F408857
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 231 | 315 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10309823|Ga0307414_103098233 |
| Length | 122 |
| Sequence | VNRFAKTFAAAPEHIDELGHVNNAVWLQWVQDIATAHWSAVADAVVTRHEIDYRGNVGLGETVTGETWIPNPPKGAQFDRCVEFRDAAGKRLVAVKSTWAMLDRASGRLVRIPADVAAPFLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 3 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 4 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 5 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 6 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 7 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 8 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 9 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 10 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 11 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 12 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 13 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 147 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 148 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 149 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 150 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 154 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 155 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 156 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 157 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 158 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 159 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 160 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 161 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 162 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 163 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 164 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 165 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 201 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 202 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 205 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 206 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 217 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 220 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 221 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 223 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 226 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 228 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 230 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 231 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.33 |
| Metatranscriptomes | 0 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.92 |
| Bulb | 0 |
| Endosphere | 9.79 |
| Nodule | 0 |
| Rhizoplane | 4.59 |
| Rhizosphere | 75.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2660858 | 2162886007 | Bacteria | 9264 |
| 2 | JGI24739J22299_10009476 | 3300001989 | Bacteria | 3629 |
| 3 | JGI24748J21848_1009458 | 3300002074 | Bacteria | 1148 |
| 4 | JGI25165J46597_1000385 | 3300003214 | Bacteria | 47716 |
| 5 | Ga0055530_10000202 | 3300003791 | Bacteria | 53648 |
| 6 | Ga0055531_10000090 | 3300003794 | Bacteria | 100342 |
| 7 | Ga0065714_10461713 | 3300005288 | Bacteria | 546 |
| 8 | Ga0065704_10070333 | 3300005289 | Bacteria | 31916 |
| 9 | Ga0065712_10201521 | 3300005290 | Bacteria | 1102 |
| 10 | Ga0070676_11370430 | 3300005328 | Bacteria | 542 |
| 11 | Ga0070683_100071518 | 3300005329 | Bacteria | 3237 |
| 12 | Ga0070670_100141446 | 3300005331 | Bacteria | 2081 |
| 13 | Ga0068869_100675153 | 3300005334 | Bacteria | 879 |
| 14 | Ga0070666_10001699 | 3300005335 | Bacteria | 13427 |
| 15 | Ga0070680_100001754 | 3300005336 | Bacteria | 15933 |
| 16 | Ga0070682_100035454 | 3300005337 | Bacteria | 3046 |
| 17 | Ga0068868_101097504 | 3300005338 | Bacteria | 732 |
| 18 | Ga0070660_100784263 | 3300005339 | Bacteria | 801 |
| 19 | Ga0070691_10239244 | 3300005341 | Bacteria | 969 |
| 20 | Ga0070661_100008812 | 3300005344 | Bacteria | 6982 |
| 21 | Ga0070692_10244462 | 3300005345 | Bacteria | 1071 |
| 22 | Ga0070692_10838321 | 3300005345 | Bacteria | 631 |
| 23 | Ga0070668_100000076 | 3300005347 | Bacteria | 60771 |
| 24 | Ga0070668_100006926 | 3300005347 | Bacteria | 8398 |
| 25 | Ga0070669_100000143 | 3300005353 | Bacteria | 64072 |
| 26 | Ga0070669_100064229 | 3300005353 | Bacteria | 2703 |
| 27 | Ga0070669_100275391 | 3300005353 | Bacteria | 1347 |
| 28 | Ga0070675_100048909 | 3300005354 | Bacteria | 3469 |
| 29 | Ga0070671_100011449 | 3300005355 | Bacteria | 7131 |
| 30 | Ga0070674_101359482 | 3300005356 | Bacteria | 635 |
| 31 | Ga0070659_100053183 | 3300005366 | Bacteria | 3187 |
| 32 | Ga0070659_100265623 | 3300005366 | Bacteria | 1424 |
| 33 | Ga0070667_100000025 | 3300005367 | Bacteria | 190744 |
| 34 | Ga0070667_100000210 | 3300005367 | Bacteria | 68040 |
| 35 | Ga0070662_100000900 | 3300005457 | Bacteria | 18178 |
| 36 | Ga0070662_100015259 | 3300005457 | Bacteria | 5143 |
| 37 | Ga0068867_100340950 | 3300005459 | Bacteria | 1248 |
| 38 | Ga0070698_100355326 | 3300005471 | Bacteria | 1397 |
| 39 | Ga0070679_100014086 | 3300005530 | Bacteria | 7669 |
| 40 | Ga0070684_100582024 | 3300005535 | Bacteria | 1040 |
| 41 | Ga0068853_100032690 | 3300005539 | Bacteria | 4409 |
| 42 | Ga0070665_100014128 | 3300005548 | Bacteria | 8023 |
| 43 | Ga0070665_101708119 | 3300005548 | Bacteria | 637 |
| 44 | Ga0068855_100017830 | 3300005563 | Bacteria | 8534 |
| 45 | Ga0068855_100090167 | 3300005563 | Bacteria | 3539 |
| 46 | Ga0068855_100109011 | 3300005563 | Bacteria | 3180 |
| 47 | Ga0068855_102226576 | 3300005563 | Bacteria | 550 |
| 48 | Ga0070664_100017361 | 3300005564 | Bacteria | 5909 |
| 49 | Ga0070664_100534771 | 3300005564 | Bacteria | 1083 |
| 50 | Ga0068857_100077634 | 3300005577 | Bacteria | 2963 |
| 51 | Ga0068857_100078397 | 3300005577 | Bacteria | 2949 |
| 52 | Ga0068854_100046494 | 3300005578 | Bacteria | 3090 |
| 53 | Ga0068854_100099474 | 3300005578 | Bacteria | 2178 |
| 54 | Ga0068856_100010625 | 3300005614 | Bacteria | 8946 |
| 55 | Ga0068852_100439346 | 3300005616 | Bacteria | 1290 |
| 56 | Ga0068859_102169319 | 3300005617 | Bacteria | 613 |
| 57 | Ga0068861_100339511 | 3300005719 | Bacteria | 1314 |
| 58 | Ga0068861_101798317 | 3300005719 | Bacteria | 608 |
| 59 | Ga0068870_10821514 | 3300005840 | Bacteria | 651 |
| 60 | Ga0068863_100000067 | 3300005841 | Bacteria | 117275 |
| 61 | Ga0068863_100317674 | 3300005841 | Bacteria | 1512 |
| 62 | Ga0068858_100000742 | 3300005842 | Bacteria | 34163 |
| 63 | Ga0068858_100038425 | 3300005842 | Bacteria | 4440 |
| 64 | Ga0068858_102242447 | 3300005842 | Bacteria | 540 |
| 65 | Ga0068860_100017251 | 3300005843 | Bacteria | 7036 |
| 66 | Ga0068862_100047194 | 3300005844 | Bacteria | 3675 |
| 67 | Ga0068862_100734629 | 3300005844 | Bacteria | 959 |
| 68 | Ga0081539_10050777 | 3300005985 | Bacteria | 2344 |
| 69 | Ga0068865_100890729 | 3300006881 | Bacteria | 773 |
| 70 | Ga0097620_102169136 | 3300006931 | Bacteria | 613 |
| 71 | Ga0105250_10012000 | 3300009092 | Bacteria | 3587 |
| 72 | Ga0105240_11604745 | 3300009093 | Bacteria | 681 |
| 73 | Ga0105245_10005284 | 3300009098 | Bacteria | 11343 |
| 74 | Ga0105247_10110110 | 3300009101 | Bacteria | 1771 |
| 75 | Ga0105241_10036289 | 3300009174 | Bacteria | 3709 |
| 76 | Ga0105242_10193468 | 3300009176 | Bacteria | 1802 |
| 77 | Ga0105242_10608116 | 3300009176 | Bacteria | 1057 |
| 78 | Ga0105248_10027683 | 3300009177 | Bacteria | 6312 |
| 79 | Ga0105237_12714220 | 3300009545 | Bacteria | 506 |
| 80 | Ga0105238_10043816 | 3300009551 | Bacteria | 4526 |
| 81 | Ga0105249_10160640 | 3300009553 | Bacteria | 2171 |
| 82 | Ga0105249_11137194 | 3300009553 | Bacteria | 851 |
| 83 | Ga0105239_12200587 | 3300010375 | Bacteria | 641 |
| 84 | Ga0105246_10000083 | 3300011119 | Bacteria | 40197 |
| 85 | Ga0157373_10001931 | 3300013100 | Bacteria | 15749 |
| 86 | Ga0157371_10002579 | 3300013102 | Bacteria | 17192 |
| 87 | Ga0157371_10043316 | 3300013102 | Bacteria | 3207 |
| 88 | Ga0157371_10157688 | 3300013102 | Bacteria | 1620 |
| 89 | Ga0157371_11544998 | 3300013102 | Bacteria | 518 |
| 90 | Ga0157370_10006095 | 3300013104 | Bacteria | 13381 |
| 91 | Ga0157370_10728254 | 3300013104 | Bacteria | 904 |
| 92 | Ga0157369_10024449 | 3300013105 | Bacteria | 6719 |
| 93 | Ga0157369_10123972 | 3300013105 | Bacteria | 2741 |
| 94 | Ga0163162_10003751 | 3300013306 | Bacteria | 14561 |
| 95 | Ga0163162_10196076 | 3300013306 | Bacteria | 2148 |
| 96 | Ga0157372_10019894 | 3300013307 | Bacteria | 7236 |
| 97 | Ga0157372_10529565 | 3300013307 | Bacteria | 1374 |
| 98 | Ga0157372_10665964 | 3300013307 | Bacteria | 1212 |
| 99 | Ga0157372_12298143 | 3300013307 | Bacteria | 619 |
| 100 | Ga0157375_13200316 | 3300013308 | Bacteria | 546 |
| 101 | Ga0182008_10371988 | 3300014497 | Bacteria | 762 |
| 102 | Ga0157376_11571181 | 3300014969 | Bacteria | 692 |
| 103 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 104 | Ga0163161_10470504 | 3300017792 | Bacteria | 1019 |
| 105 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 106 | Ga0209455_1007538 | 3300025272 | Bacteria | 3061 |
| 107 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 108 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 109 | Ga0207696_1006076 | 3300025711 | Bacteria | 4918 |
| 110 | Ga0207680_10016975 | 3300025903 | Bacteria | 3836 |
| 111 | Ga0207647_10409208 | 3300025904 | Bacteria | 763 |
| 112 | Ga0207705_10013877 | 3300025909 | Bacteria | 5808 |
| 113 | Ga0207707_10013599 | 3300025912 | Bacteria | 7096 |
| 114 | Ga0207657_10000130 | 3300025919 | Bacteria | 75710 |
| 115 | Ga0207649_10001538 | 3300025920 | Bacteria | 13543 |
| 116 | Ga0207652_10150004 | 3300025921 | Bacteria | 2087 |
| 117 | Ga0207681_10093625 | 3300025923 | Bacteria | 2151 |
| 118 | Ga0207694_10011250 | 3300025924 | Bacteria | 6759 |
| 119 | Ga0207650_10114526 | 3300025925 | Bacteria | 2092 |
| 120 | Ga0207659_10271299 | 3300025926 | Bacteria | 1384 |
| 121 | Ga0207687_10002787 | 3300025927 | Bacteria | 11852 |
| 122 | Ga0207644_10014015 | 3300025931 | Bacteria | 5358 |
| 123 | Ga0207690_10001968 | 3300025932 | Bacteria | 12597 |
| 124 | Ga0207706_10000798 | 3300025933 | Bacteria | 32625 |
| 125 | Ga0207706_10016756 | 3300025933 | Bacteria | 6615 |
| 126 | Ga0207686_10107803 | 3300025934 | Bacteria | 1873 |
| 127 | Ga0207709_10075921 | 3300025935 | Bacteria | 2149 |
| 128 | Ga0207669_11126804 | 3300025937 | Bacteria | 663 |
| 129 | Ga0207711_10003155 | 3300025941 | Bacteria | 14370 |
| 130 | Ga0207689_10658975 | 3300025942 | Bacteria | 882 |
| 131 | Ga0207661_10020542 | 3300025944 | Bacteria | 4938 |
| 132 | Ga0207661_10047227 | 3300025944 | Bacteria | 3417 |
| 133 | Ga0207667_10028275 | 3300025949 | Bacteria | 6091 |
| 134 | Ga0207667_10028384 | 3300025949 | Bacteria | 6079 |
| 135 | Ga0207667_10856239 | 3300025949 | Bacteria | 903 |
| 136 | Ga0207712_10085190 | 3300025961 | Bacteria | 2311 |
| 137 | Ga0207712_10682285 | 3300025961 | Bacteria | 895 |
| 138 | Ga0207668_10000488 | 3300025972 | Bacteria | 24888 |
| 139 | Ga0207668_10074466 | 3300025972 | Bacteria | 2437 |
| 140 | Ga0207668_11692283 | 3300025972 | Bacteria | 571 |
| 141 | Ga0207640_10008754 | 3300025981 | Bacteria | 5632 |
| 142 | Ga0207640_10026300 | 3300025981 | Bacteria | 3531 |
| 143 | Ga0207640_10103600 | 3300025981 | Bacteria | 2001 |
| 144 | Ga0207658_10000023 | 3300025986 | Bacteria | 190806 |
| 145 | Ga0207658_10000333 | 3300025986 | Bacteria | 47363 |
| 146 | Ga0207658_10784487 | 3300025986 | Bacteria | 864 |
| 147 | Ga0207703_10000167 | 3300026035 | Bacteria | 76517 |
| 148 | Ga0207703_10000272 | 3300026035 | Bacteria | 57191 |
| 149 | Ga0207703_11844036 | 3300026035 | Bacteria | 581 |
| 150 | Ga0207639_10004916 | 3300026041 | Bacteria | 9005 |
| 151 | Ga0207641_10000119 | 3300026088 | Bacteria | 117312 |
| 152 | Ga0207641_12067989 | 3300026088 | Bacteria | 570 |
| 153 | Ga0207648_10194065 | 3300026089 | Bacteria | 1800 |
| 154 | Ga0207648_10678957 | 3300026089 | Bacteria | 953 |
| 155 | Ga0207676_10000217 | 3300026095 | Bacteria | 49723 |
| 156 | Ga0207674_10020877 | 3300026116 | Bacteria | 7067 |
| 157 | Ga0207674_10139359 | 3300026116 | Bacteria | 2386 |
| 158 | Ga0207675_100326035 | 3300026118 | Bacteria | 1500 |
| 159 | Ga0207675_100475680 | 3300026118 | Bacteria | 1241 |
| 160 | Ga0207698_11299875 | 3300026142 | Bacteria | 742 |
| 161 | Ga0268266_10004966 | 3300028379 | Bacteria | 12588 |
| 162 | Ga0268265_10222639 | 3300028380 | Bacteria | 1652 |
| 163 | Ga0268265_10332901 | 3300028380 | Bacteria | 1379 |
| 164 | Ga0268264_10023423 | 3300028381 | Bacteria | 5037 |
| 165 | Ga0268264_10073102 | 3300028381 | Bacteria | 2909 |
| 166 | Ga0307515_10241063 | 3300028794 | Bacteria | 1579 |
| 167 | Ga0307513_10223195 | 3300031456 | Bacteria | 1703 |
| 168 | Ga0307509_10263910 | 3300031507 | Bacteria | 1495 |
| 169 | Ga0307408_100048709 | 3300031548 | Bacteria | 3040 |
| 170 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 171 | Ga0307405_11159093 | 3300031731 | Bacteria | 667 |
| 172 | Ga0307413_10254929 | 3300031824 | Bacteria | 1304 |
| 173 | Ga0307406_10469635 | 3300031901 | Bacteria | 1013 |
| 174 | Ga0307406_10904449 | 3300031901 | Bacteria | 752 |
| 175 | Ga0307406_11605323 | 3300031901 | Bacteria | 575 |
| 176 | Ga0307407_10014045 | 3300031903 | Bacteria | 3907 |
| 177 | Ga0307412_10195569 | 3300031911 | Bacteria | 1532 |
| 178 | Ga0307412_11089572 | 3300031911 | Bacteria | 710 |
| 179 | Ga0307409_100004709 | 3300031995 | Bacteria | 7725 |
| 180 | Ga0307416_100030972 | 3300032002 | Bacteria | 4021 |
| 181 | Ga0307416_100529485 | 3300032002 | Bacteria | 1248 |
| 182 | Ga0307414_10120465 | 3300032004 | Bacteria | 2016 |
| 183 | Ga0307414_10309823 | 3300032004 | Bacteria | 1339 |
| 184 | Ga0307414_10367085 | 3300032004 | Bacteria | 1240 |
| 185 | Ga0307414_11456041 | 3300032004 | Bacteria | 637 |
| 186 | Ga0307411_10013646 | 3300032005 | Bacteria | 4491 |
| 187 | Ga0307411_10492263 | 3300032005 | Bacteria | 1035 |
| 188 | Ga0307411_10611649 | 3300032005 | Bacteria | 938 |
| 189 | Ga0307411_10729068 | 3300032005 | Bacteria | 866 |
| 190 | Ga0307415_100467356 | 3300032126 | Bacteria | 1095 |
| 191 | Ga0307415_101118196 | 3300032126 | Bacteria | 738 |
| 192 | Ga0307510_10005649 | 3300033180 | Bacteria | 14912 |
| 193 | Ga0436363_1579915 | 3300039450 | Bacteria | 946 |
| 194 | Ga0439436_0009383 | 3300041404 | Bacteria | 3000 |
| 195 | Ga0439439_0253810 | 3300041406 | Bacteria | 522 |
| 196 | Ga0439461_0004181 | 3300041410 | Bacteria | 2399 |
| 197 | Ga0439465_0001862 | 3300041413 | Bacteria | 6895 |
| 198 | Ga0439465_0007735 | 3300041413 | Bacteria | 3409 |
| 199 | Ga0451791_0018520 | 3300041451 | Bacteria | 535 |
| 200 | Ga0451793_0614447 | 3300041452 | Bacteria | 602 |
| 201 | Ga0451795_0782315 | 3300041456 | Bacteria | 814 |
| 202 | Ga0451833_1196429 | 3300041491 | Bacteria | 567 |
| 203 | Ga0439431_0000969 | 3300041997 | Bacteria | 6222 |
| 204 | Ga0439442_005444 | 3300042002 | Bacteria | 2545 |
| 205 | Ga0439445_0005431 | 3300042004 | Bacteria | 2904 |
| 206 | Ga0439432_004300 | 3300042006 | Bacteria | 5206 |
| 207 | Ga0439452_086584 | 3300042010 | Bacteria | 679 |
| 208 | Ga0439457_033499 | 3300042014 | Bacteria | 1140 |
| 209 | Ga0439462_0000159 | 3300042015 | Bacteria | 11155 |
| 210 | Ga0439462_0002064 | 3300042015 | Bacteria | 4611 |
| 211 | Ga0450923_149500 | 3300042125 | Bacteria | 565 |
| 212 | Ga0439446_0016630 | 3300042156 | Bacteria | 2050 |
| 213 | Ga0450909_004465 | 3300042185 | Bacteria | 1996 |
| 214 | Ga0439434_0002003 | 3300042435 | Bacteria | 5891 |
| 215 | Ga0439434_0138384 | 3300042435 | Bacteria | 801 |
| 216 | Ga0453684_1122667 | 3300044712 | Bacteria | 829 |
| 217 | Ga0451576_0189266 | 3300045051 | Bacteria | 2149 |
| 218 | Ga0495638_0000400 | 3300046460 | Bacteria | 53251 |
| 219 | Ga0495638_0041087 | 3300046460 | Bacteria | 2928 |
| 220 | Ga0495638_0215639 | 3300046460 | Bacteria | 1076 |
| 221 | Ga0495650_0000453 | 3300046471 | Bacteria | 64790 |
| 222 | Ga0495585_0017577 | 3300046492 | Bacteria | 4131 |
| 223 | Ga0495607_0001504 | 3300046501 | Bacteria | 20566 |
| 224 | Ga0495583_0000443 | 3300046506 | Bacteria | 62113 |
| 225 | Ga0495583_0261243 | 3300046506 | Bacteria | 692 |
| 226 | Ga0495632_0000220 | 3300046519 | Bacteria | 58010 |
| 227 | Ga0495648_0000020 | 3300046524 | Bacteria | 254330 |
| 228 | Ga0495648_0020313 | 3300046524 | Bacteria | 4635 |
| 229 | Ga0495648_0038081 | 3300046524 | Bacteria | 3082 |
| 230 | Ga0495648_0042338 | 3300046524 | Bacteria | 2866 |
| 231 | Ga0495648_0223186 | 3300046524 | Bacteria | 928 |
| 232 | Ga0495663_0046702 | 3300046525 | Bacteria | 1331 |
| 233 | Ga0495642_0107519 | 3300046528 | Bacteria | 1191 |
| 234 | Ga0495598_0001142 | 3300046537 | Bacteria | 5104 |
| 235 | Ga0495598_0021331 | 3300046537 | Bacteria | 1722 |
| 236 | Ga0495597_0094747 | 3300046542 | Bacteria | 1264 |
| 237 | Ga0495622_0004975 | 3300046557 | Bacteria | 6155 |
| 238 | Ga0495633_0014541 | 3300046558 | Bacteria | 4110 |
| 239 | Ga0495668_0196031 | 3300046616 | Bacteria | 1106 |
| 240 | Ga0495668_0281355 | 3300046616 | Bacteria | 911 |
| 241 | Ga0495611_0117637 | 3300046648 | Bacteria | 1239 |
| 242 | Ga0495625_0000397 | 3300046660 | Bacteria | 66539 |
| 243 | Ga0495625_0007444 | 3300046660 | Bacteria | 9520 |
| 244 | Ga0495625_0146022 | 3300046660 | Bacteria | 1593 |
| 245 | Ga0495625_0167729 | 3300046660 | Bacteria | 1467 |
| 246 | Ga0495625_0197485 | 3300046660 | Bacteria | 1330 |
| 247 | Ga0495670_0000029 | 3300046691 | Bacteria | 87662 |
| 248 | Ga0495670_0139215 | 3300046691 | Bacteria | 1268 |
| 249 | Ga0495670_0600953 | 3300046691 | Bacteria | 599 |
| 250 | Ga0495671_0000022 | 3300046692 | Bacteria | 255591 |
| 251 | Ga0495671_0010759 | 3300046692 | Bacteria | 5058 |
| 252 | Ga0495673_0000051 | 3300047469 | Bacteria | 255511 |
| 253 | Ga0495686_0013775 | 3300047472 | Bacteria | 5602 |
| 254 | Ga0495686_0394361 | 3300047472 | Bacteria | 744 |
| 255 | Ga0495615_0003130 | 3300048090 | Bacteria | 2743 |
| 256 | Ga0496100_0003320 | 3300048903 | Bacteria | 8376 |
| 257 | Ga0496101_0061732 | 3300048904 | Bacteria | 2722 |
| 258 | Ga0496102_0000648 | 3300048905 | Bacteria | 35117 |
| 259 | Ga0496103_0000110 | 3300048906 | Bacteria | 90202 |
| 260 | Ga0496104_0000047 | 3300048907 | Bacteria | 148896 |
| 261 | Ga0496105_0000081 | 3300048908 | Bacteria | 70237 |
| 262 | Ga0496106_0659494 | 3300048909 | Bacteria | 836 |
| 263 | Ga0496107_0152331 | 3300048910 | Bacteria | 1711 |
| 264 | Ga0496113_0000020 | 3300048916 | Bacteria | 70677 |
| 265 | Ga0496114_0065207 | 3300048917 | Bacteria | 3051 |
| 266 | Ga0496115_0965242 | 3300048918 | Bacteria | 653 |
| 267 | Ga0496115_1064961 | 3300048918 | Bacteria | 615 |
| 268 | Ga0496117_0018664 | 3300048920 | Bacteria | 5733 |
| 269 | Ga0496118_0098204 | 3300048921 | Bacteria | 1989 |
| 270 | Ga0496119_0000699 | 3300048922 | Bacteria | 44963 |
| 271 | Ga0496120_0001199 | 3300048923 | Bacteria | 32884 |
| 272 | Ga0496121_0000652 | 3300048924 | Bacteria | 64960 |
| 273 | Ga0496121_0005579 | 3300048924 | Bacteria | 16069 |
| 274 | Ga0496121_0077424 | 3300048924 | Bacteria | 2648 |
| 275 | Ga0496122_0001260 | 3300048925 | Bacteria | 42389 |
| 276 | Ga0496122_0479289 | 3300048925 | Bacteria | 610 |
| 277 | Ga0496123_0000362 | 3300048926 | Bacteria | 85587 |
| 278 | Ga0496124_0005477 | 3300048927 | Bacteria | 14255 |
| 279 | Ga0496125_0000555 | 3300048928 | Bacteria | 64263 |
| 280 | Ga0496125_0020285 | 3300048928 | Bacteria | 6240 |
| 281 | Ga0496125_0036826 | 3300048928 | Bacteria | 4263 |
| 282 | Ga0496126_0001290 | 3300048929 | Bacteria | 40086 |
| 283 | Ga0496126_0031610 | 3300048929 | Bacteria | 4997 |
| 284 | Ga0495678_011239 | 3300049459 | Bacteria | 4297 |
| 285 | Ga0501033_0338536 | 3300049570 | Bacteria | 1055 |
| 286 | Ga0501046_0495704 | 3300049580 | Bacteria | 875 |
| 287 | Ga0501225_0003832 | 3300049705 | Bacteria | 4518 |
| 288 | Ga0501083_0728833 | 3300049744 | Bacteria | 645 |
| 289 | Ga0501241_002688 | 3300049758 | Bacteria | 3420 |
| 290 | Ga0501044_0061931 | 3300049823 | Bacteria | 3827 |
| 291 | nmdc:mga03683_36040_c1 | 3300050489 | Bacteria | 2010 |
| 292 | nmdc:mga0k408_241684_c1 | 3300050493 | Bacteria | 1078 |
| 293 | nmdc:mga07m45_46999_c1 | 3300050496 | Bacteria | 2425 |
| 294 | Ga0500643_000611 | 3300053087 | Bacteria | 24350 |
| 295 | Ga0500643_003544 | 3300053087 | Bacteria | 7435 |
| 296 | Ga0500643_014490 | 3300053087 | Bacteria | 2738 |
| 297 | Ga0500643_021218 | 3300053087 | Bacteria | 2108 |
| 298 | Ga0500643_025464 | 3300053087 | Bacteria | 1865 |
| 299 | Ga0500641_0372989 | 3300053096 | Bacteria | 568 |
| 300 | Ga0500556_0000053 | 3300053104 | Bacteria | 117389 |
| 301 | Ga0500557_152353 | 3300053105 | Bacteria | 760 |
| 302 | Ga0500594_0307658 | 3300053118 | Bacteria | 531 |
| 303 | Ga0500595_037876 | 3300053119 | Bacteria | 1570 |
| 304 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 305 | Ga0500658_0000319 | 3300053134 | Bacteria | 21255 |
| 306 | Ga0500658_0031568 | 3300053134 | Bacteria | 2072 |
| 307 | Ga0500559_0009884 | 3300053136 | Bacteria | 4113 |
| 308 | Ga0500559_0142708 | 3300053136 | Bacteria | 1122 |
| 309 | Ga0500559_0230349 | 3300053136 | Bacteria | 873 |
| 310 | Ga0500568_0014103 | 3300053139 | Bacteria | 3621 |
| 311 | Ga0500568_0288641 | 3300053139 | Unclassified | 596 |
| 312 | Ga0500573_0000417 | 3300053140 | Bacteria | 18184 |
| 313 | Ga0500573_0048942 | 3300053140 | Bacteria | 2433 |
| 314 | Ga0500604_0031332 | 3300053151 | Bacteria | 1560 |
| 315 | Ga0500645_000784 | 3300053730 | Bacteria | 19194 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032004 | Ga0307414_10309823 | Ga0307414_103098233 | 122 |
| 2 | 3300025949 | Ga0207667_10856239 | Ga0207667_108562392 | 124 |
| 3 | 3300031901 | Ga0307406_11605323 | Ga0307406_116053231 | 126 |
| 4 | 3300046537 | Ga0495598_0021331 | Ga0495598_0021331_672_1052 | 126 |
| 5 | 3300046691 | Ga0495670_0600953 | Ga0495670_0600953_182_562 | 126 |
| 6 | 3300048090 | Ga0495615_0003130 | Ga0495615_0003130_734_1114 | 126 |
| 7 | iso_pu_bacteria | 2643221622 | 2644125261 | 126 |
| 8 | iso_pu_bacteria | 2928027323 | 2928030239 | 126 |
| 9 | iso_pu_bacteria | 2946787523 | 2946790915 | 126 |
| 10 | iso_pu_bacteria | 2984555340 | 2984556901 | 126 |
| 11 | iso_pu_bacteria | 2984564862 | 2984568794 | 126 |
| 12 | iso_pu_bacteria | 2993356040 | 2993359783 | 126 |
| 13 | 3300005329 | Ga0070683_100071518 | Ga0070683_1000715182 | 127 |
| 14 | 3300005336 | Ga0070680_100001754 | Ga0070680_1000017546 | 127 |
| 15 | 3300005337 | Ga0070682_100035454 | Ga0070682_1000354542 | 127 |
| 16 | 3300005339 | Ga0070660_100784263 | Ga0070660_1007842631 | 127 |
| 17 | 3300005341 | Ga0070691_10239244 | Ga0070691_102392442 | 127 |
| 18 | 3300005344 | Ga0070661_100008812 | Ga0070661_1000088122 | 127 |
| 19 | 3300005345 | Ga0070692_10244462 | Ga0070692_102444622 | 127 |
| 20 | 3300005457 | Ga0070662_100000900 | Ga0070662_1000009008 | 127 |
| 21 | 3300005530 | Ga0070679_100014086 | Ga0070679_1000140867 | 127 |
| 22 | 3300005539 | Ga0068853_100032690 | Ga0068853_1000326903 | 127 |
| 23 | 3300005563 | Ga0068855_100017830 | Ga0068855_1000178303 | 127 |
| 24 | 3300005564 | Ga0070664_100017361 | Ga0070664_1000173614 | 127 |
| 25 | 3300005577 | Ga0068857_100077634 | Ga0068857_1000776342 | 127 |
| 26 | 3300005578 | Ga0068854_100046494 | Ga0068854_1000464942 | 127 |
| 27 | 3300005614 | Ga0068856_100010625 | Ga0068856_1000106254 | 127 |
| 28 | 3300009174 | Ga0105241_10036289 | Ga0105241_100362893 | 127 |
| 29 | 3300013100 | Ga0157373_10001931 | Ga0157373_100019313 | 127 |
| 30 | 3300013102 | Ga0157371_10002579 | Ga0157371_100025794 | 127 |
| 31 | 3300013104 | Ga0157370_10006095 | Ga0157370_100060952 | 127 |
| 32 | 3300013105 | Ga0157369_10024449 | Ga0157369_100244494 | 127 |
| 33 | 3300013307 | Ga0157372_10019894 | Ga0157372_100198946 | 127 |
| 34 | 3300013308 | Ga0157375_13200316 | Ga0157375_132003162 | 127 |
| 35 | 3300025904 | Ga0207647_10409208 | Ga0207647_104092082 | 127 |
| 36 | 3300025909 | Ga0207705_10013877 | Ga0207705_100138774 | 127 |
| 37 | 3300025912 | Ga0207707_10013599 | Ga0207707_100135993 | 127 |
| 38 | 3300025919 | Ga0207657_10000130 | Ga0207657_1000013062 | 127 |
| 39 | 3300025920 | Ga0207649_10001538 | Ga0207649_100015389 | 127 |
| 40 | 3300025921 | Ga0207652_10150004 | Ga0207652_101500042 | 127 |
| 41 | 3300025932 | Ga0207690_10001968 | Ga0207690_100019688 | 127 |
| 42 | 3300025933 | Ga0207706_10000798 | Ga0207706_1000079823 | 127 |
| 43 | 3300025944 | Ga0207661_10020542 | Ga0207661_100205422 | 127 |
| 44 | 3300025944 | Ga0207661_10047227 | Ga0207661_100472273 | 127 |
| 45 | 3300025949 | Ga0207667_10028275 | Ga0207667_100282753 | 127 |
| 46 | 3300025981 | Ga0207640_10026300 | Ga0207640_100263003 | 127 |
| 47 | 3300026041 | Ga0207639_10004916 | Ga0207639_100049166 | 127 |
| 48 | 3300026116 | Ga0207674_10020877 | Ga0207674_100208774 | 127 |
| 49 | 3300026142 | Ga0207698_11299875 | Ga0207698_112998752 | 127 |
| 50 | 3300003214 | JGI25165J46597_1000385 | JGI25165J46597_100038513 | 128 |
| 51 | 3300005334 | Ga0068869_100675153 | Ga0068869_1006751532 | 128 |
| 52 | 3300006881 | Ga0068865_100890729 | Ga0068865_1008907292 | 128 |
| 53 | 3300009098 | Ga0105245_10005284 | Ga0105245_100052843 | 128 |
| 54 | 3300009176 | Ga0105242_10193468 | Ga0105242_101934683 | 128 |
| 55 | 3300009545 | Ga0105237_12714220 | Ga0105237_127142201 | 128 |
| 56 | 3300009551 | Ga0105238_10043816 | Ga0105238_100438162 | 128 |
| 57 | 3300025261 | Ga0209233_1000044 | Ga0209233_100004413 | 128 |
| 58 | 3300025272 | Ga0209455_1007538 | Ga0209455_10075382 | 128 |
| 59 | 3300025924 | Ga0207694_10011250 | Ga0207694_100112502 | 128 |
| 60 | 3300025927 | Ga0207687_10002787 | Ga0207687_100027874 | 128 |
| 61 | 3300025934 | Ga0207686_10107803 | Ga0207686_101078032 | 128 |
| 62 | 3300025942 | Ga0207689_10658975 | Ga0207689_106589752 | 128 |
| 63 | 3300053136 | Ga0500559_0009884 | Ga0500559_0009884_2464_2850 | 128 |
| 64 | iso_pu_bacteria | 2818991466 | 2819715248 | 128 |
| 65 | iso_pu_bacteria | 2885429604 | 2885432035 | 128 |
| 66 | iso_pu_bacteria | 2928968154 | 2928971484 | 128 |
| 67 | 3300005288 | Ga0065714_10461713 | Ga0065714_104617131 | 129 |
| 68 | 3300005328 | Ga0070676_11370430 | Ga0070676_113704301 | 129 |
| 69 | 3300005459 | Ga0068867_100340950 | Ga0068867_1003409502 | 129 |
| 70 | 3300005563 | Ga0068855_102226576 | Ga0068855_1022265761 | 129 |
| 71 | 3300005617 | Ga0068859_102169319 | Ga0068859_1021693192 | 129 |
| 72 | 3300005719 | Ga0068861_100339511 | Ga0068861_1003395112 | 129 |
| 73 | 3300005840 | Ga0068870_10821514 | Ga0068870_108215142 | 129 |
| 74 | 3300006931 | Ga0097620_102169136 | Ga0097620_1021691362 | 129 |
| 75 | 3300009093 | Ga0105240_11604745 | Ga0105240_116047451 | 129 |
| 76 | 3300014969 | Ga0157376_11571181 | Ga0157376_115711811 | 129 |
| 77 | 3300026089 | Ga0207648_10194065 | Ga0207648_101940652 | 129 |
| 78 | 3300026118 | Ga0207675_100475680 | Ga0207675_1004756802 | 129 |
| 79 | 3300031507 | Ga0307509_10263910 | Ga0307509_102639102 | 129 |
| 80 | 3300031616 | Ga0307508_10000011 | Ga0307508_10000011222 | 129 |
| 81 | 3300041451 | Ga0451791_0018520 | Ga0451791_0018520_47_436 | 129 |
| 82 | 3300041452 | Ga0451793_0614447 | Ga0451793_0614447_19_408 | 129 |
| 83 | 3300041456 | Ga0451795_0782315 | Ga0451795_0782315_152_541 | 129 |
| 84 | 3300041491 | Ga0451833_1196429 | Ga0451833_1196429_30_419 | 129 |
| 85 | 3300046460 | Ga0495638_0000400 | Ga0495638_0000400_28398_28787 | 129 |
| 86 | 3300046492 | Ga0495585_0017577 | Ga0495585_0017577_334_723 | 129 |
| 87 | 3300046525 | Ga0495663_0046702 | Ga0495663_0046702_314_703 | 129 |
| 88 | 3300046542 | Ga0495597_0094747 | Ga0495597_0094747_376_765 | 129 |
| 89 | 3300046660 | Ga0495625_0000397 | Ga0495625_0000397_43430_43819 | 129 |
| 90 | 3300046660 | Ga0495625_0167729 | Ga0495625_0167729_295_684 | 129 |
| 91 | 3300048918 | Ga0496115_1064961 | Ga0496115_1064961_46_435 | 129 |
| 92 | 3300048924 | Ga0496121_0077424 | Ga0496121_0077424_821_1210 | 129 |
| 93 | 3300049823 | Ga0501044_0061931 | Ga0501044_0061931_2968_3360 | 129 |
| 94 | 3300053119 | Ga0500595_037876 | Ga0500595_037876_433_822 | 129 |
| 95 | 3300053136 | Ga0500559_0230349 | Ga0500559_0230349_226_615 | 129 |
| 96 | iso_pu_bacteria | 2643221588 | 2643951335 | 129 |
| 97 | iso_pu_bacteria | 2848297114 | 2848299602 | 129 |
| 98 | iso_pu_bacteria | 2919138771 | 2919139117 | 129 |
| 99 | 3300001989 | JGI24739J22299_10009476 | JGI24739J22299_100094762 | 130 |
| 100 | 3300003791 | Ga0055530_10000202 | Ga0055530_1000020235 | 130 |
| 101 | 3300003794 | Ga0055531_10000090 | Ga0055531_1000009046 | 130 |
| 102 | 3300005353 | Ga0070669_100275391 | Ga0070669_1002753912 | 130 |
| 103 | 3300005356 | Ga0070674_101359482 | Ga0070674_1013594822 | 130 |
| 104 | 3300005548 | Ga0070665_101708119 | Ga0070665_1017081192 | 130 |
| 105 | 3300005719 | Ga0068861_101798317 | Ga0068861_1017983171 | 130 |
| 106 | 3300005842 | Ga0068858_100038425 | Ga0068858_1000384254 | 130 |
| 107 | 3300009177 | Ga0105248_10027683 | Ga0105248_100276835 | 130 |
| 108 | 3300009553 | Ga0105249_10160640 | Ga0105249_101606402 | 130 |
| 109 | 3300013306 | Ga0163162_10003751 | Ga0163162_100037517 | 130 |
| 110 | 3300013306 | Ga0163162_10196076 | Ga0163162_101960762 | 130 |
| 111 | 3300017792 | Ga0163161_10470504 | Ga0163161_104705042 | 130 |
| 112 | 3300025298 | Ga0209050_1000051 | Ga0209050_1000051193 | 130 |
| 113 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028175 | 130 |
| 114 | 3300025937 | Ga0207669_11126804 | Ga0207669_111268042 | 130 |
| 115 | 3300025941 | Ga0207711_10003155 | Ga0207711_100031552 | 130 |
| 116 | 3300025961 | Ga0207712_10085190 | Ga0207712_100851901 | 130 |
| 117 | 3300025986 | Ga0207658_10784487 | Ga0207658_107844871 | 130 |
| 118 | 3300026035 | Ga0207703_10000272 | Ga0207703_100002721 | 130 |
| 119 | 3300026089 | Ga0207648_10678957 | Ga0207648_106789572 | 130 |
| 120 | 3300026095 | Ga0207676_10000217 | Ga0207676_1000021718 | 130 |
| 121 | 3300026118 | Ga0207675_100326035 | Ga0207675_1003260352 | 130 |
| 122 | 3300031731 | Ga0307405_11159093 | Ga0307405_111590931 | 130 |
| 123 | 3300039450 | Ga0436363_1579915 | Ga0436363_1579915_62_454 | 130 |
| 124 | 3300041404 | Ga0439436_0009383 | Ga0439436_0009383_583_975 | 130 |
| 125 | 3300041406 | Ga0439439_0253810 | Ga0439439_0253810_101_493 | 130 |
| 126 | 3300041410 | Ga0439461_0004181 | Ga0439461_0004181_522_914 | 130 |
| 127 | 3300041413 | Ga0439465_0001862 | Ga0439465_0001862_5977_6369 | 130 |
| 128 | 3300041413 | Ga0439465_0007735 | Ga0439465_0007735_2029_2421 | 130 |
| 129 | 3300041997 | Ga0439431_0000969 | Ga0439431_0000969_4115_4507 | 130 |
| 130 | 3300042002 | Ga0439442_005444 | Ga0439442_005444_664_1056 | 130 |
| 131 | 3300042004 | Ga0439445_0005431 | Ga0439445_0005431_1986_2378 | 130 |
| 132 | 3300042006 | Ga0439432_004300 | Ga0439432_004300_4281_4673 | 130 |
| 133 | 3300042010 | Ga0439452_086584 | Ga0439452_086584_210_602 | 130 |
| 134 | 3300042014 | Ga0439457_033499 | Ga0439457_033499_682_1074 | 130 |
| 135 | 3300042015 | Ga0439462_0000159 | Ga0439462_0000159_1430_1822 | 130 |
| 136 | 3300042015 | Ga0439462_0002064 | Ga0439462_0002064_3707_4099 | 130 |
| 137 | 3300042125 | Ga0450923_149500 | Ga0450923_149500_117_509 | 130 |
| 138 | 3300042156 | Ga0439446_0016630 | Ga0439446_0016630_829_1221 | 130 |
| 139 | 3300042185 | Ga0450909_004465 | Ga0450909_004465_687_1079 | 130 |
| 140 | 3300042435 | Ga0439434_0002003 | Ga0439434_0002003_1639_2031 | 130 |
| 141 | 3300042435 | Ga0439434_0138384 | Ga0439434_0138384_313_705 | 130 |
| 142 | 3300046460 | Ga0495638_0215639 | Ga0495638_0215639_662_1054 | 130 |
| 143 | 3300046501 | Ga0495607_0001504 | Ga0495607_0001504_2362_2754 | 130 |
| 144 | 3300046506 | Ga0495583_0261243 | Ga0495583_0261243_149_541 | 130 |
| 145 | 3300046524 | Ga0495648_0038081 | Ga0495648_0038081_12_404 | 130 |
| 146 | 3300046524 | Ga0495648_0042338 | Ga0495648_0042338_2059_2451 | 130 |
| 147 | 3300046528 | Ga0495642_0107519 | Ga0495642_0107519_681_1073 | 130 |
| 148 | 3300046616 | Ga0495668_0196031 | Ga0495668_0196031_418_810 | 130 |
| 149 | 3300046616 | Ga0495668_0281355 | Ga0495668_0281355_441_833 | 130 |
| 150 | 3300046660 | Ga0495625_0007444 | Ga0495625_0007444_4946_5338 | 130 |
| 151 | 3300046660 | Ga0495625_0146022 | Ga0495625_0146022_742_1134 | 130 |
| 152 | 3300046660 | Ga0495625_0197485 | Ga0495625_0197485_212_604 | 130 |
| 153 | 3300046691 | Ga0495670_0000029 | Ga0495670_0000029_19364_19756 | 130 |
| 154 | 3300047472 | Ga0495686_0394361 | Ga0495686_0394361_74_511 | 130 |
| 155 | 3300048929 | Ga0496126_0031610 | Ga0496126_0031610_2362_2754 | 130 |
| 156 | 3300049580 | Ga0501046_0495704 | Ga0501046_0495704_300_692 | 130 |
| 157 | 3300049758 | Ga0501241_002688 | Ga0501241_002688_1698_2090 | 130 |
| 158 | 3300053087 | Ga0500643_003544 | Ga0500643_003544_819_1211 | 130 |
| 159 | 3300053087 | Ga0500643_021218 | Ga0500643_021218_576_968 | 130 |
| 160 | 3300053087 | Ga0500643_025464 | Ga0500643_025464_336_731 | 130 |
| 161 | 3300053134 | Ga0500658_0000319 | Ga0500658_0000319_1534_1926 | 130 |
| 162 | 3300053134 | Ga0500658_0031568 | Ga0500658_0031568_1339_1731 | 130 |
| 163 | 3300053136 | Ga0500559_0142708 | Ga0500559_0142708_605_997 | 130 |
| 164 | 3300053139 | Ga0500568_0014103 | Ga0500568_0014103_1383_1775 | 130 |
| 165 | 3300053140 | Ga0500573_0000417 | Ga0500573_0000417_11347_11739 | 130 |
| 166 | 3300053151 | Ga0500604_0031332 | Ga0500604_0031332_66_458 | 130 |
| 167 | 3300005331 | Ga0070670_100141446 | Ga0070670_1001414462 | 131 |
| 168 | 3300005335 | Ga0070666_10001699 | Ga0070666_100016992 | 131 |
| 169 | 3300005338 | Ga0068868_101097504 | Ga0068868_1010975041 | 131 |
| 170 | 3300005347 | Ga0070668_100000076 | Ga0070668_10000007644 | 131 |
| 171 | 3300005367 | Ga0070667_100000025 | Ga0070667_10000002595 | 131 |
| 172 | 3300005841 | Ga0068863_100000067 | Ga0068863_10000006794 | 131 |
| 173 | 3300005842 | Ga0068858_100000742 | Ga0068858_1000007427 | 131 |
| 174 | 3300005842 | Ga0068858_102242447 | Ga0068858_1022424471 | 131 |
| 175 | 3300005844 | Ga0068862_100734629 | Ga0068862_1007346291 | 131 |
| 176 | 3300009176 | Ga0105242_10608116 | Ga0105242_106081162 | 131 |
| 177 | 3300013102 | Ga0157371_10043316 | Ga0157371_100433163 | 131 |
| 178 | 3300013102 | Ga0157371_11544998 | Ga0157371_115449981 | 131 |
| 179 | 3300013307 | Ga0157372_10529565 | Ga0157372_105295652 | 131 |
| 180 | 3300013307 | Ga0157372_12298143 | Ga0157372_122981431 | 131 |
| 181 | 3300014497 | Ga0182008_10371988 | Ga0182008_103719882 | 131 |
| 182 | 3300015690 | Ga0183363_1003 | Ga0183363_1003200 | 131 |
| 183 | 3300025903 | Ga0207680_10016975 | Ga0207680_100169755 | 131 |
| 184 | 3300025925 | Ga0207650_10114526 | Ga0207650_101145263 | 131 |
| 185 | 3300025972 | Ga0207668_10000488 | Ga0207668_100004881 | 131 |
| 186 | 3300025986 | Ga0207658_10000023 | Ga0207658_1000002393 | 131 |
| 187 | 3300026035 | Ga0207703_10000167 | Ga0207703_100001672 | 131 |
| 188 | 3300026035 | Ga0207703_11844036 | Ga0207703_118440361 | 131 |
| 189 | 3300026088 | Ga0207641_10000119 | Ga0207641_1000011925 | 131 |
| 190 | 3300028380 | Ga0268265_10222639 | Ga0268265_102226393 | 131 |
| 191 | 3300028794 | Ga0307515_10241063 | Ga0307515_102410633 | 131 |
| 192 | 3300031456 | Ga0307513_10223195 | Ga0307513_102231952 | 131 |
| 193 | 3300031824 | Ga0307413_10254929 | Ga0307413_102549291 | 131 |
| 194 | 3300032004 | Ga0307414_10120465 | Ga0307414_101204653 | 131 |
| 195 | 3300032004 | Ga0307414_10367085 | Ga0307414_103670852 | 131 |
| 196 | 3300032005 | Ga0307411_10492263 | Ga0307411_104922633 | 131 |
| 197 | 3300032005 | Ga0307411_10729068 | Ga0307411_107290682 | 131 |
| 198 | 3300033180 | Ga0307510_10005649 | Ga0307510_100056493 | 131 |
| 199 | 3300046460 | Ga0495638_0041087 | Ga0495638_0041087_2033_2428 | 131 |
| 200 | 3300046471 | Ga0495650_0000453 | Ga0495650_0000453_56671_57066 | 131 |
| 201 | 3300046506 | Ga0495583_0000443 | Ga0495583_0000443_30577_30996 | 131 |
| 202 | 3300046519 | Ga0495632_0000220 | Ga0495632_0000220_30993_31418 | 131 |
| 203 | 3300046524 | Ga0495648_0000020 | Ga0495648_0000020_222593_223024 | 131 |
| 204 | 3300046524 | Ga0495648_0223186 | Ga0495648_0223186_148_543 | 131 |
| 205 | 3300046557 | Ga0495622_0004975 | Ga0495622_0004975_828_1223 | 131 |
| 206 | 3300046558 | Ga0495633_0014541 | Ga0495633_0014541_545_964 | 131 |
| 207 | 3300046648 | Ga0495611_0117637 | Ga0495611_0117637_471_866 | 131 |
| 208 | 3300046691 | Ga0495670_0139215 | Ga0495670_0139215_220_666 | 131 |
| 209 | 3300046692 | Ga0495671_0000022 | Ga0495671_0000022_223819_224238 | 131 |
| 210 | 3300046692 | Ga0495671_0010759 | Ga0495671_0010759_3674_4069 | 131 |
| 211 | 3300047469 | Ga0495673_0000051 | Ga0495673_0000051_31374_31793 | 131 |
| 212 | 3300049459 | Ga0495678_011239 | Ga0495678_011239_1295_1690 | 131 |
| 213 | 3300050489 | nmdc:mga03683_36040_c1 | nmdc:mga03683_36040_c1_958_1353 | 131 |
| 214 | 3300050493 | nmdc:mga0k408_241684_c1 | nmdc:mga0k408_241684_c1_610_1005 | 131 |
| 215 | 3300050496 | nmdc:mga07m45_46999_c1 | nmdc:mga07m45_46999_c1_839_1234 | 131 |
| 216 | 3300053087 | Ga0500643_000611 | Ga0500643_000611_17354_17749 | 131 |
| 217 | 3300053087 | Ga0500643_014490 | Ga0500643_014490_1089_1484 | 131 |
| 218 | 3300053096 | Ga0500641_0372989 | Ga0500641_0372989_19_414 | 131 |
| 219 | 3300053104 | Ga0500556_0000053 | Ga0500556_0000053_18356_18751 | 131 |
| 220 | 3300053105 | Ga0500557_152353 | Ga0500557_152353_70_465 | 131 |
| 221 | 3300053118 | Ga0500594_0307658 | Ga0500594_0307658_44_439 | 131 |
| 222 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_271197_271592 | 131 |
| 223 | 3300053139 | Ga0500568_0288641 | Ga0500568_0288641_24_419 | 131 |
| 224 | 3300053140 | Ga0500573_0048942 | Ga0500573_0048942_2008_2403 | 131 |
| 225 | 3300053730 | Ga0500645_000784 | Ga0500645_000784_47_442 | 131 |
| 226 | 3300005290 | Ga0065712_10201521 | Ga0065712_102015212 | 132 |
| 227 | 3300005353 | Ga0070669_100064229 | Ga0070669_1000642293 | 132 |
| 228 | 3300005471 | Ga0070698_100355326 | Ga0070698_1003553262 | 132 |
| 229 | 3300005578 | Ga0068854_100099474 | Ga0068854_1000994744 | 132 |
| 230 | 3300005985 | Ga0081539_10050777 | Ga0081539_100507772 | 132 |
| 231 | 3300025923 | Ga0207681_10093625 | Ga0207681_100936252 | 132 |
| 232 | 3300025981 | Ga0207640_10008754 | Ga0207640_100087544 | 132 |
| 233 | 3300028381 | Ga0268264_10023423 | Ga0268264_100234232 | 132 |
| 234 | 3300031548 | Ga0307408_100048709 | Ga0307408_1000487092 | 132 |
| 235 | 3300031901 | Ga0307406_10469635 | Ga0307406_104696352 | 132 |
| 236 | 3300031901 | Ga0307406_10904449 | Ga0307406_109044492 | 132 |
| 237 | 3300031903 | Ga0307407_10014045 | Ga0307407_100140452 | 132 |
| 238 | 3300031911 | Ga0307412_10195569 | Ga0307412_101955692 | 132 |
| 239 | 3300031911 | Ga0307412_11089572 | Ga0307412_110895722 | 132 |
| 240 | 3300031995 | Ga0307409_100004709 | Ga0307409_1000047092 | 132 |
| 241 | 3300032002 | Ga0307416_100030972 | Ga0307416_1000309723 | 132 |
| 242 | 3300032002 | Ga0307416_100529485 | Ga0307416_1005294852 | 132 |
| 243 | 3300032004 | Ga0307414_11456041 | Ga0307414_114560411 | 132 |
| 244 | 3300032005 | Ga0307411_10013646 | Ga0307411_100136464 | 132 |
| 245 | 3300032005 | Ga0307411_10611649 | Ga0307411_106116492 | 132 |
| 246 | 3300032126 | Ga0307415_100467356 | Ga0307415_1004673562 | 132 |
| 247 | 3300032126 | Ga0307415_101118196 | Ga0307415_1011181962 | 132 |
| 248 | 3300046537 | Ga0495598_0001142 | Ga0495598_0001142_1897_2295 | 132 |
| 249 | 3300047472 | Ga0495686_0013775 | Ga0495686_0013775_201_653 | 132 |
| 250 | 3300048924 | Ga0496121_0000652 | Ga0496121_0000652_28376_28780 | 132 |
| 251 | 3300048928 | Ga0496125_0020285 | Ga0496125_0020285_941_1339 | 132 |
| 252 | 3300049705 | Ga0501225_0003832 | Ga0501225_0003832_2190_2588 | 132 |
| 253 | 3300049744 | Ga0501083_0728833 | Ga0501083_0728833_132_551 | 132 |
| 254 | 2162886007 | SwRhRL2b_contig_2660858 | SwRhRL2b_0099.00007350 | 133 |
| 255 | 3300002074 | JGI24748J21848_1009458 | JGI24748J21848_10094582 | 133 |
| 256 | 3300005289 | Ga0065704_10070333 | Ga0065704_1007033328 | 133 |
| 257 | 3300005345 | Ga0070692_10838321 | Ga0070692_108383211 | 133 |
| 258 | 3300005347 | Ga0070668_100006926 | Ga0070668_1000069262 | 133 |
| 259 | 3300005353 | Ga0070669_100000143 | Ga0070669_10000014327 | 133 |
| 260 | 3300005354 | Ga0070675_100048909 | Ga0070675_1000489092 | 133 |
| 261 | 3300005355 | Ga0070671_100011449 | Ga0070671_1000114495 | 133 |
| 262 | 3300005366 | Ga0070659_100053183 | Ga0070659_1000531832 | 133 |
| 263 | 3300005366 | Ga0070659_100265623 | Ga0070659_1002656232 | 133 |
| 264 | 3300005367 | Ga0070667_100000210 | Ga0070667_10000021021 | 133 |
| 265 | 3300005457 | Ga0070662_100015259 | Ga0070662_1000152593 | 133 |
| 266 | 3300005535 | Ga0070684_100582024 | Ga0070684_1005820242 | 133 |
| 267 | 3300005548 | Ga0070665_100014128 | Ga0070665_1000141283 | 133 |
| 268 | 3300005563 | Ga0068855_100090167 | Ga0068855_1000901673 | 133 |
| 269 | 3300005563 | Ga0068855_100109011 | Ga0068855_1001090113 | 133 |
| 270 | 3300005564 | Ga0070664_100534771 | Ga0070664_1005347712 | 133 |
| 271 | 3300005577 | Ga0068857_100078397 | Ga0068857_1000783971 | 133 |
| 272 | 3300005616 | Ga0068852_100439346 | Ga0068852_1004393462 | 133 |
| 273 | 3300005841 | Ga0068863_100317674 | Ga0068863_1003176741 | 133 |
| 274 | 3300005843 | Ga0068860_100017251 | Ga0068860_1000172517 | 133 |
| 275 | 3300005844 | Ga0068862_100047194 | Ga0068862_1000471943 | 133 |
| 276 | 3300009092 | Ga0105250_10012000 | Ga0105250_100120002 | 133 |
| 277 | 3300009101 | Ga0105247_10110110 | Ga0105247_101101102 | 133 |
| 278 | 3300009553 | Ga0105249_11137194 | Ga0105249_111371941 | 133 |
| 279 | 3300010375 | Ga0105239_12200587 | Ga0105239_122005872 | 133 |
| 280 | 3300011119 | Ga0105246_10000083 | Ga0105246_1000008322 | 133 |
| 281 | 3300013102 | Ga0157371_10157688 | Ga0157371_101576882 | 133 |
| 282 | 3300013104 | Ga0157370_10728254 | Ga0157370_107282542 | 133 |
| 283 | 3300013105 | Ga0157369_10123972 | Ga0157369_101239721 | 133 |
| 284 | 3300013307 | Ga0157372_10665964 | Ga0157372_106659642 | 133 |
| 285 | 3300025711 | Ga0207696_1006076 | Ga0207696_10060763 | 133 |
| 286 | 3300025926 | Ga0207659_10271299 | Ga0207659_102712992 | 133 |
| 287 | 3300025931 | Ga0207644_10014015 | Ga0207644_100140152 | 133 |
| 288 | 3300025933 | Ga0207706_10016756 | Ga0207706_100167564 | 133 |
| 289 | 3300025935 | Ga0207709_10075921 | Ga0207709_100759212 | 133 |
| 290 | 3300025949 | Ga0207667_10028384 | Ga0207667_100283842 | 133 |
| 291 | 3300025961 | Ga0207712_10682285 | Ga0207712_106822852 | 133 |
| 292 | 3300025972 | Ga0207668_10074466 | Ga0207668_100744662 | 133 |
| 293 | 3300025972 | Ga0207668_11692283 | Ga0207668_116922832 | 133 |
| 294 | 3300025981 | Ga0207640_10103600 | Ga0207640_101036003 | 133 |
| 295 | 3300025986 | Ga0207658_10000333 | Ga0207658_1000033319 | 133 |
| 296 | 3300026088 | Ga0207641_12067989 | Ga0207641_120679891 | 133 |
| 297 | 3300026116 | Ga0207674_10139359 | Ga0207674_101393591 | 133 |
| 298 | 3300028379 | Ga0268266_10004966 | Ga0268266_100049664 | 133 |
| 299 | 3300028380 | Ga0268265_10332901 | Ga0268265_103329012 | 133 |
| 300 | 3300028381 | Ga0268264_10073102 | Ga0268264_100731021 | 133 |
| 301 | 3300044712 | Ga0453684_1122667 | Ga0453684_1122667_267_677 | 133 |
| 302 | 3300045051 | Ga0451576_0189266 | Ga0451576_0189266_81_491 | 133 |
| 303 | 3300046524 | Ga0495648_0020313 | Ga0495648_0020313_3047_3448 | 133 |
| 304 | 3300048903 | Ga0496100_0003320 | Ga0496100_0003320_5201_5602 | 133 |
| 305 | 3300048904 | Ga0496101_0061732 | Ga0496101_0061732_13_414 | 133 |
| 306 | 3300048905 | Ga0496102_0000648 | Ga0496102_0000648_34561_34962 | 133 |
| 307 | 3300048906 | Ga0496103_0000110 | Ga0496103_0000110_164_565 | 133 |
| 308 | 3300048907 | Ga0496104_0000047 | Ga0496104_0000047_89548_89949 | 133 |
| 309 | 3300048908 | Ga0496105_0000081 | Ga0496105_0000081_69687_70088 | 133 |
| 310 | 3300048909 | Ga0496106_0659494 | Ga0496106_0659494_129_530 | 133 |
| 311 | 3300048910 | Ga0496107_0152331 | Ga0496107_0152331_86_487 | 133 |
| 312 | 3300048916 | Ga0496113_0000020 | Ga0496113_0000020_2275_2676 | 133 |
| 313 | 3300048917 | Ga0496114_0065207 | Ga0496114_0065207_960_1364 | 133 |
| 314 | 3300048918 | Ga0496115_0965242 | Ga0496115_0965242_206_607 | 133 |
| 315 | 3300048920 | Ga0496117_0018664 | Ga0496117_0018664_5164_5565 | 133 |
| 316 | 3300048921 | Ga0496118_0098204 | Ga0496118_0098204_1544_1945 | 133 |
| 317 | 3300048922 | Ga0496119_0000699 | Ga0496119_0000699_21022_21423 | 133 |
| 318 | 3300048923 | Ga0496120_0001199 | Ga0496120_0001199_32325_32726 | 133 |
| 319 | 3300048924 | Ga0496121_0005579 | Ga0496121_0005579_1426_1827 | 133 |
| 320 | 3300048925 | Ga0496122_0001260 | Ga0496122_0001260_50_451 | 133 |
| 321 | 3300048925 | Ga0496122_0479289 | Ga0496122_0479289_71_472 | 133 |
| 322 | 3300048926 | Ga0496123_0000362 | Ga0496123_0000362_22762_23163 | 133 |
| 323 | 3300048927 | Ga0496124_0005477 | Ga0496124_0005477_6622_7023 | 133 |
| 324 | 3300048928 | Ga0496125_0000555 | Ga0496125_0000555_12960_13361 | 133 |
| 325 | 3300048928 | Ga0496125_0036826 | Ga0496125_0036826_3715_4116 | 133 |
| 326 | 3300048929 | Ga0496126_0001290 | Ga0496126_0001290_34424_34825 | 133 |
| 327 | 3300049570 | Ga0501033_0338536 | Ga0501033_0338536_228_632 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2egi-assembly1.cif.gz_H | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9261 | 5 | 111 |
| 2egi-assembly2.cif.gz_I | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9223 | 5 | 111 |
| 1psu-assembly1.cif.gz_A | structure of the e. coli paai protein from the phyenylacetic acid degradation operon | 0.9149 | 4 | 109 |
| 2egi-assembly1.cif.gz_H | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9082 | 5 | 111 |
| 5dio-assembly1.cif.gz_B-2 | crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant | 0.9019 | 5 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5eo2D01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9277 | 1 | 107 | 3.10.129.10 |
| 2egiH00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9261 | 5 | 111 | 3.10.129.10 |
| af_Q80ZW2_46_168_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9143 | 3 | 110 | 3.10.129.10 |
| 2egiH00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9082 | 5 | 111 | 3.10.129.10 |
| 5dioB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9019 | 5 | 128 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A143ZR24-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9931 | 4 | 130 |
GO:0003857
GO:0006635 GO:0070403 |
| AF-A0A0A7PPY5-F1-model_v4 | Thioesterase domain-containing protein | 0.9927 | 4 | 130 |
|
| AF-A0A842HYW3-F1-model_v4 | Acyl-CoA thioesterase | 0.9922 | 4 | 129 |
GO:0047617
|
| AF-A0A501XEG2-F1-model_v4 | Acyl-CoA thioesterase | 0.9919 | 4 | 130 |
|
| AF-A0A326GMI7-F1-model_v4 | Acyl-CoA thioesterase | 0.9916 | 3 | 129 |
GO:0047617
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar