F408857

General Info

Members Datasets Scaffolds Average Seq Length
327 231 315 131

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10309823|Ga0307414_103098233
Length 122
Sequence VNRFAKTFAAAPEHIDELGHVNNAVWLQWVQDIATAHWSAVADAVVTRHEIDYRGNVGLGETVTGETWIPNPPKGAQFDRCVEFRDAAGKRLVAVKSTWAMLDRASGRLVRIPADVAAPFLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
5 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
10 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
11 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
12 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
13 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 9.79
Nodule 0
Rhizoplane 4.59
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2660858 2162886007 Bacteria 9264
2 JGI24739J22299_10009476 3300001989 Bacteria 3629
3 JGI24748J21848_1009458 3300002074 Bacteria 1148
4 JGI25165J46597_1000385 3300003214 Bacteria 47716
5 Ga0055530_10000202 3300003791 Bacteria 53648
6 Ga0055531_10000090 3300003794 Bacteria 100342
7 Ga0065714_10461713 3300005288 Bacteria 546
8 Ga0065704_10070333 3300005289 Bacteria 31916
9 Ga0065712_10201521 3300005290 Bacteria 1102
10 Ga0070676_11370430 3300005328 Bacteria 542
11 Ga0070683_100071518 3300005329 Bacteria 3237
12 Ga0070670_100141446 3300005331 Bacteria 2081
13 Ga0068869_100675153 3300005334 Bacteria 879
14 Ga0070666_10001699 3300005335 Bacteria 13427
15 Ga0070680_100001754 3300005336 Bacteria 15933
16 Ga0070682_100035454 3300005337 Bacteria 3046
17 Ga0068868_101097504 3300005338 Bacteria 732
18 Ga0070660_100784263 3300005339 Bacteria 801
19 Ga0070691_10239244 3300005341 Bacteria 969
20 Ga0070661_100008812 3300005344 Bacteria 6982
21 Ga0070692_10244462 3300005345 Bacteria 1071
22 Ga0070692_10838321 3300005345 Bacteria 631
23 Ga0070668_100000076 3300005347 Bacteria 60771
24 Ga0070668_100006926 3300005347 Bacteria 8398
25 Ga0070669_100000143 3300005353 Bacteria 64072
26 Ga0070669_100064229 3300005353 Bacteria 2703
27 Ga0070669_100275391 3300005353 Bacteria 1347
28 Ga0070675_100048909 3300005354 Bacteria 3469
29 Ga0070671_100011449 3300005355 Bacteria 7131
30 Ga0070674_101359482 3300005356 Bacteria 635
31 Ga0070659_100053183 3300005366 Bacteria 3187
32 Ga0070659_100265623 3300005366 Bacteria 1424
33 Ga0070667_100000025 3300005367 Bacteria 190744
34 Ga0070667_100000210 3300005367 Bacteria 68040
35 Ga0070662_100000900 3300005457 Bacteria 18178
36 Ga0070662_100015259 3300005457 Bacteria 5143
37 Ga0068867_100340950 3300005459 Bacteria 1248
38 Ga0070698_100355326 3300005471 Bacteria 1397
39 Ga0070679_100014086 3300005530 Bacteria 7669
40 Ga0070684_100582024 3300005535 Bacteria 1040
41 Ga0068853_100032690 3300005539 Bacteria 4409
42 Ga0070665_100014128 3300005548 Bacteria 8023
43 Ga0070665_101708119 3300005548 Bacteria 637
44 Ga0068855_100017830 3300005563 Bacteria 8534
45 Ga0068855_100090167 3300005563 Bacteria 3539
46 Ga0068855_100109011 3300005563 Bacteria 3180
47 Ga0068855_102226576 3300005563 Bacteria 550
48 Ga0070664_100017361 3300005564 Bacteria 5909
49 Ga0070664_100534771 3300005564 Bacteria 1083
50 Ga0068857_100077634 3300005577 Bacteria 2963
51 Ga0068857_100078397 3300005577 Bacteria 2949
52 Ga0068854_100046494 3300005578 Bacteria 3090
53 Ga0068854_100099474 3300005578 Bacteria 2178
54 Ga0068856_100010625 3300005614 Bacteria 8946
55 Ga0068852_100439346 3300005616 Bacteria 1290
56 Ga0068859_102169319 3300005617 Bacteria 613
57 Ga0068861_100339511 3300005719 Bacteria 1314
58 Ga0068861_101798317 3300005719 Bacteria 608
59 Ga0068870_10821514 3300005840 Bacteria 651
60 Ga0068863_100000067 3300005841 Bacteria 117275
61 Ga0068863_100317674 3300005841 Bacteria 1512
62 Ga0068858_100000742 3300005842 Bacteria 34163
63 Ga0068858_100038425 3300005842 Bacteria 4440
64 Ga0068858_102242447 3300005842 Bacteria 540
65 Ga0068860_100017251 3300005843 Bacteria 7036
66 Ga0068862_100047194 3300005844 Bacteria 3675
67 Ga0068862_100734629 3300005844 Bacteria 959
68 Ga0081539_10050777 3300005985 Bacteria 2344
69 Ga0068865_100890729 3300006881 Bacteria 773
70 Ga0097620_102169136 3300006931 Bacteria 613
71 Ga0105250_10012000 3300009092 Bacteria 3587
72 Ga0105240_11604745 3300009093 Bacteria 681
73 Ga0105245_10005284 3300009098 Bacteria 11343
74 Ga0105247_10110110 3300009101 Bacteria 1771
75 Ga0105241_10036289 3300009174 Bacteria 3709
76 Ga0105242_10193468 3300009176 Bacteria 1802
77 Ga0105242_10608116 3300009176 Bacteria 1057
78 Ga0105248_10027683 3300009177 Bacteria 6312
79 Ga0105237_12714220 3300009545 Bacteria 506
80 Ga0105238_10043816 3300009551 Bacteria 4526
81 Ga0105249_10160640 3300009553 Bacteria 2171
82 Ga0105249_11137194 3300009553 Bacteria 851
83 Ga0105239_12200587 3300010375 Bacteria 641
84 Ga0105246_10000083 3300011119 Bacteria 40197
85 Ga0157373_10001931 3300013100 Bacteria 15749
86 Ga0157371_10002579 3300013102 Bacteria 17192
87 Ga0157371_10043316 3300013102 Bacteria 3207
88 Ga0157371_10157688 3300013102 Bacteria 1620
89 Ga0157371_11544998 3300013102 Bacteria 518
90 Ga0157370_10006095 3300013104 Bacteria 13381
91 Ga0157370_10728254 3300013104 Bacteria 904
92 Ga0157369_10024449 3300013105 Bacteria 6719
93 Ga0157369_10123972 3300013105 Bacteria 2741
94 Ga0163162_10003751 3300013306 Bacteria 14561
95 Ga0163162_10196076 3300013306 Bacteria 2148
96 Ga0157372_10019894 3300013307 Bacteria 7236
97 Ga0157372_10529565 3300013307 Bacteria 1374
98 Ga0157372_10665964 3300013307 Bacteria 1212
99 Ga0157372_12298143 3300013307 Bacteria 619
100 Ga0157375_13200316 3300013308 Bacteria 546
101 Ga0182008_10371988 3300014497 Bacteria 762
102 Ga0157376_11571181 3300014969 Bacteria 692
103 Ga0183363_1003 3300015690 Bacteria 421263
104 Ga0163161_10470504 3300017792 Bacteria 1019
105 Ga0209233_1000044 3300025261 Bacteria 489783
106 Ga0209455_1007538 3300025272 Bacteria 3061
107 Ga0209050_1000051 3300025298 Bacteria 353153
108 Ga0209257_1000028 3300025304 Bacteria 699493
109 Ga0207696_1006076 3300025711 Bacteria 4918
110 Ga0207680_10016975 3300025903 Bacteria 3836
111 Ga0207647_10409208 3300025904 Bacteria 763
112 Ga0207705_10013877 3300025909 Bacteria 5808
113 Ga0207707_10013599 3300025912 Bacteria 7096
114 Ga0207657_10000130 3300025919 Bacteria 75710
115 Ga0207649_10001538 3300025920 Bacteria 13543
116 Ga0207652_10150004 3300025921 Bacteria 2087
117 Ga0207681_10093625 3300025923 Bacteria 2151
118 Ga0207694_10011250 3300025924 Bacteria 6759
119 Ga0207650_10114526 3300025925 Bacteria 2092
120 Ga0207659_10271299 3300025926 Bacteria 1384
121 Ga0207687_10002787 3300025927 Bacteria 11852
122 Ga0207644_10014015 3300025931 Bacteria 5358
123 Ga0207690_10001968 3300025932 Bacteria 12597
124 Ga0207706_10000798 3300025933 Bacteria 32625
125 Ga0207706_10016756 3300025933 Bacteria 6615
126 Ga0207686_10107803 3300025934 Bacteria 1873
127 Ga0207709_10075921 3300025935 Bacteria 2149
128 Ga0207669_11126804 3300025937 Bacteria 663
129 Ga0207711_10003155 3300025941 Bacteria 14370
130 Ga0207689_10658975 3300025942 Bacteria 882
131 Ga0207661_10020542 3300025944 Bacteria 4938
132 Ga0207661_10047227 3300025944 Bacteria 3417
133 Ga0207667_10028275 3300025949 Bacteria 6091
134 Ga0207667_10028384 3300025949 Bacteria 6079
135 Ga0207667_10856239 3300025949 Bacteria 903
136 Ga0207712_10085190 3300025961 Bacteria 2311
137 Ga0207712_10682285 3300025961 Bacteria 895
138 Ga0207668_10000488 3300025972 Bacteria 24888
139 Ga0207668_10074466 3300025972 Bacteria 2437
140 Ga0207668_11692283 3300025972 Bacteria 571
141 Ga0207640_10008754 3300025981 Bacteria 5632
142 Ga0207640_10026300 3300025981 Bacteria 3531
143 Ga0207640_10103600 3300025981 Bacteria 2001
144 Ga0207658_10000023 3300025986 Bacteria 190806
145 Ga0207658_10000333 3300025986 Bacteria 47363
146 Ga0207658_10784487 3300025986 Bacteria 864
147 Ga0207703_10000167 3300026035 Bacteria 76517
148 Ga0207703_10000272 3300026035 Bacteria 57191
149 Ga0207703_11844036 3300026035 Bacteria 581
150 Ga0207639_10004916 3300026041 Bacteria 9005
151 Ga0207641_10000119 3300026088 Bacteria 117312
152 Ga0207641_12067989 3300026088 Bacteria 570
153 Ga0207648_10194065 3300026089 Bacteria 1800
154 Ga0207648_10678957 3300026089 Bacteria 953
155 Ga0207676_10000217 3300026095 Bacteria 49723
156 Ga0207674_10020877 3300026116 Bacteria 7067
157 Ga0207674_10139359 3300026116 Bacteria 2386
158 Ga0207675_100326035 3300026118 Bacteria 1500
159 Ga0207675_100475680 3300026118 Bacteria 1241
160 Ga0207698_11299875 3300026142 Bacteria 742
161 Ga0268266_10004966 3300028379 Bacteria 12588
162 Ga0268265_10222639 3300028380 Bacteria 1652
163 Ga0268265_10332901 3300028380 Bacteria 1379
164 Ga0268264_10023423 3300028381 Bacteria 5037
165 Ga0268264_10073102 3300028381 Bacteria 2909
166 Ga0307515_10241063 3300028794 Bacteria 1579
167 Ga0307513_10223195 3300031456 Bacteria 1703
168 Ga0307509_10263910 3300031507 Bacteria 1495
169 Ga0307408_100048709 3300031548 Bacteria 3040
170 Ga0307508_10000011 3300031616 Bacteria 248001
171 Ga0307405_11159093 3300031731 Bacteria 667
172 Ga0307413_10254929 3300031824 Bacteria 1304
173 Ga0307406_10469635 3300031901 Bacteria 1013
174 Ga0307406_10904449 3300031901 Bacteria 752
175 Ga0307406_11605323 3300031901 Bacteria 575
176 Ga0307407_10014045 3300031903 Bacteria 3907
177 Ga0307412_10195569 3300031911 Bacteria 1532
178 Ga0307412_11089572 3300031911 Bacteria 710
179 Ga0307409_100004709 3300031995 Bacteria 7725
180 Ga0307416_100030972 3300032002 Bacteria 4021
181 Ga0307416_100529485 3300032002 Bacteria 1248
182 Ga0307414_10120465 3300032004 Bacteria 2016
183 Ga0307414_10309823 3300032004 Bacteria 1339
184 Ga0307414_10367085 3300032004 Bacteria 1240
185 Ga0307414_11456041 3300032004 Bacteria 637
186 Ga0307411_10013646 3300032005 Bacteria 4491
187 Ga0307411_10492263 3300032005 Bacteria 1035
188 Ga0307411_10611649 3300032005 Bacteria 938
189 Ga0307411_10729068 3300032005 Bacteria 866
190 Ga0307415_100467356 3300032126 Bacteria 1095
191 Ga0307415_101118196 3300032126 Bacteria 738
192 Ga0307510_10005649 3300033180 Bacteria 14912
193 Ga0436363_1579915 3300039450 Bacteria 946
194 Ga0439436_0009383 3300041404 Bacteria 3000
195 Ga0439439_0253810 3300041406 Bacteria 522
196 Ga0439461_0004181 3300041410 Bacteria 2399
197 Ga0439465_0001862 3300041413 Bacteria 6895
198 Ga0439465_0007735 3300041413 Bacteria 3409
199 Ga0451791_0018520 3300041451 Bacteria 535
200 Ga0451793_0614447 3300041452 Bacteria 602
201 Ga0451795_0782315 3300041456 Bacteria 814
202 Ga0451833_1196429 3300041491 Bacteria 567
203 Ga0439431_0000969 3300041997 Bacteria 6222
204 Ga0439442_005444 3300042002 Bacteria 2545
205 Ga0439445_0005431 3300042004 Bacteria 2904
206 Ga0439432_004300 3300042006 Bacteria 5206
207 Ga0439452_086584 3300042010 Bacteria 679
208 Ga0439457_033499 3300042014 Bacteria 1140
209 Ga0439462_0000159 3300042015 Bacteria 11155
210 Ga0439462_0002064 3300042015 Bacteria 4611
211 Ga0450923_149500 3300042125 Bacteria 565
212 Ga0439446_0016630 3300042156 Bacteria 2050
213 Ga0450909_004465 3300042185 Bacteria 1996
214 Ga0439434_0002003 3300042435 Bacteria 5891
215 Ga0439434_0138384 3300042435 Bacteria 801
216 Ga0453684_1122667 3300044712 Bacteria 829
217 Ga0451576_0189266 3300045051 Bacteria 2149
218 Ga0495638_0000400 3300046460 Bacteria 53251
219 Ga0495638_0041087 3300046460 Bacteria 2928
220 Ga0495638_0215639 3300046460 Bacteria 1076
221 Ga0495650_0000453 3300046471 Bacteria 64790
222 Ga0495585_0017577 3300046492 Bacteria 4131
223 Ga0495607_0001504 3300046501 Bacteria 20566
224 Ga0495583_0000443 3300046506 Bacteria 62113
225 Ga0495583_0261243 3300046506 Bacteria 692
226 Ga0495632_0000220 3300046519 Bacteria 58010
227 Ga0495648_0000020 3300046524 Bacteria 254330
228 Ga0495648_0020313 3300046524 Bacteria 4635
229 Ga0495648_0038081 3300046524 Bacteria 3082
230 Ga0495648_0042338 3300046524 Bacteria 2866
231 Ga0495648_0223186 3300046524 Bacteria 928
232 Ga0495663_0046702 3300046525 Bacteria 1331
233 Ga0495642_0107519 3300046528 Bacteria 1191
234 Ga0495598_0001142 3300046537 Bacteria 5104
235 Ga0495598_0021331 3300046537 Bacteria 1722
236 Ga0495597_0094747 3300046542 Bacteria 1264
237 Ga0495622_0004975 3300046557 Bacteria 6155
238 Ga0495633_0014541 3300046558 Bacteria 4110
239 Ga0495668_0196031 3300046616 Bacteria 1106
240 Ga0495668_0281355 3300046616 Bacteria 911
241 Ga0495611_0117637 3300046648 Bacteria 1239
242 Ga0495625_0000397 3300046660 Bacteria 66539
243 Ga0495625_0007444 3300046660 Bacteria 9520
244 Ga0495625_0146022 3300046660 Bacteria 1593
245 Ga0495625_0167729 3300046660 Bacteria 1467
246 Ga0495625_0197485 3300046660 Bacteria 1330
247 Ga0495670_0000029 3300046691 Bacteria 87662
248 Ga0495670_0139215 3300046691 Bacteria 1268
249 Ga0495670_0600953 3300046691 Bacteria 599
250 Ga0495671_0000022 3300046692 Bacteria 255591
251 Ga0495671_0010759 3300046692 Bacteria 5058
252 Ga0495673_0000051 3300047469 Bacteria 255511
253 Ga0495686_0013775 3300047472 Bacteria 5602
254 Ga0495686_0394361 3300047472 Bacteria 744
255 Ga0495615_0003130 3300048090 Bacteria 2743
256 Ga0496100_0003320 3300048903 Bacteria 8376
257 Ga0496101_0061732 3300048904 Bacteria 2722
258 Ga0496102_0000648 3300048905 Bacteria 35117
259 Ga0496103_0000110 3300048906 Bacteria 90202
260 Ga0496104_0000047 3300048907 Bacteria 148896
261 Ga0496105_0000081 3300048908 Bacteria 70237
262 Ga0496106_0659494 3300048909 Bacteria 836
263 Ga0496107_0152331 3300048910 Bacteria 1711
264 Ga0496113_0000020 3300048916 Bacteria 70677
265 Ga0496114_0065207 3300048917 Bacteria 3051
266 Ga0496115_0965242 3300048918 Bacteria 653
267 Ga0496115_1064961 3300048918 Bacteria 615
268 Ga0496117_0018664 3300048920 Bacteria 5733
269 Ga0496118_0098204 3300048921 Bacteria 1989
270 Ga0496119_0000699 3300048922 Bacteria 44963
271 Ga0496120_0001199 3300048923 Bacteria 32884
272 Ga0496121_0000652 3300048924 Bacteria 64960
273 Ga0496121_0005579 3300048924 Bacteria 16069
274 Ga0496121_0077424 3300048924 Bacteria 2648
275 Ga0496122_0001260 3300048925 Bacteria 42389
276 Ga0496122_0479289 3300048925 Bacteria 610
277 Ga0496123_0000362 3300048926 Bacteria 85587
278 Ga0496124_0005477 3300048927 Bacteria 14255
279 Ga0496125_0000555 3300048928 Bacteria 64263
280 Ga0496125_0020285 3300048928 Bacteria 6240
281 Ga0496125_0036826 3300048928 Bacteria 4263
282 Ga0496126_0001290 3300048929 Bacteria 40086
283 Ga0496126_0031610 3300048929 Bacteria 4997
284 Ga0495678_011239 3300049459 Bacteria 4297
285 Ga0501033_0338536 3300049570 Bacteria 1055
286 Ga0501046_0495704 3300049580 Bacteria 875
287 Ga0501225_0003832 3300049705 Bacteria 4518
288 Ga0501083_0728833 3300049744 Bacteria 645
289 Ga0501241_002688 3300049758 Bacteria 3420
290 Ga0501044_0061931 3300049823 Bacteria 3827
291 nmdc:mga03683_36040_c1 3300050489 Bacteria 2010
292 nmdc:mga0k408_241684_c1 3300050493 Bacteria 1078
293 nmdc:mga07m45_46999_c1 3300050496 Bacteria 2425
294 Ga0500643_000611 3300053087 Bacteria 24350
295 Ga0500643_003544 3300053087 Bacteria 7435
296 Ga0500643_014490 3300053087 Bacteria 2738
297 Ga0500643_021218 3300053087 Bacteria 2108
298 Ga0500643_025464 3300053087 Bacteria 1865
299 Ga0500641_0372989 3300053096 Bacteria 568
300 Ga0500556_0000053 3300053104 Bacteria 117389
301 Ga0500557_152353 3300053105 Bacteria 760
302 Ga0500594_0307658 3300053118 Bacteria 531
303 Ga0500595_037876 3300053119 Bacteria 1570
304 Ga0500642_0000001 3300053130 Bacteria 1468402
305 Ga0500658_0000319 3300053134 Bacteria 21255
306 Ga0500658_0031568 3300053134 Bacteria 2072
307 Ga0500559_0009884 3300053136 Bacteria 4113
308 Ga0500559_0142708 3300053136 Bacteria 1122
309 Ga0500559_0230349 3300053136 Bacteria 873
310 Ga0500568_0014103 3300053139 Bacteria 3621
311 Ga0500568_0288641 3300053139 Unclassified 596
312 Ga0500573_0000417 3300053140 Bacteria 18184
313 Ga0500573_0048942 3300053140 Bacteria 2433
314 Ga0500604_0031332 3300053151 Bacteria 1560
315 Ga0500645_000784 3300053730 Bacteria 19194

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10309823 Ga0307414_103098233 122
2 3300025949 Ga0207667_10856239 Ga0207667_108562392 124
3 3300031901 Ga0307406_11605323 Ga0307406_116053231 126
4 3300046537 Ga0495598_0021331 Ga0495598_0021331_672_1052 126
5 3300046691 Ga0495670_0600953 Ga0495670_0600953_182_562 126
6 3300048090 Ga0495615_0003130 Ga0495615_0003130_734_1114 126
7 iso_pu_bacteria 2643221622 2644125261 126
8 iso_pu_bacteria 2928027323 2928030239 126
9 iso_pu_bacteria 2946787523 2946790915 126
10 iso_pu_bacteria 2984555340 2984556901 126
11 iso_pu_bacteria 2984564862 2984568794 126
12 iso_pu_bacteria 2993356040 2993359783 126
13 3300005329 Ga0070683_100071518 Ga0070683_1000715182 127
14 3300005336 Ga0070680_100001754 Ga0070680_1000017546 127
15 3300005337 Ga0070682_100035454 Ga0070682_1000354542 127
16 3300005339 Ga0070660_100784263 Ga0070660_1007842631 127
17 3300005341 Ga0070691_10239244 Ga0070691_102392442 127
18 3300005344 Ga0070661_100008812 Ga0070661_1000088122 127
19 3300005345 Ga0070692_10244462 Ga0070692_102444622 127
20 3300005457 Ga0070662_100000900 Ga0070662_1000009008 127
21 3300005530 Ga0070679_100014086 Ga0070679_1000140867 127
22 3300005539 Ga0068853_100032690 Ga0068853_1000326903 127
23 3300005563 Ga0068855_100017830 Ga0068855_1000178303 127
24 3300005564 Ga0070664_100017361 Ga0070664_1000173614 127
25 3300005577 Ga0068857_100077634 Ga0068857_1000776342 127
26 3300005578 Ga0068854_100046494 Ga0068854_1000464942 127
27 3300005614 Ga0068856_100010625 Ga0068856_1000106254 127
28 3300009174 Ga0105241_10036289 Ga0105241_100362893 127
29 3300013100 Ga0157373_10001931 Ga0157373_100019313 127
30 3300013102 Ga0157371_10002579 Ga0157371_100025794 127
31 3300013104 Ga0157370_10006095 Ga0157370_100060952 127
32 3300013105 Ga0157369_10024449 Ga0157369_100244494 127
33 3300013307 Ga0157372_10019894 Ga0157372_100198946 127
34 3300013308 Ga0157375_13200316 Ga0157375_132003162 127
35 3300025904 Ga0207647_10409208 Ga0207647_104092082 127
36 3300025909 Ga0207705_10013877 Ga0207705_100138774 127
37 3300025912 Ga0207707_10013599 Ga0207707_100135993 127
38 3300025919 Ga0207657_10000130 Ga0207657_1000013062 127
39 3300025920 Ga0207649_10001538 Ga0207649_100015389 127
40 3300025921 Ga0207652_10150004 Ga0207652_101500042 127
41 3300025932 Ga0207690_10001968 Ga0207690_100019688 127
42 3300025933 Ga0207706_10000798 Ga0207706_1000079823 127
43 3300025944 Ga0207661_10020542 Ga0207661_100205422 127
44 3300025944 Ga0207661_10047227 Ga0207661_100472273 127
45 3300025949 Ga0207667_10028275 Ga0207667_100282753 127
46 3300025981 Ga0207640_10026300 Ga0207640_100263003 127
47 3300026041 Ga0207639_10004916 Ga0207639_100049166 127
48 3300026116 Ga0207674_10020877 Ga0207674_100208774 127
49 3300026142 Ga0207698_11299875 Ga0207698_112998752 127
50 3300003214 JGI25165J46597_1000385 JGI25165J46597_100038513 128
51 3300005334 Ga0068869_100675153 Ga0068869_1006751532 128
52 3300006881 Ga0068865_100890729 Ga0068865_1008907292 128
53 3300009098 Ga0105245_10005284 Ga0105245_100052843 128
54 3300009176 Ga0105242_10193468 Ga0105242_101934683 128
55 3300009545 Ga0105237_12714220 Ga0105237_127142201 128
56 3300009551 Ga0105238_10043816 Ga0105238_100438162 128
57 3300025261 Ga0209233_1000044 Ga0209233_100004413 128
58 3300025272 Ga0209455_1007538 Ga0209455_10075382 128
59 3300025924 Ga0207694_10011250 Ga0207694_100112502 128
60 3300025927 Ga0207687_10002787 Ga0207687_100027874 128
61 3300025934 Ga0207686_10107803 Ga0207686_101078032 128
62 3300025942 Ga0207689_10658975 Ga0207689_106589752 128
63 3300053136 Ga0500559_0009884 Ga0500559_0009884_2464_2850 128
64 iso_pu_bacteria 2818991466 2819715248 128
65 iso_pu_bacteria 2885429604 2885432035 128
66 iso_pu_bacteria 2928968154 2928971484 128
67 3300005288 Ga0065714_10461713 Ga0065714_104617131 129
68 3300005328 Ga0070676_11370430 Ga0070676_113704301 129
69 3300005459 Ga0068867_100340950 Ga0068867_1003409502 129
70 3300005563 Ga0068855_102226576 Ga0068855_1022265761 129
71 3300005617 Ga0068859_102169319 Ga0068859_1021693192 129
72 3300005719 Ga0068861_100339511 Ga0068861_1003395112 129
73 3300005840 Ga0068870_10821514 Ga0068870_108215142 129
74 3300006931 Ga0097620_102169136 Ga0097620_1021691362 129
75 3300009093 Ga0105240_11604745 Ga0105240_116047451 129
76 3300014969 Ga0157376_11571181 Ga0157376_115711811 129
77 3300026089 Ga0207648_10194065 Ga0207648_101940652 129
78 3300026118 Ga0207675_100475680 Ga0207675_1004756802 129
79 3300031507 Ga0307509_10263910 Ga0307509_102639102 129
80 3300031616 Ga0307508_10000011 Ga0307508_10000011222 129
81 3300041451 Ga0451791_0018520 Ga0451791_0018520_47_436 129
82 3300041452 Ga0451793_0614447 Ga0451793_0614447_19_408 129
83 3300041456 Ga0451795_0782315 Ga0451795_0782315_152_541 129
84 3300041491 Ga0451833_1196429 Ga0451833_1196429_30_419 129
85 3300046460 Ga0495638_0000400 Ga0495638_0000400_28398_28787 129
86 3300046492 Ga0495585_0017577 Ga0495585_0017577_334_723 129
87 3300046525 Ga0495663_0046702 Ga0495663_0046702_314_703 129
88 3300046542 Ga0495597_0094747 Ga0495597_0094747_376_765 129
89 3300046660 Ga0495625_0000397 Ga0495625_0000397_43430_43819 129
90 3300046660 Ga0495625_0167729 Ga0495625_0167729_295_684 129
91 3300048918 Ga0496115_1064961 Ga0496115_1064961_46_435 129
92 3300048924 Ga0496121_0077424 Ga0496121_0077424_821_1210 129
93 3300049823 Ga0501044_0061931 Ga0501044_0061931_2968_3360 129
94 3300053119 Ga0500595_037876 Ga0500595_037876_433_822 129
95 3300053136 Ga0500559_0230349 Ga0500559_0230349_226_615 129
96 iso_pu_bacteria 2643221588 2643951335 129
97 iso_pu_bacteria 2848297114 2848299602 129
98 iso_pu_bacteria 2919138771 2919139117 129
99 3300001989 JGI24739J22299_10009476 JGI24739J22299_100094762 130
100 3300003791 Ga0055530_10000202 Ga0055530_1000020235 130
101 3300003794 Ga0055531_10000090 Ga0055531_1000009046 130
102 3300005353 Ga0070669_100275391 Ga0070669_1002753912 130
103 3300005356 Ga0070674_101359482 Ga0070674_1013594822 130
104 3300005548 Ga0070665_101708119 Ga0070665_1017081192 130
105 3300005719 Ga0068861_101798317 Ga0068861_1017983171 130
106 3300005842 Ga0068858_100038425 Ga0068858_1000384254 130
107 3300009177 Ga0105248_10027683 Ga0105248_100276835 130
108 3300009553 Ga0105249_10160640 Ga0105249_101606402 130
109 3300013306 Ga0163162_10003751 Ga0163162_100037517 130
110 3300013306 Ga0163162_10196076 Ga0163162_101960762 130
111 3300017792 Ga0163161_10470504 Ga0163161_104705042 130
112 3300025298 Ga0209050_1000051 Ga0209050_1000051193 130
113 3300025304 Ga0209257_1000028 Ga0209257_1000028175 130
114 3300025937 Ga0207669_11126804 Ga0207669_111268042 130
115 3300025941 Ga0207711_10003155 Ga0207711_100031552 130
116 3300025961 Ga0207712_10085190 Ga0207712_100851901 130
117 3300025986 Ga0207658_10784487 Ga0207658_107844871 130
118 3300026035 Ga0207703_10000272 Ga0207703_100002721 130
119 3300026089 Ga0207648_10678957 Ga0207648_106789572 130
120 3300026095 Ga0207676_10000217 Ga0207676_1000021718 130
121 3300026118 Ga0207675_100326035 Ga0207675_1003260352 130
122 3300031731 Ga0307405_11159093 Ga0307405_111590931 130
123 3300039450 Ga0436363_1579915 Ga0436363_1579915_62_454 130
124 3300041404 Ga0439436_0009383 Ga0439436_0009383_583_975 130
125 3300041406 Ga0439439_0253810 Ga0439439_0253810_101_493 130
126 3300041410 Ga0439461_0004181 Ga0439461_0004181_522_914 130
127 3300041413 Ga0439465_0001862 Ga0439465_0001862_5977_6369 130
128 3300041413 Ga0439465_0007735 Ga0439465_0007735_2029_2421 130
129 3300041997 Ga0439431_0000969 Ga0439431_0000969_4115_4507 130
130 3300042002 Ga0439442_005444 Ga0439442_005444_664_1056 130
131 3300042004 Ga0439445_0005431 Ga0439445_0005431_1986_2378 130
132 3300042006 Ga0439432_004300 Ga0439432_004300_4281_4673 130
133 3300042010 Ga0439452_086584 Ga0439452_086584_210_602 130
134 3300042014 Ga0439457_033499 Ga0439457_033499_682_1074 130
135 3300042015 Ga0439462_0000159 Ga0439462_0000159_1430_1822 130
136 3300042015 Ga0439462_0002064 Ga0439462_0002064_3707_4099 130
137 3300042125 Ga0450923_149500 Ga0450923_149500_117_509 130
138 3300042156 Ga0439446_0016630 Ga0439446_0016630_829_1221 130
139 3300042185 Ga0450909_004465 Ga0450909_004465_687_1079 130
140 3300042435 Ga0439434_0002003 Ga0439434_0002003_1639_2031 130
141 3300042435 Ga0439434_0138384 Ga0439434_0138384_313_705 130
142 3300046460 Ga0495638_0215639 Ga0495638_0215639_662_1054 130
143 3300046501 Ga0495607_0001504 Ga0495607_0001504_2362_2754 130
144 3300046506 Ga0495583_0261243 Ga0495583_0261243_149_541 130
145 3300046524 Ga0495648_0038081 Ga0495648_0038081_12_404 130
146 3300046524 Ga0495648_0042338 Ga0495648_0042338_2059_2451 130
147 3300046528 Ga0495642_0107519 Ga0495642_0107519_681_1073 130
148 3300046616 Ga0495668_0196031 Ga0495668_0196031_418_810 130
149 3300046616 Ga0495668_0281355 Ga0495668_0281355_441_833 130
150 3300046660 Ga0495625_0007444 Ga0495625_0007444_4946_5338 130
151 3300046660 Ga0495625_0146022 Ga0495625_0146022_742_1134 130
152 3300046660 Ga0495625_0197485 Ga0495625_0197485_212_604 130
153 3300046691 Ga0495670_0000029 Ga0495670_0000029_19364_19756 130
154 3300047472 Ga0495686_0394361 Ga0495686_0394361_74_511 130
155 3300048929 Ga0496126_0031610 Ga0496126_0031610_2362_2754 130
156 3300049580 Ga0501046_0495704 Ga0501046_0495704_300_692 130
157 3300049758 Ga0501241_002688 Ga0501241_002688_1698_2090 130
158 3300053087 Ga0500643_003544 Ga0500643_003544_819_1211 130
159 3300053087 Ga0500643_021218 Ga0500643_021218_576_968 130
160 3300053087 Ga0500643_025464 Ga0500643_025464_336_731 130
161 3300053134 Ga0500658_0000319 Ga0500658_0000319_1534_1926 130
162 3300053134 Ga0500658_0031568 Ga0500658_0031568_1339_1731 130
163 3300053136 Ga0500559_0142708 Ga0500559_0142708_605_997 130
164 3300053139 Ga0500568_0014103 Ga0500568_0014103_1383_1775 130
165 3300053140 Ga0500573_0000417 Ga0500573_0000417_11347_11739 130
166 3300053151 Ga0500604_0031332 Ga0500604_0031332_66_458 130
167 3300005331 Ga0070670_100141446 Ga0070670_1001414462 131
168 3300005335 Ga0070666_10001699 Ga0070666_100016992 131
169 3300005338 Ga0068868_101097504 Ga0068868_1010975041 131
170 3300005347 Ga0070668_100000076 Ga0070668_10000007644 131
171 3300005367 Ga0070667_100000025 Ga0070667_10000002595 131
172 3300005841 Ga0068863_100000067 Ga0068863_10000006794 131
173 3300005842 Ga0068858_100000742 Ga0068858_1000007427 131
174 3300005842 Ga0068858_102242447 Ga0068858_1022424471 131
175 3300005844 Ga0068862_100734629 Ga0068862_1007346291 131
176 3300009176 Ga0105242_10608116 Ga0105242_106081162 131
177 3300013102 Ga0157371_10043316 Ga0157371_100433163 131
178 3300013102 Ga0157371_11544998 Ga0157371_115449981 131
179 3300013307 Ga0157372_10529565 Ga0157372_105295652 131
180 3300013307 Ga0157372_12298143 Ga0157372_122981431 131
181 3300014497 Ga0182008_10371988 Ga0182008_103719882 131
182 3300015690 Ga0183363_1003 Ga0183363_1003200 131
183 3300025903 Ga0207680_10016975 Ga0207680_100169755 131
184 3300025925 Ga0207650_10114526 Ga0207650_101145263 131
185 3300025972 Ga0207668_10000488 Ga0207668_100004881 131
186 3300025986 Ga0207658_10000023 Ga0207658_1000002393 131
187 3300026035 Ga0207703_10000167 Ga0207703_100001672 131
188 3300026035 Ga0207703_11844036 Ga0207703_118440361 131
189 3300026088 Ga0207641_10000119 Ga0207641_1000011925 131
190 3300028380 Ga0268265_10222639 Ga0268265_102226393 131
191 3300028794 Ga0307515_10241063 Ga0307515_102410633 131
192 3300031456 Ga0307513_10223195 Ga0307513_102231952 131
193 3300031824 Ga0307413_10254929 Ga0307413_102549291 131
194 3300032004 Ga0307414_10120465 Ga0307414_101204653 131
195 3300032004 Ga0307414_10367085 Ga0307414_103670852 131
196 3300032005 Ga0307411_10492263 Ga0307411_104922633 131
197 3300032005 Ga0307411_10729068 Ga0307411_107290682 131
198 3300033180 Ga0307510_10005649 Ga0307510_100056493 131
199 3300046460 Ga0495638_0041087 Ga0495638_0041087_2033_2428 131
200 3300046471 Ga0495650_0000453 Ga0495650_0000453_56671_57066 131
201 3300046506 Ga0495583_0000443 Ga0495583_0000443_30577_30996 131
202 3300046519 Ga0495632_0000220 Ga0495632_0000220_30993_31418 131
203 3300046524 Ga0495648_0000020 Ga0495648_0000020_222593_223024 131
204 3300046524 Ga0495648_0223186 Ga0495648_0223186_148_543 131
205 3300046557 Ga0495622_0004975 Ga0495622_0004975_828_1223 131
206 3300046558 Ga0495633_0014541 Ga0495633_0014541_545_964 131
207 3300046648 Ga0495611_0117637 Ga0495611_0117637_471_866 131
208 3300046691 Ga0495670_0139215 Ga0495670_0139215_220_666 131
209 3300046692 Ga0495671_0000022 Ga0495671_0000022_223819_224238 131
210 3300046692 Ga0495671_0010759 Ga0495671_0010759_3674_4069 131
211 3300047469 Ga0495673_0000051 Ga0495673_0000051_31374_31793 131
212 3300049459 Ga0495678_011239 Ga0495678_011239_1295_1690 131
213 3300050489 nmdc:mga03683_36040_c1 nmdc:mga03683_36040_c1_958_1353 131
214 3300050493 nmdc:mga0k408_241684_c1 nmdc:mga0k408_241684_c1_610_1005 131
215 3300050496 nmdc:mga07m45_46999_c1 nmdc:mga07m45_46999_c1_839_1234 131
216 3300053087 Ga0500643_000611 Ga0500643_000611_17354_17749 131
217 3300053087 Ga0500643_014490 Ga0500643_014490_1089_1484 131
218 3300053096 Ga0500641_0372989 Ga0500641_0372989_19_414 131
219 3300053104 Ga0500556_0000053 Ga0500556_0000053_18356_18751 131
220 3300053105 Ga0500557_152353 Ga0500557_152353_70_465 131
221 3300053118 Ga0500594_0307658 Ga0500594_0307658_44_439 131
222 3300053130 Ga0500642_0000001 Ga0500642_0000001_271197_271592 131
223 3300053139 Ga0500568_0288641 Ga0500568_0288641_24_419 131
224 3300053140 Ga0500573_0048942 Ga0500573_0048942_2008_2403 131
225 3300053730 Ga0500645_000784 Ga0500645_000784_47_442 131
226 3300005290 Ga0065712_10201521 Ga0065712_102015212 132
227 3300005353 Ga0070669_100064229 Ga0070669_1000642293 132
228 3300005471 Ga0070698_100355326 Ga0070698_1003553262 132
229 3300005578 Ga0068854_100099474 Ga0068854_1000994744 132
230 3300005985 Ga0081539_10050777 Ga0081539_100507772 132
231 3300025923 Ga0207681_10093625 Ga0207681_100936252 132
232 3300025981 Ga0207640_10008754 Ga0207640_100087544 132
233 3300028381 Ga0268264_10023423 Ga0268264_100234232 132
234 3300031548 Ga0307408_100048709 Ga0307408_1000487092 132
235 3300031901 Ga0307406_10469635 Ga0307406_104696352 132
236 3300031901 Ga0307406_10904449 Ga0307406_109044492 132
237 3300031903 Ga0307407_10014045 Ga0307407_100140452 132
238 3300031911 Ga0307412_10195569 Ga0307412_101955692 132
239 3300031911 Ga0307412_11089572 Ga0307412_110895722 132
240 3300031995 Ga0307409_100004709 Ga0307409_1000047092 132
241 3300032002 Ga0307416_100030972 Ga0307416_1000309723 132
242 3300032002 Ga0307416_100529485 Ga0307416_1005294852 132
243 3300032004 Ga0307414_11456041 Ga0307414_114560411 132
244 3300032005 Ga0307411_10013646 Ga0307411_100136464 132
245 3300032005 Ga0307411_10611649 Ga0307411_106116492 132
246 3300032126 Ga0307415_100467356 Ga0307415_1004673562 132
247 3300032126 Ga0307415_101118196 Ga0307415_1011181962 132
248 3300046537 Ga0495598_0001142 Ga0495598_0001142_1897_2295 132
249 3300047472 Ga0495686_0013775 Ga0495686_0013775_201_653 132
250 3300048924 Ga0496121_0000652 Ga0496121_0000652_28376_28780 132
251 3300048928 Ga0496125_0020285 Ga0496125_0020285_941_1339 132
252 3300049705 Ga0501225_0003832 Ga0501225_0003832_2190_2588 132
253 3300049744 Ga0501083_0728833 Ga0501083_0728833_132_551 132
254 2162886007 SwRhRL2b_contig_2660858 SwRhRL2b_0099.00007350 133
255 3300002074 JGI24748J21848_1009458 JGI24748J21848_10094582 133
256 3300005289 Ga0065704_10070333 Ga0065704_1007033328 133
257 3300005345 Ga0070692_10838321 Ga0070692_108383211 133
258 3300005347 Ga0070668_100006926 Ga0070668_1000069262 133
259 3300005353 Ga0070669_100000143 Ga0070669_10000014327 133
260 3300005354 Ga0070675_100048909 Ga0070675_1000489092 133
261 3300005355 Ga0070671_100011449 Ga0070671_1000114495 133
262 3300005366 Ga0070659_100053183 Ga0070659_1000531832 133
263 3300005366 Ga0070659_100265623 Ga0070659_1002656232 133
264 3300005367 Ga0070667_100000210 Ga0070667_10000021021 133
265 3300005457 Ga0070662_100015259 Ga0070662_1000152593 133
266 3300005535 Ga0070684_100582024 Ga0070684_1005820242 133
267 3300005548 Ga0070665_100014128 Ga0070665_1000141283 133
268 3300005563 Ga0068855_100090167 Ga0068855_1000901673 133
269 3300005563 Ga0068855_100109011 Ga0068855_1001090113 133
270 3300005564 Ga0070664_100534771 Ga0070664_1005347712 133
271 3300005577 Ga0068857_100078397 Ga0068857_1000783971 133
272 3300005616 Ga0068852_100439346 Ga0068852_1004393462 133
273 3300005841 Ga0068863_100317674 Ga0068863_1003176741 133
274 3300005843 Ga0068860_100017251 Ga0068860_1000172517 133
275 3300005844 Ga0068862_100047194 Ga0068862_1000471943 133
276 3300009092 Ga0105250_10012000 Ga0105250_100120002 133
277 3300009101 Ga0105247_10110110 Ga0105247_101101102 133
278 3300009553 Ga0105249_11137194 Ga0105249_111371941 133
279 3300010375 Ga0105239_12200587 Ga0105239_122005872 133
280 3300011119 Ga0105246_10000083 Ga0105246_1000008322 133
281 3300013102 Ga0157371_10157688 Ga0157371_101576882 133
282 3300013104 Ga0157370_10728254 Ga0157370_107282542 133
283 3300013105 Ga0157369_10123972 Ga0157369_101239721 133
284 3300013307 Ga0157372_10665964 Ga0157372_106659642 133
285 3300025711 Ga0207696_1006076 Ga0207696_10060763 133
286 3300025926 Ga0207659_10271299 Ga0207659_102712992 133
287 3300025931 Ga0207644_10014015 Ga0207644_100140152 133
288 3300025933 Ga0207706_10016756 Ga0207706_100167564 133
289 3300025935 Ga0207709_10075921 Ga0207709_100759212 133
290 3300025949 Ga0207667_10028384 Ga0207667_100283842 133
291 3300025961 Ga0207712_10682285 Ga0207712_106822852 133
292 3300025972 Ga0207668_10074466 Ga0207668_100744662 133
293 3300025972 Ga0207668_11692283 Ga0207668_116922832 133
294 3300025981 Ga0207640_10103600 Ga0207640_101036003 133
295 3300025986 Ga0207658_10000333 Ga0207658_1000033319 133
296 3300026088 Ga0207641_12067989 Ga0207641_120679891 133
297 3300026116 Ga0207674_10139359 Ga0207674_101393591 133
298 3300028379 Ga0268266_10004966 Ga0268266_100049664 133
299 3300028380 Ga0268265_10332901 Ga0268265_103329012 133
300 3300028381 Ga0268264_10073102 Ga0268264_100731021 133
301 3300044712 Ga0453684_1122667 Ga0453684_1122667_267_677 133
302 3300045051 Ga0451576_0189266 Ga0451576_0189266_81_491 133
303 3300046524 Ga0495648_0020313 Ga0495648_0020313_3047_3448 133
304 3300048903 Ga0496100_0003320 Ga0496100_0003320_5201_5602 133
305 3300048904 Ga0496101_0061732 Ga0496101_0061732_13_414 133
306 3300048905 Ga0496102_0000648 Ga0496102_0000648_34561_34962 133
307 3300048906 Ga0496103_0000110 Ga0496103_0000110_164_565 133
308 3300048907 Ga0496104_0000047 Ga0496104_0000047_89548_89949 133
309 3300048908 Ga0496105_0000081 Ga0496105_0000081_69687_70088 133
310 3300048909 Ga0496106_0659494 Ga0496106_0659494_129_530 133
311 3300048910 Ga0496107_0152331 Ga0496107_0152331_86_487 133
312 3300048916 Ga0496113_0000020 Ga0496113_0000020_2275_2676 133
313 3300048917 Ga0496114_0065207 Ga0496114_0065207_960_1364 133
314 3300048918 Ga0496115_0965242 Ga0496115_0965242_206_607 133
315 3300048920 Ga0496117_0018664 Ga0496117_0018664_5164_5565 133
316 3300048921 Ga0496118_0098204 Ga0496118_0098204_1544_1945 133
317 3300048922 Ga0496119_0000699 Ga0496119_0000699_21022_21423 133
318 3300048923 Ga0496120_0001199 Ga0496120_0001199_32325_32726 133
319 3300048924 Ga0496121_0005579 Ga0496121_0005579_1426_1827 133
320 3300048925 Ga0496122_0001260 Ga0496122_0001260_50_451 133
321 3300048925 Ga0496122_0479289 Ga0496122_0479289_71_472 133
322 3300048926 Ga0496123_0000362 Ga0496123_0000362_22762_23163 133
323 3300048927 Ga0496124_0005477 Ga0496124_0005477_6622_7023 133
324 3300048928 Ga0496125_0000555 Ga0496125_0000555_12960_13361 133
325 3300048928 Ga0496125_0036826 Ga0496125_0036826_3715_4116 133
326 3300048929 Ga0496126_0001290 Ga0496126_0001290_34424_34825 133
327 3300049570 Ga0501033_0338536 Ga0501033_0338536_228_632 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

18

71

0.96

PF13279

4HBT_2

Thioesterase-like superfamily

10

120

0.89

PF01643

Acyl-ACP_TE

Acyl-ACP thioesterase N-terminal domain

2

120

0.84

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

3

101

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9261 5 111
2egi-assembly2.cif.gz_I crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9223 5 111
1psu-assembly1.cif.gz_A structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9149 4 109
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9082 5 111
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9019 5 128
ID Description Score Start End Superfamily
5eo2D01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9277 1 107 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9261 5 111 3.10.129.10
af_Q80ZW2_46_168_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9143 3 110 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9082 5 111 3.10.129.10
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9019 5 128 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A143ZR24-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9931 4 130 GO:0003857
GO:0006635
GO:0070403
AF-A0A0A7PPY5-F1-model_v4 Thioesterase domain-containing protein 0.9927 4 130
AF-A0A842HYW3-F1-model_v4 Acyl-CoA thioesterase 0.9922 4 129 GO:0047617
AF-A0A501XEG2-F1-model_v4 Acyl-CoA thioesterase 0.9919 4 130
AF-A0A326GMI7-F1-model_v4 Acyl-CoA thioesterase 0.9916 3 129 GO:0047617

Feature Viewer

pLDDT pTM Quality
93.55 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map