F408786

General Info

Members Datasets Scaffolds Average Seq Length
327 219 654 213

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10879899|Ga0163162_108798991
Length 232
Sequence MKRKKSRETMKKIIAITQVTLDGVMQSPGGPEEDPSNGFTHGGWAMSFLDDALNRAIGETIAGEFDMLLGRRTYEIFAAYWPHHGDNPIAKAFNKATKYVVTRTLDRFDWKNSLRINGDVVDEVHRLKASPGPALHVWGSSELLQTLIAAGLVDEYRIWVFPLVLGEGKRLFENGVPPGSLALVQTRSTPKGVLINVYRPAGSLPPGTFHPDNPSDAELARRKKLAAEGSGT

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 2643221670 Streptomyces sp. Root431 Isolate Unclassified
218 2738541284 Pedobacter sp. YR016 Isolate Unclassified
219 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 3.36
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10879899 3300013306 Bacteria 1010
2 rootH2_10145335 3300003320 Bacteria 5405
3 Ga0065714_10002194 3300005288 Bacteria 111067
4 Ga0065714_10015987 3300005288 Unclassified 2136
5 Ga0065714_10145642 3300005288 Bacteria 1140
6 Ga0065707_10016637 3300005295 Bacteria 2573
7 Ga0065707_10224767 3300005295 Bacteria 1206
8 Ga0070658_10261305 3300005327 Bacteria 1470
9 Ga0070683_100003782 3300005329 Bacteria 12354
10 Ga0070677_10400273 3300005333 Unclassified 723
11 Ga0070680_100251815 3300005336 Bacteria 1493
12 Ga0070682_100006901 3300005337 Bacteria 6386
13 Ga0070682_100015604 3300005337 Bacteria 4404
14 Ga0070682_100295060 3300005337 Bacteria 1187
15 Ga0070689_100000001 3300005340 Bacteria 1334580
16 Ga0070689_100415474 3300005340 Bacteria 1139
17 Ga0070661_100053207 3300005344 Bacteria 2963
18 Ga0070661_100223433 3300005344 Bacteria 1445
19 Ga0070675_100004476 3300005354 Bacteria 10663
20 Ga0070673_100059756 3300005364 Bacteria 3018
21 Ga0070659_100167372 3300005366 Bacteria 1799
22 Ga0070667_100029537 3300005367 Bacteria 4568
23 Ga0070667_100039263 3300005367 Bacteria 3967
24 Ga0070714_100172253 3300005435 Bacteria 1965
25 Ga0070700_100047398 3300005441 Bacteria 2659
26 Ga0070708_100016202 3300005445 Bacteria 6179
27 Ga0070708_100017151 3300005445 Bacteria 6031
28 Ga0070708_100651957 3300005445 Bacteria 992
29 Ga0070708_100800918 3300005445 Bacteria 886
30 Ga0070662_100024360 3300005457 Bacteria 4168
31 Ga0070681_10006162 3300005458 Bacteria 11651
32 Ga0070681_10465635 3300005458 Bacteria 1176
33 Ga0068867_100003362 3300005459 Bacteria 11266
34 Ga0070685_10361819 3300005466 Bacteria 995
35 Ga0070706_100015922 3300005467 Bacteria 6944
36 Ga0070707_100034113 3300005468 Bacteria 4853
37 Ga0070707_100053002 3300005468 Bacteria 3888
38 Ga0070698_100086731 3300005471 Bacteria 3117
39 Ga0070698_100153892 3300005471 Bacteria 2245
40 Ga0070698_100339099 3300005471 Bacteria 1434
41 Ga0070699_100010533 3300005518 Bacteria 8000
42 Ga0070699_100341675 3300005518 Bacteria 1347
43 Ga0070679_100038325 3300005530 Bacteria 4764
44 Ga0070679_100062545 3300005530 Bacteria 3711
45 Ga0070679_100278374 3300005530 Unclassified 1626
46 Ga0070684_100460963 3300005535 Unclassified 1175
47 Ga0070697_100135801 3300005536 Bacteria 2065
48 Ga0068853_100729757 3300005539 Unclassified 946
49 Ga0070695_100109571 3300005545 Bacteria 1872
50 Ga0070696_100055684 3300005546 Bacteria 2757
51 Ga0070696_100362336 3300005546 Bacteria 1125
52 Ga0068855_100024293 3300005563 Bacteria 7255
53 Ga0068855_100084305 3300005563 Bacteria 3680
54 Ga0068855_100094885 3300005563 Bacteria 3439
55 Ga0068855_100341993 3300005563 Bacteria 1649
56 Ga0068857_100075958 3300005577 Bacteria 2995
57 Ga0068856_100067565 3300005614 Unclassified 3532
58 Ga0068856_100704599 3300005614 Bacteria 1030
59 Ga0068859_100001005 3300005617 Bacteria 28915
60 Ga0068859_100171204 3300005617 Bacteria 2252
61 Ga0068864_100639722 3300005618 Bacteria 1035
62 Ga0068866_10138120 3300005718 Bacteria 1395
63 Ga0068861_100157394 3300005719 Bacteria 1870
64 Ga0068861_100488390 3300005719 Bacteria 1111
65 Ga0068863_100050850 3300005841 Bacteria 3928
66 Ga0068863_100686593 3300005841 Bacteria 1017
67 Ga0068858_100008106 3300005842 Bacteria 10107
68 Ga0068858_100030437 3300005842 Bacteria 5012
69 Ga0068860_100015667 3300005843 Bacteria 7401
70 Ga0068860_100048920 3300005843 Bacteria 4029
71 Ga0068860_100111433 3300005843 Bacteria 2616
72 Ga0068862_100505794 3300005844 Bacteria 1147
73 Ga0081455_10012865 3300005937 Bacteria 8308
74 Ga0081455_10027286 3300005937 Bacteria 5233
75 Ga0081455_10062197 3300005937 Bacteria 3139
76 Ga0081539_10060818 3300005985 Bacteria 2072
77 Ga0075365_10376079 3300006038 Bacteria 1002
78 Ga0075367_10428391 3300006178 Bacteria 838
79 Ga0097621_100118270 3300006237 Bacteria 2246
80 Ga0075428_100026372 3300006844 Bacteria 6433
81 Ga0075430_100120405 3300006846 Unclassified 2188
82 Ga0075431_100000024 3300006847 Bacteria 79167
83 Ga0075431_100007671 3300006847 Bacteria 10744
84 Ga0075431_100057495 3300006847 Bacteria 4012
85 Ga0075431_100466091 3300006847 Bacteria 1257
86 Ga0075433_10023482 3300006852 Bacteria 5191
87 Ga0075433_10054992 3300006852 Bacteria 3474
88 Ga0075434_100097273 3300006871 Bacteria 2948
89 Ga0075429_100000773 3300006880 Bacteria 25189
90 Ga0075429_100007782 3300006880 Bacteria 9306
91 Ga0068865_100225528 3300006881 Bacteria 1467
92 Ga0075436_100116137 3300006914 Bacteria 1870
93 Ga0097620_100001005 3300006931 Bacteria 28915
94 Ga0097620_100171218 3300006931 Bacteria 2252
95 Ga0075435_100005874 3300007076 Bacteria 8640
96 Ga0075435_100149472 3300007076 Bacteria 1963
97 Ga0111539_10000102 3300009094 Bacteria 91214
98 Ga0111539_10099160 3300009094 Bacteria 3422
99 Ga0105245_10152922 3300009098 Bacteria 2183
100 Ga0105245_10160492 3300009098 Bacteria 2133
101 Ga0105247_10001170 3300009101 Bacteria 19489
102 Ga0114129_10006157 3300009147 Bacteria 17020
103 Ga0114129_10037867 3300009147 Bacteria 6806
104 Ga0114129_10130407 3300009147 Bacteria 3453
105 Ga0114129_11104977 3300009147 Bacteria 992
106 Ga0105243_10471932 3300009148 Bacteria 1182
107 Ga0105248_10022053 3300009177 Bacteria 7056
108 Ga0105248_10105041 3300009177 Bacteria 3185
109 Ga0105237_10528100 3300009545 Bacteria 1187
110 Ga0105238_10153869 3300009551 Bacteria 2275
111 Ga0105249_10050774 3300009553 Bacteria 3781
112 Ga0105239_10194799 3300010375 Bacteria 2269
113 Ga0157373_10264814 3300013100 Bacteria 1216
114 Ga0157370_10231229 3300013104 Unclassified 1711
115 Ga0157369_10307522 3300013105 Bacteria 1648
116 Ga0157374_10048895 3300013296 Bacteria 3925
117 Ga0157374_10084979 3300013296 Bacteria 3008
118 Ga0157378_10085016 3300013297 Bacteria 2865
119 Ga0157378_10195005 3300013297 Bacteria 1913
120 Ga0163162_10218083 3300013306 Bacteria 2038
121 Ga0163162_10813610 3300013306 Bacteria 1051
122 Ga0163162_11496760 3300013306 Bacteria 769
123 Ga0163162_11677425 3300013306 Bacteria 726
124 Ga0157372_10016991 3300013307 Bacteria 7811
125 Ga0157375_10027830 3300013308 Bacteria 5289
126 Ga0157375_10650845 3300013308 Bacteria 1210
127 Ga0163163_10127160 3300014325 Bacteria 2587
128 Ga0157380_10036154 3300014326 Bacteria 3819
129 Ga0157379_10010630 3300014968 Bacteria 8022
130 Ga0157379_10039963 3300014968 Bacteria 4186
131 Ga0207710_10002119 3300025900 Bacteria 9371
132 Ga0207647_10057773 3300025904 Bacteria 2378
133 Ga0207684_10000765 3300025910 Bacteria 37409
134 Ga0207684_10141657 3300025910 Bacteria 2067
135 Ga0207707_10045251 3300025912 Bacteria 3836
136 Ga0207707_10534606 3300025912 Bacteria 997
137 Ga0207695_10048043 3300025913 Bacteria 4510
138 Ga0207660_10756103 3300025917 Bacteria 793
139 Ga0207662_10034461 3300025918 Bacteria 2955
140 Ga0207657_10005097 3300025919 Bacteria 13764
141 Ga0207652_10023008 3300025921 Bacteria 5162
142 Ga0207652_10037827 3300025921 Bacteria 4086
143 Ga0207652_10115549 3300025921 Unclassified 2384
144 Ga0207646_10463249 3300025922 Bacteria 1143
145 Ga0207646_10861262 3300025922 Bacteria 805
146 Ga0207650_10798822 3300025925 Bacteria 800
147 Ga0207687_10952541 3300025927 Bacteria 735
148 Ga0207644_10063919 3300025931 Bacteria 2673
149 Ga0207644_10167018 3300025931 Bacteria 1715
150 Ga0207706_10008624 3300025933 Bacteria 9396
151 Ga0207670_10000014 3300025936 Bacteria 178499
152 Ga0207670_10026539 3300025936 Bacteria 3651
153 Ga0207704_10028550 3300025938 Bacteria 3097
154 Ga0207704_10113532 3300025938 Bacteria 1837
155 Ga0207691_10072231 3300025940 Bacteria 3113
156 Ga0207711_10012533 3300025941 Bacteria 7045
157 Ga0207711_10280637 3300025941 Bacteria 1534
158 Ga0207661_10003671 3300025944 Bacteria 10695
159 Ga0207667_10198655 3300025949 Bacteria 2057
160 Ga0207667_10397336 3300025949 Bacteria 1404
161 Ga0207667_10605528 3300025949 Bacteria 1104
162 Ga0207667_11254021 3300025949 Unclassified 719
163 Ga0207712_10419073 3300025961 Bacteria 1129
164 Ga0207712_10669341 3300025961 Bacteria 903
165 Ga0207668_10381975 3300025972 Bacteria 1186
166 Ga0207640_10324522 3300025981 Bacteria 1227
167 Ga0207658_10003541 3300025986 Bacteria 11024
168 Ga0207703_10003082 3300026035 Bacteria 14098
169 Ga0207703_10021003 3300026035 Bacteria 5109
170 Ga0207639_10518066 3300026041 Bacteria 1092
171 Ga0207639_10683115 3300026041 Bacteria 951
172 Ga0207708_10011145 3300026075 Bacteria 6687
173 Ga0207708_10226364 3300026075 Bacteria 1500
174 Ga0207702_10573466 3300026078 Bacteria 1106
175 Ga0207641_10015469 3300026088 Bacteria 6251
176 Ga0207641_10051195 3300026088 Bacteria 3497
177 Ga0207648_10002530 3300026089 Bacteria 19614
178 Ga0207676_10288612 3300026095 Bacteria 1493
179 Ga0207674_10019344 3300026116 Bacteria 7377
180 Ga0207675_100081472 3300026118 Bacteria 3034
181 Ga0209974_10018049 3300027876 Bacteria 2339
182 Ga0207428_10027520 3300027907 Bacteria 4733
183 Ga0268265_10517285 3300028380 Bacteria 1127
184 Ga0268264_10016139 3300028381 Bacteria 6118
185 Ga0268264_10199778 3300028381 Bacteria 1828
186 Ga0268264_10824238 3300028381 Bacteria 928
187 Ga0265314_10089212 3300031711 Bacteria 2012
188 Ga0307406_10084766 3300031901 Bacteria 2117
189 Ga0307406_10160060 3300031901 Bacteria 1617
190 Ga0307407_10458645 3300031903 Bacteria 926
191 Ga0307414_10966589 3300032004 Bacteria 783
192 Ga0373926_0063189 3300035083 Bacteria 1352
193 Ga0373951_0003653 3300035091 Bacteria 3709
194 Ga0373923_0013426 3300035111 Bacteria 3054
195 Ga0373945_0184049 3300035116 Unclassified 861
196 Ga0373954_0115390 3300035118 Bacteria 1301
197 Ga0373956_0133560 3300035119 Bacteria 1163
198 Ga0373946_0252851 3300035171 Bacteria 860
199 Ga0373955_0368015 3300035172 Bacteria 872
200 Ga0373924_0012935 3300035410 Bacteria 3127
201 Ga0373931_0441541 3300035691 Bacteria 831
202 Ga0373935_0165102 3300035692 Bacteria 1512
203 Ga0373935_0283662 3300035692 Unclassified 1166
204 Ga0373927_0355447 3300035695 Unclassified 965
205 Ga0373933_0196308 3300035724 Bacteria 1290
206 Ga0373947_0350304 3300035725 Bacteria 991
207 Ga0373937_0110505 3300036401 Bacteria 2556
208 Ga0373925_0100916 3300037068 Bacteria 2218
209 Ga0395900_0386582 3300037418 Bacteria 1366
210 Ga0395900_0388198 3300037418 Bacteria 1363
211 Ga0395898_0655820 3300037466 Bacteria 992
212 Ga0395905_0112261 3300037471 Bacteria 2560
213 Ga0395905_0140288 3300037471 Bacteria 2274
214 Ga0436361_0841847 3300039447 Bacteria 1090
215 Ga0436363_0376412 3300039450 Bacteria 795
216 Ga0436362_0334233 3300039453 Bacteria 782
217 Ga0451853_1263326 3300041512 Bacteria 1346
218 Ga0439449_0211362 3300042007 Bacteria 727
219 Ga0439464_0040895 3300042439 Bacteria 1321
220 Ga0439460_0140137 3300042461 Bacteria 802
221 Ga0451577_0231722 3300042876 Bacteria 1670
222 Ga0451577_0499476 3300042876 Bacteria 1104
223 Ga0466961_0049563 3300044693 Bacteria 2684
224 Ga0466964_0067793 3300044706 Bacteria 1501
225 Ga0451576_0335810 3300045051 Bacteria 1582
226 Ga0466958_0072927 3300045836 Bacteria 2103
227 Ga0466967_0422014 3300045976 Bacteria 1300
228 Ga0495639_0027014 3300046475 Bacteria 2540
229 Ga0495662_0202538 3300046476 Unclassified 978
230 Ga0495664_0028480 3300046477 Bacteria 3262
231 Ga0495608_0447340 3300046511 Unclassified 786
232 Ga0495618_0014593 3300046514 Bacteria 4789
233 Ga0495628_0130412 3300046516 Bacteria 1923
234 Ga0495630_0254191 3300046517 Bacteria 1342
235 Ga0495644_0197727 3300046523 Bacteria 775
236 Ga0495652_0127346 3300046529 Bacteria 2021
237 Ga0495665_0118084 3300046531 Bacteria 1389
238 Ga0495640_0022074 3300046533 Bacteria 4661
239 Ga0495587_0125527 3300046536 Bacteria 1469
240 Ga0495621_0217454 3300046539 Bacteria 773
241 Ga0495634_0078927 3300046642 Bacteria 2156
242 Ga0495599_0066839 3300046678 Bacteria 2246
243 Ga0495646_0064163 3300046680 Bacteria 2178
244 Ga0495647_0031080 3300046681 Bacteria 1985
245 Ga0495647_0362426 3300046681 Bacteria 661
246 Ga0495613_0062725 3300046689 Bacteria 2720
247 Ga0495624_0070878 3300046690 Bacteria 2169
248 Ga0495581_0021852 3300047315 Bacteria 3709
249 Ga0495604_0285520 3300047317 Bacteria 1113
250 Ga0495674_0026305 3300047319 Bacteria 5325
251 Ga0495684_0019991 3300047471 Bacteria 5159
252 Ga0496101_0454847 3300048904 Bacteria 1010
253 Ga0496102_0041268 3300048905 Bacteria 4177
254 Ga0496102_0353155 3300048905 Bacteria 1384
255 Ga0496102_0873956 3300048905 Bacteria 821
256 Ga0496103_0089901 3300048906 Bacteria 1937
257 Ga0496104_0024010 3300048907 Bacteria 5609
258 Ga0496106_0199237 3300048909 Bacteria 1593
259 Ga0496107_0162028 3300048910 Bacteria 1658
260 Ga0496108_0606828 3300048911 Bacteria 953
261 Ga0496112_0093423 3300048915 Bacteria 2979
262 Ga0496112_0159082 3300048915 Bacteria 2225
263 Ga0496121_0034314 3300048924 Bacteria 4568
264 Ga0496125_0019020 3300048928 Bacteria 6499
265 Ga0496126_0527065 3300048929 Bacteria 941
266 Ga0501297_045204 3300049520 Bacteria 632
267 Ga0501033_0341516 3300049570 Bacteria 1050
268 Ga0501037_0083855 3300049573 Bacteria 2309
269 Ga0501039_0604174 3300049575 Bacteria 860
270 Ga0501039_0870954 3300049575 Bacteria 702
271 Ga0501043_0582745 3300049579 Bacteria 828
272 Ga0501046_0102876 3300049580 Bacteria 2190
273 Ga0501047_0016182 3300049581 Bacteria 7116
274 Ga0501070_0038271 3300049586 Bacteria 4002
275 Ga0501070_0058694 3300049586 Bacteria 3189
276 Ga0501071_0146890 3300049587 Bacteria 1758
277 Ga0501071_0398527 3300049587 Bacteria 1051
278 Ga0501072_0024347 3300049588 Bacteria 4708
279 Ga0501072_0611953 3300049588 Bacteria 859
280 Ga0501075_0367855 3300049591 Bacteria 1096
281 Ga0501076_0973126 3300049592 Bacteria 699
282 Ga0501079_0028088 3300049741 Bacteria 4316
283 Ga0501079_0208399 3300049741 Bacteria 1527
284 Ga0501079_0783582 3300049741 Bacteria 751
285 Ga0501080_0016175 3300049742 Bacteria 6887
286 Ga0501080_0256437 3300049742 Bacteria 1594
287 Ga0501080_0450193 3300049742 Bacteria 1154
288 Ga0501080_0599571 3300049742 Bacteria 978
289 Ga0501081_0076331 3300049743 Bacteria 2340
290 Ga0501081_0212343 3300049743 Bacteria 1406
291 Ga0501268_019813 3300049765 Bacteria 1142
292 Ga0501044_0605657 3300049823 Bacteria 988
293 Ga0501045_0155279 3300049824 Bacteria 1703
294 nmdc:mga05p37_11352_c1 3300050507 Bacteria 9168
295 nmdc:mga05p37_120714_c1 3300050507 Bacteria 3220
296 nmdc:mga05p37_14572_c1 3300050507 Bacteria 9442
297 nmdc:mga05p37_608689_c1 3300050507 Bacteria 1232
298 nmdc:mga05p37_81680_c1 3300050507 Bacteria 3981
299 nmdc:mga05p37_86997_c1 3300050507 Bacteria 3852
300 nmdc:mga09592_182077_c1 3300050508 Bacteria 1818
301 nmdc:mga09592_886_c1 3300050508 Bacteria 23447
302 nmdc:mga09592_97306_c1 3300050508 Unclassified 2519
303 nmdc:mga0qj67_275406_c1 3300050509 Unclassified 1364
304 nmdc:mga0qj67_9985_c1 3300050509 Bacteria 7081
305 nmdc:mga06r32_11_c1 3300050510 Bacteria 111691
306 nmdc:mga06r32_16705_c1 3300050510 Bacteria 6690
307 nmdc:mga06r32_167257_c1 3300050510 Unclassified 2182
308 nmdc:mga06r32_340299_c1 3300050510 Bacteria 1485
309 nmdc:mga06r32_60888_c1 3300050510 Bacteria 3633
310 nmdc:mga08y16_172337_c1 3300050511 Bacteria 2248
311 nmdc:mga08y16_268698_c1 3300050511 Bacteria 1761
312 nmdc:mga08y16_6733_c1 3300050511 Bacteria 12048
313 nmdc:mga0n895_3379_c1 3300050512 Bacteria 12838
314 nmdc:mga0n895_52381_c1 3300050512 Bacteria 4006
315 nmdc:mga0rr50_1338_c2 3300050513 Bacteria 6561
316 nmdc:mga0rr50_2641_c1 3300050513 Bacteria 10149
317 nmdc:mga08x19_4194_c1 3300050514 Bacteria 8539
318 nmdc:mga0a205_13931_c1 3300050515 Bacteria 7499
319 nmdc:mga0a205_50608_c1 3300050515 Bacteria 4011
320 nmdc:mga0a205_55226_c1 3300050515 Bacteria 3836
321 Ga0495601_0175665 3300053077 Bacteria 1400
322 Ga0495612_0032817 3300053078 Bacteria 2099
323 Ga0500622_0044857 3300053156 Bacteria 2290
324 Ga0501084_0051370 3300054114 Bacteria 3450
325 2644388083 2643221670 Bacteria 6497041
326 2738762562 2738541284 Bacteria 5199923
327 2918507390 2918501144 Bacteria 8668083
328 Ga0163162_10879899
329 rootH2_10145335
330 Ga0065714_10002194
331 Ga0065714_10015987
332 Ga0065714_10145642
333 Ga0065707_10016637
334 Ga0065707_10224767
335 Ga0070658_10261305
336 Ga0070683_100003782
337 Ga0070677_10400273
338 Ga0070680_100251815
339 Ga0070682_100006901
340 Ga0070682_100015604
341 Ga0070682_100295060
342 Ga0070689_100000001
343 Ga0070689_100415474
344 Ga0070661_100053207
345 Ga0070661_100223433
346 Ga0070675_100004476
347 Ga0070673_100059756
348 Ga0070659_100167372
349 Ga0070667_100029537
350 Ga0070667_100039263
351 Ga0070714_100172253
352 Ga0070700_100047398
353 Ga0070708_100016202
354 Ga0070708_100017151
355 Ga0070708_100651957
356 Ga0070708_100800918
357 Ga0070662_100024360
358 Ga0070681_10006162
359 Ga0070681_10465635
360 Ga0068867_100003362
361 Ga0070685_10361819
362 Ga0070706_100015922
363 Ga0070707_100034113
364 Ga0070707_100053002
365 Ga0070698_100086731
366 Ga0070698_100153892
367 Ga0070698_100339099
368 Ga0070699_100010533
369 Ga0070699_100341675
370 Ga0070679_100038325
371 Ga0070679_100062545
372 Ga0070679_100278374
373 Ga0070684_100460963
374 Ga0070697_100135801
375 Ga0068853_100729757
376 Ga0070695_100109571
377 Ga0070696_100055684
378 Ga0070696_100362336
379 Ga0068855_100024293
380 Ga0068855_100084305
381 Ga0068855_100094885
382 Ga0068855_100341993
383 Ga0068857_100075958
384 Ga0068856_100067565
385 Ga0068856_100704599
386 Ga0068859_100001005
387 Ga0068859_100171204
388 Ga0068864_100639722
389 Ga0068866_10138120
390 Ga0068861_100157394
391 Ga0068861_100488390
392 Ga0068863_100050850
393 Ga0068863_100686593
394 Ga0068858_100008106
395 Ga0068858_100030437
396 Ga0068860_100015667
397 Ga0068860_100048920
398 Ga0068860_100111433
399 Ga0068862_100505794
400 Ga0081455_10012865
401 Ga0081455_10027286
402 Ga0081455_10062197
403 Ga0081539_10060818
404 Ga0075365_10376079
405 Ga0075367_10428391
406 Ga0097621_100118270
407 Ga0075428_100026372
408 Ga0075430_100120405
409 Ga0075431_100000024
410 Ga0075431_100007671
411 Ga0075431_100057495
412 Ga0075431_100466091
413 Ga0075433_10023482
414 Ga0075433_10054992
415 Ga0075434_100097273
416 Ga0075429_100000773
417 Ga0075429_100007782
418 Ga0068865_100225528
419 Ga0075436_100116137
420 Ga0097620_100001005
421 Ga0097620_100171218
422 Ga0075435_100005874
423 Ga0075435_100149472
424 Ga0111539_10000102
425 Ga0111539_10099160
426 Ga0105245_10152922
427 Ga0105245_10160492
428 Ga0105247_10001170
429 Ga0114129_10006157
430 Ga0114129_10037867
431 Ga0114129_10130407
432 Ga0114129_11104977
433 Ga0105243_10471932
434 Ga0105248_10022053
435 Ga0105248_10105041
436 Ga0105237_10528100
437 Ga0105238_10153869
438 Ga0105249_10050774
439 Ga0105239_10194799
440 Ga0157373_10264814
441 Ga0157370_10231229
442 Ga0157369_10307522
443 Ga0157374_10048895
444 Ga0157374_10084979
445 Ga0157378_10085016
446 Ga0157378_10195005
447 Ga0163162_10218083
448 Ga0163162_10813610
449 Ga0163162_11496760
450 Ga0163162_11677425
451 Ga0157372_10016991
452 Ga0157375_10027830
453 Ga0157375_10650845
454 Ga0163163_10127160
455 Ga0157380_10036154
456 Ga0157379_10010630
457 Ga0157379_10039963
458 Ga0207710_10002119
459 Ga0207647_10057773
460 Ga0207684_10000765
461 Ga0207684_10141657
462 Ga0207707_10045251
463 Ga0207707_10534606
464 Ga0207695_10048043
465 Ga0207660_10756103
466 Ga0207662_10034461
467 Ga0207657_10005097
468 Ga0207652_10023008
469 Ga0207652_10037827
470 Ga0207652_10115549
471 Ga0207646_10463249
472 Ga0207646_10861262
473 Ga0207650_10798822
474 Ga0207687_10952541
475 Ga0207644_10063919
476 Ga0207644_10167018
477 Ga0207706_10008624
478 Ga0207670_10000014
479 Ga0207670_10026539
480 Ga0207704_10028550
481 Ga0207704_10113532
482 Ga0207691_10072231
483 Ga0207711_10012533
484 Ga0207711_10280637
485 Ga0207661_10003671
486 Ga0207667_10198655
487 Ga0207667_10397336
488 Ga0207667_10605528
489 Ga0207667_11254021
490 Ga0207712_10419073
491 Ga0207712_10669341
492 Ga0207668_10381975
493 Ga0207640_10324522
494 Ga0207658_10003541
495 Ga0207703_10003082
496 Ga0207703_10021003
497 Ga0207639_10518066
498 Ga0207639_10683115
499 Ga0207708_10011145
500 Ga0207708_10226364
501 Ga0207702_10573466
502 Ga0207641_10015469
503 Ga0207641_10051195
504 Ga0207648_10002530
505 Ga0207676_10288612
506 Ga0207674_10019344
507 Ga0207675_100081472
508 Ga0209974_10018049
509 Ga0207428_10027520
510 Ga0268265_10517285
511 Ga0268264_10016139
512 Ga0268264_10199778
513 Ga0268264_10824238
514 Ga0265314_10089212
515 Ga0307406_10084766
516 Ga0307406_10160060
517 Ga0307407_10458645
518 Ga0307414_10966589
519 Ga0373926_0063189
520 Ga0373951_0003653
521 Ga0373923_0013426
522 Ga0373945_0184049
523 Ga0373954_0115390
524 Ga0373956_0133560
525 Ga0373946_0252851
526 Ga0373955_0368015
527 Ga0373924_0012935
528 Ga0373931_0441541
529 Ga0373935_0165102
530 Ga0373935_0283662
531 Ga0373927_0355447
532 Ga0373933_0196308
533 Ga0373947_0350304
534 Ga0373937_0110505
535 Ga0373925_0100916
536 Ga0395900_0386582
537 Ga0395900_0388198
538 Ga0395898_0655820
539 Ga0395905_0112261
540 Ga0395905_0140288
541 Ga0436361_0841847
542 Ga0436363_0376412
543 Ga0436362_0334233
544 Ga0451853_1263326
545 Ga0439449_0211362
546 Ga0439464_0040895
547 Ga0439460_0140137
548 Ga0451577_0231722
549 Ga0451577_0499476
550 Ga0466961_0049563
551 Ga0466964_0067793
552 Ga0451576_0335810
553 Ga0466958_0072927
554 Ga0466967_0422014
555 Ga0495639_0027014
556 Ga0495662_0202538
557 Ga0495664_0028480
558 Ga0495608_0447340
559 Ga0495618_0014593
560 Ga0495628_0130412
561 Ga0495630_0254191
562 Ga0495644_0197727
563 Ga0495652_0127346
564 Ga0495665_0118084
565 Ga0495640_0022074
566 Ga0495587_0125527
567 Ga0495621_0217454
568 Ga0495634_0078927
569 Ga0495599_0066839
570 Ga0495646_0064163
571 Ga0495647_0031080
572 Ga0495647_0362426
573 Ga0495613_0062725
574 Ga0495624_0070878
575 Ga0495581_0021852
576 Ga0495604_0285520
577 Ga0495674_0026305
578 Ga0495684_0019991
579 Ga0496101_0454847
580 Ga0496102_0041268
581 Ga0496102_0353155
582 Ga0496102_0873956
583 Ga0496103_0089901
584 Ga0496104_0024010
585 Ga0496106_0199237
586 Ga0496107_0162028
587 Ga0496108_0606828
588 Ga0496112_0093423
589 Ga0496112_0159082
590 Ga0496121_0034314
591 Ga0496125_0019020
592 Ga0496126_0527065
593 Ga0501297_045204
594 Ga0501033_0341516
595 Ga0501037_0083855
596 Ga0501039_0604174
597 Ga0501039_0870954
598 Ga0501043_0582745
599 Ga0501046_0102876
600 Ga0501047_0016182
601 Ga0501070_0038271
602 Ga0501070_0058694
603 Ga0501071_0146890
604 Ga0501071_0398527
605 Ga0501072_0024347
606 Ga0501072_0611953
607 Ga0501075_0367855
608 Ga0501076_0973126
609 Ga0501079_0028088
610 Ga0501079_0208399
611 Ga0501079_0783582
612 Ga0501080_0016175
613 Ga0501080_0256437
614 Ga0501080_0450193
615 Ga0501080_0599571
616 Ga0501081_0076331
617 Ga0501081_0212343
618 Ga0501268_019813
619 Ga0501044_0605657
620 Ga0501045_0155279
621 nmdc:mga05p37_11352_c1
622 nmdc:mga05p37_120714_c1
623 nmdc:mga05p37_14572_c1
624 nmdc:mga05p37_608689_c1
625 nmdc:mga05p37_81680_c1
626 nmdc:mga05p37_86997_c1
627 nmdc:mga09592_182077_c1
628 nmdc:mga09592_886_c1
629 nmdc:mga09592_97306_c1
630 nmdc:mga0qj67_275406_c1
631 nmdc:mga0qj67_9985_c1
632 nmdc:mga06r32_11_c1
633 nmdc:mga06r32_16705_c1
634 nmdc:mga06r32_167257_c1
635 nmdc:mga06r32_340299_c1
636 nmdc:mga06r32_60888_c1
637 nmdc:mga08y16_172337_c1
638 nmdc:mga08y16_268698_c1
639 nmdc:mga08y16_6733_c1
640 nmdc:mga0n895_3379_c1
641 nmdc:mga0n895_52381_c1
642 nmdc:mga0rr50_1338_c2
643 nmdc:mga0rr50_2641_c1
644 nmdc:mga08x19_4194_c1
645 nmdc:mga0a205_13931_c1
646 nmdc:mga0a205_50608_c1
647 nmdc:mga0a205_55226_c1
648 Ga0495601_0175665
649 Ga0495612_0032817
650 Ga0500622_0044857
651 Ga0501084_0051370
652 2644388083
653 2738762562
654 2918507390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

11

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.778 20 210
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7779 21 210
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7727 20 210
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7697 20 210
4m7v-assembly1.cif.gz_A dihydrofolate reductase from enterococcus faecalis complexed with nadp(h)and rab-propyl 0.7678 21 210
ID Description Score Start End Superfamily
af_A0A1D6K465_2_75_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8499 192 207 3.30.70.100
af_Q54FJ0_879_1544_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7847 190 208 2.70.130.10
4m7vA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7678 21 210 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7656 20 207 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7613 20 207 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9375 73 207 GO:0008703
GO:0009231
AF-A0A1G3G7P7-F1-model_v4 Deaminase 0.9321 79 208 GO:0008703
GO:0009231
AF-A0A538BRR6-F1-model_v4 Dihydrofolate reductase 0.9301 74 208 GO:0008703
GO:0009231
AF-A0A6G3XUC1-F1-model_v4 Dihydrofolate reductase family protein 0.9273 87 210 GO:0008703
GO:0009231
AF-A0A535VYB9-F1-model_v4 Dihydrofolate reductase 0.9257 107 208 GO:0008703
GO:0009231

Map