47862_c1 nmdc:mga03683_47862_c1_1180_1431 83
306 3300050491 nmdc:mga00v17_473147_c1 nmdc:mga00v17_473147_c1_99_350 83
307 3300050492 nmdc:mga0yw44_289752_c1 nmdc:mga0yw44_289752_c1_539_790 83
308 3300050507 nmdc:mga05p37_780049_c1 nmdc:mga05p37_780049_c1_143_394 83
309 3300050511 nmdc:mga08y16_1187196_c1 nmdc:mga08y16_1187196_c1_438_689 83
310 3300050512 nmdc:mga0n895_232283_c1 nmdc:mga0n895_232283_c1_55_312 83
311 3300053077 Ga0495601_0229797 Ga0495601_0229797_900_1157 83
312 3300053079 Ga0500610_0046490 Ga0500610_0046490_950_1201 83
313 3300053085 Ga0495619_0064053 Ga0495619_0064053_29_286 83
314 3300053093 Ga0500651_0476953 Ga0500651_0476953_356_607 83
315 3300053096 Ga0500641_0011677 Ga0500641_0011677_1446_1697 83
316 3300053098 Ga0500650_0227756 Ga0500650_0227756_35_286 83
317 3300053108 Ga0500562_023113 Ga0500562_023113_299_550 83
318 3300053117 Ga0500593_028321 Ga0500593_028321_975_1226 83
319 3300053151 Ga0500604_0132828 Ga0500604_0132828_520_771 83
320 3300059421 Ga0590071_023951 Ga0590071_023951_533_784 83
321 3300060353 Ga0501082_0009209 Ga0501082_0009209_4986_5237 83
322 3300060353 Ga0501082_0140560 Ga0501082_0140560_1095_1346 83
323 3300061719 Ga0466962_0022397 Ga0466962_0022397_1911_2162 83
324 3300061719 Ga0466962_0333458 Ga0466962_0333458_484_735 83
325 3300061734 Ga0530510_0067106 Ga0530510_0067106_2020_2271 83
326 3300061734 Ga0530510_0758994 Ga0530510_0758994_410_661 83
327 iso_pu_bacteria 2842698319 2842698710 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

13

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8646 1 83
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8549 1 83
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8482 2 83
2qie-assembly1.cif.gz_D staphylococcus aureus molybdopterin synthase in complex with precursor z 0.8102 1 83
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8096 2 83
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9029 2 83 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.872 2 83 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8647 1 79 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8443 1 79 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8416 2 83 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A258K8M6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9925 1 43
AF-A0A212QXW6-F1-model_v4 Molybdopterin synthase subunit MoaD 0.9656 1 83
AF-A0A0Q6BUZ6-F1-model_v4 deleted 0.9655 1 83
AF-A0A1I2BS04-F1-model_v4 deleted 0.9638 1 83
AF-A0A849EGV1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9627 1 81 GO:0006777
GO:1990133

Feature Viewer

pLDDT pTM Quality
92.1 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map