F408722

General Info

Members Datasets Scaffolds Average Seq Length
327 218 318 242

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10104878|Ga0075365_101048782
Length 277
Sequence MAADRSSNGLRGRPQAGYDGLLAGLADLKNLNESDGTGMKLIKRGLLAALFAGSLCAAFSLQAQEATIRKNMAERIPQFGKIDEITKSPMTGLYEVRSGTDIIYTDAEANFIIQGSLIDAKQRRNLTEERTEKLLQVDFSALPLKDGFTIVRGNGKRRMAVFEDPNCGYCKRFERDLQKVDNVTIHMFLYPILGADSADKSRNIWCAKDKGKAWQDWMVRDQAAGSATCDTAALARNLEFGKKHKITGTPTMIFTDGSRVPGAVPVAQVEKFLTEVK

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221717 Acidovorax sp. Root267 Isolate Unclassified
6 2738543012 Acidovorax sp. CF301 Isolate Unclassified
7 2816332133 Acidovorax radicis 2721A Isolate Unclassified
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
182 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
183 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
216 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
217 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
218 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.16
Nodule 0.92
Rhizoplane 0.31
Rhizosphere 67.58
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000029 3300002704 Bacteria 118964
2 JGI25156J39149_1000272 3300002705 Bacteria 35071
3 JGI25154J39366_1000053 3300002738 Bacteria 119466
4 JGI25157J39369_1000046 3300002741 Bacteria 119470
5 JGI25150J39212_1003533 3300002774 Bacteria 3648
6 JGI25159J45721_1002528 3300002987 Bacteria 6883
7 JGI25159J45721_1004037 3300002987 Bacteria 4992
8 JGI25151J46595_10003511 3300003187 Bacteria 8633
9 JGI25151J46595_10008613 3300003187 Bacteria 4889
10 JGI25160J50197_1004647 3300003354 Bacteria 5892
11 JGI25161J50226_1000013 3300003374 Bacteria 199086
12 Ga0055526_1004155 3300003771 Bacteria 8815
13 Ga0055526_1005732 3300003771 Bacteria 7017
14 Ga0055537_1000623 3300003773 Bacteria 19351
15 Ga0055524_1000044 3300003775 Bacteria 151631
16 Ga0055534_1000397 3300003784 Bacteria 26870
17 Ga0055528_1000963 3300003790 Bacteria 19079
18 Ga0055530_10003088 3300003791 Bacteria 9896
19 Ga0055530_10035930 3300003791 Bacteria 1251
20 Ga0055540_1000063 3300003792 Bacteria 127901
21 Ga0055531_10000276 3300003794 Bacteria 52882
22 Ga0055543_1006509 3300004625 Bacteria 2812
23 Ga0065165_1023376 3300005262 Bacteria 2098
24 Ga0065165_1047536 3300005262 Bacteria 1238
25 Ga0065715_10113633 3300005293 Bacteria 2481
26 Ga0070676_10053230 3300005328 Bacteria 2383
27 Ga0070670_100071571 3300005331 Bacteria 2977
28 Ga0070670_100113851 3300005331 Bacteria 2332
29 Ga0070670_100207478 3300005331 Bacteria 1703
30 Ga0070677_10001407 3300005333 Bacteria 7662
31 Ga0068869_100782466 3300005334 Bacteria 819
32 Ga0068868_100022903 3300005338 Bacteria 4722
33 Ga0068868_100071362 3300005338 Bacteria 2770
34 Ga0068868_100816183 3300005338 Bacteria 842
35 Ga0070660_100017577 3300005339 Bacteria 5213
36 Ga0070668_100242989 3300005347 Bacteria 1492
37 Ga0070669_100021637 3300005353 Bacteria 4596
38 Ga0070669_100111276 3300005353 Bacteria 2078
39 Ga0070669_100360997 3300005353 Bacteria 1181
40 Ga0070675_100011310 3300005354 Bacteria 6985
41 Ga0070675_100140361 3300005354 Bacteria 2065
42 Ga0070671_100006290 3300005355 Bacteria 9466
43 Ga0070671_100051021 3300005355 Bacteria 3441
44 Ga0070674_100001710 3300005356 Bacteria 11893
45 Ga0070674_100074513 3300005356 Bacteria 2409
46 Ga0070673_100189969 3300005364 Bacteria 1763
47 Ga0070673_100263965 3300005364 Bacteria 1505
48 Ga0070659_100590189 3300005366 Bacteria 954
49 Ga0070700_100117242 3300005441 Bacteria 1779
50 Ga0070678_100012666 3300005456 Bacteria 5255
51 Ga0070678_100132908 3300005456 Bacteria 1980
52 Ga0070662_100223421 3300005457 Bacteria 1504
53 Ga0068867_100033315 3300005459 Bacteria 3730
54 Ga0070706_100048072 3300005467 Bacteria 3938
55 Ga0070679_100103762 3300005530 Bacteria 2829
56 Ga0070679_100179508 3300005530 Bacteria 2090
57 Ga0070672_100004302 3300005543 Bacteria 9314
58 Ga0070665_100184448 3300005548 Bacteria 2087
59 Ga0068855_100043313 3300005563 Bacteria 5332
60 Ga0068855_100120515 3300005563 Bacteria 3003
61 Ga0070664_100815526 3300005564 Bacteria 873
62 Ga0068852_100181005 3300005616 Bacteria 1982
63 Ga0068852_100208933 3300005616 Bacteria 1851
64 Ga0068864_100026910 3300005618 Bacteria 4851
65 Ga0068864_100639588 3300005618 Bacteria 1035
66 Ga0068866_10008889 3300005718 Bacteria 4250
67 Ga0068861_100093001 3300005719 Bacteria 2383
68 Ga0068863_100019027 3300005841 Bacteria 6572
69 Ga0068863_100065973 3300005841 Bacteria 3425
70 Ga0068863_100162962 3300005841 Bacteria 2137
71 Ga0068863_100601123 3300005841 Bacteria 1089
72 Ga0068863_100665088 3300005841 Bacteria 1034
73 Ga0068858_100024142 3300005842 Bacteria 5666
74 Ga0068860_100078338 3300005843 Bacteria 3143
75 Ga0068862_100093712 3300005844 Bacteria 2619
76 Ga0075365_10007414 3300006038 Bacteria 6139
77 Ga0075365_10028359 3300006038 Bacteria 3570
78 Ga0075365_10104878 3300006038 Bacteria 1939
79 Ga0075368_10026989 3300006042 Bacteria 2211
80 Ga0075364_10143169 3300006051 Bacteria 1609
81 Ga0075364_10321313 3300006051 Bacteria 1054
82 Ga0075362_10008749 3300006177 Bacteria 3889
83 Ga0075367_10139455 3300006178 Bacteria 1502
84 Ga0075366_10053001 3300006195 Bacteria 2410
85 Ga0075366_10255718 3300006195 Bacteria 1069
86 Ga0097621_100142367 3300006237 Bacteria 2050
87 Ga0079104_1030306 3300006946 Bacteria 1352
88 Ga0099826_10165921 3300006948 Bacteria 1245
89 Ga0105240_10015617 3300009093 Bacteria 10312
90 Ga0105245_10047570 3300009098 Bacteria 3835
91 Ga0105245_10054902 3300009098 Bacteria 3577
92 Ga0105245_10168762 3300009098 Bacteria 2082
93 Ga0105243_10010904 3300009148 Bacteria 6875
94 Ga0105243_10159029 3300009148 Bacteria 1946
95 Ga0105242_10000319 3300009176 Bacteria 38570
96 Ga0105248_10041053 3300009177 Bacteria 5186
97 Ga0105237_10231784 3300009545 Bacteria 1847
98 Ga0105238_10083758 3300009551 Bacteria 3178
99 Ga0105249_10100988 3300009553 Bacteria 2713
100 Ga0105239_10142093 3300010375 Bacteria 2675
101 Ga0157371_10272057 3300013102 Bacteria 1223
102 Ga0163162_10309194 3300013306 Bacteria 1713
103 Ga0157375_10029232 3300013308 Bacteria 5180
104 Ga0157375_10078426 3300013308 Bacteria 3336
105 Ga0157380_10010006 3300014326 Bacteria 6807
106 Ga0157380_10335067 3300014326 Bacteria 1409
107 Ga0157379_10042509 3300014968 Bacteria 4058
108 Ga0157379_10074993 3300014968 Bacteria 3028
109 Ga0157376_10005532 3300014969 Bacteria 8830
110 Ga0157376_10451312 3300014969 Bacteria 1254
111 Ga0163161_10065803 3300017792 Bacteria 2645
112 Ga0163161_10099478 3300017792 Bacteria 2163
113 Ga0209435_100003 3300025206 Bacteria 669534
114 Ga0207425_1000933 3300025245 Bacteria 13901
115 Ga0207425_1010274 3300025245 Bacteria 2285
116 Ga0209646_1000008 3300025246 Bacteria 669534
117 Ga0209026_1000007 3300025250 Bacteria 669534
118 Ga0209759_1000026 3300025256 Bacteria 311743
119 Ga0209129_1010834 3300025258 Bacteria 2232
120 Ga0209129_1027520 3300025258 Bacteria 972
121 Ga0209565_1000200 3300025263 Bacteria 71490
122 Ga0209565_1001022 3300025263 Bacteria 14301
123 Ga0209673_1000009 3300025273 Bacteria 620735
124 Ga0209673_1000012 3300025273 Bacteria 579480
125 Ga0209130_1000064 3300025284 Bacteria 196568
126 Ga0209130_1000225 3300025284 Bacteria 74120
127 Ga0209675_1000144 3300025291 Bacteria 94908
128 Ga0209675_1006861 3300025291 Bacteria 4485
129 Ga0209675_1010506 3300025291 Bacteria 3154
130 Ga0209675_1018958 3300025291 Bacteria 1909
131 Ga0209676_1000051 3300025292 Bacteria 389016
132 Ga0209676_1002156 3300025292 Bacteria 14892
133 Ga0209025_1001509 3300025294 Bacteria 29944
134 Ga0209025_1003958 3300025294 Bacteria 13297
135 Ga0209025_1007756 3300025294 Bacteria 7907
136 Ga0209025_1008400 3300025294 Bacteria 7443
137 Ga0209564_1000797 3300025295 Bacteria 43362
138 Ga0209564_1000945 3300025295 Bacteria 37432
139 Ga0209564_1001673 3300025295 Bacteria 21213
140 Ga0209758_1015888 3300025297 Bacteria 3865
141 Ga0209050_1000044 3300025298 Bacteria 391114
142 Ga0209050_1009483 3300025298 Bacteria 4974
143 Ga0209050_1012356 3300025298 Bacteria 3925
144 Ga0209256_1000003 3300025299 Bacteria 1661127
145 Ga0209256_1012334 3300025299 Bacteria 3292
146 Ga0209256_1031381 3300025299 Bacteria 1454
147 Ga0207426_1000116 3300025302 Bacteria 225245
148 Ga0207426_1001529 3300025302 Bacteria 18859
149 Ga0209051_1000031 3300025303 Bacteria 391114
150 Ga0209257_1000058 3300025304 Bacteria 381686
151 Ga0209257_1008829 3300025304 Bacteria 5573
152 Ga0207656_10060290 3300025321 Bacteria 1663
153 Ga0207682_10003749 3300025893 Bacteria 6532
154 Ga0207642_10043848 3300025899 Bacteria 1976
155 Ga0207680_10021894 3300025903 Bacteria 3467
156 Ga0207645_10025288 3300025907 Bacteria 3842
157 Ga0207643_10120273 3300025908 Bacteria 1555
158 Ga0207695_10068359 3300025913 Bacteria 3640
159 Ga0207660_10047513 3300025917 Bacteria 3035
160 Ga0207657_10058763 3300025919 Bacteria 3308
161 Ga0207652_10220052 3300025921 Bacteria 1711
162 Ga0207652_10324581 3300025921 Bacteria 1390
163 Ga0207681_10000880 3300025923 Bacteria 19761
164 Ga0207681_10012083 3300025923 Bacteria 5320
165 Ga0207694_10051905 3300025924 Bacteria 3178
166 Ga0207650_10004671 3300025925 Bacteria 9362
167 Ga0207650_10294776 3300025925 Bacteria 1323
168 Ga0207650_10463177 3300025925 Bacteria 1056
169 Ga0207659_10001102 3300025926 Bacteria 16008
170 Ga0207659_10178191 3300025926 Bacteria 1682
171 Ga0207687_10030099 3300025927 Bacteria 3658
172 Ga0207687_10058388 3300025927 Bacteria 2714
173 Ga0207644_10000537 3300025931 Bacteria 24617
174 Ga0207690_10497335 3300025932 Bacteria 986
175 Ga0207706_10107050 3300025933 Bacteria 2460
176 Ga0207686_10048867 3300025934 Bacteria 2623
177 Ga0207670_10247824 3300025936 Bacteria 1375
178 Ga0207669_10015461 3300025937 Bacteria 3849
179 Ga0207669_10034205 3300025937 Bacteria 2877
180 Ga0207669_10243745 3300025937 Bacteria 1334
181 Ga0207711_10057437 3300025941 Bacteria 3346
182 Ga0207711_10063136 3300025941 Bacteria 3197
183 Ga0207689_10028407 3300025942 Bacteria 4680
184 Ga0207689_10189678 3300025942 Bacteria 1696
185 Ga0207679_10576799 3300025945 Bacteria 1012
186 Ga0207667_10063994 3300025949 Bacteria 3842
187 Ga0207667_10097596 3300025949 Bacteria 3033
188 Ga0207651_10042229 3300025960 Bacteria 3033
189 Ga0207712_10070620 3300025961 Bacteria 2509
190 Ga0207668_10007781 3300025972 Bacteria 6374
191 Ga0207658_10003937 3300025986 Bacteria 10438
192 Ga0207658_10514132 3300025986 Bacteria 1068
193 Ga0207677_10071085 3300026023 Bacteria 2455
194 Ga0207677_10098435 3300026023 Bacteria 2145
195 Ga0207703_10007815 3300026035 Bacteria 8460
196 Ga0207708_10143336 3300026075 Bacteria 1876
197 Ga0207641_10008372 3300026088 Bacteria 8547
198 Ga0207641_10030954 3300026088 Bacteria 4435
199 Ga0207641_10159372 3300026088 Bacteria 2050
200 Ga0207648_10021799 3300026089 Bacteria 5756
201 Ga0207648_10092271 3300026089 Bacteria 2648
202 Ga0207675_100058635 3300026118 Bacteria 3593
203 Ga0207683_10014861 3300026121 Bacteria 6629
204 Ga0207683_10272759 3300026121 Bacteria 1545
205 Ga0207698_10143645 3300026142 Bacteria 2060
206 Ga0209971_1000744 3300027682 Bacteria 8388
207 Ga0209974_10026659 3300027876 Bacteria 1912
208 Ga0268266_10023531 3300028379 Bacteria 5243
209 Ga0268264_10016600 3300028381 Bacteria 6029
210 Ga0307517_10001975 3300028786 Bacteria 33407
211 Ga0307517_10068166 3300028786 Bacteria 3245
212 Ga0307515_10001487 3300028794 Bacteria 52645
213 Ga0307512_10028244 3300030522 Bacteria 4922
214 Ga0265330_10000044 3300031235 Bacteria 113679
215 Ga0265332_10000023 3300031238 Bacteria 211994
216 Ga0265332_10000046 3300031238 Bacteria 113777
217 Ga0265332_10000087 3300031238 Bacteria 81410
218 Ga0265332_10009255 3300031238 Bacteria 4401
219 Ga0265325_10013967 3300031241 Bacteria 4554
220 Ga0265329_10020856 3300031242 Bacteria 2208
221 Ga0265340_10006278 3300031247 Bacteria 6550
222 Ga0307513_10298093 3300031456 Bacteria 1380
223 Ga0307509_10070934 3300031507 Bacteria 3636
224 Ga0307408_100025613 3300031548 Bacteria 4041
225 Ga0307408_100583619 3300031548 Bacteria 991
226 Ga0307408_100666855 3300031548 Bacteria 931
227 Ga0307508_10010916 3300031616 Bacteria 8309
228 Ga0307508_10142912 3300031616 Bacteria 1997
229 Ga0307514_10093592 3300031649 Bacteria 2182
230 Ga0265314_10000130 3300031711 Bacteria 113776
231 Ga0265314_10005055 3300031711 Bacteria 12020
232 Ga0307405_10012257 3300031731 Bacteria 4530
233 Ga0307405_10316166 3300031731 Bacteria 1191
234 Ga0307413_10002721 3300031824 Bacteria 7253
235 Ga0307413_10059435 3300031824 Bacteria 2349
236 Ga0307410_10010493 3300031852 Bacteria 5251
237 Ga0307406_10000319 3300031901 Bacteria 28062
238 Ga0307406_10008383 3300031901 Bacteria 5764
239 Ga0307406_10079701 3300031901 Bacteria 2172
240 Ga0307406_10229742 3300031901 Bacteria 1385
241 Ga0307406_10429192 3300031901 Bacteria 1055
242 Ga0307407_10325303 3300031903 Bacteria 1080
243 Ga0307412_10142527 3300031911 Bacteria 1757
244 Ga0307412_10198600 3300031911 Bacteria 1521
245 Ga0307412_10547461 3300031911 Bacteria 971
246 Ga0307409_100127565 3300031995 Bacteria 2167
247 Ga0307416_100782343 3300032002 Bacteria 1049
248 Ga0307411_10117258 3300032005 Bacteria 1918
249 Ga0307415_100243856 3300032126 Bacteria 1455
250 Ga0395900_0539467 3300037418 Bacteria 1112
251 Ga0395898_0273424 3300037466 Bacteria 1611
252 Ga0395905_0051556 3300037471 Bacteria 3855
253 Ga0395905_0067485 3300037471 Bacteria 3350
254 Ga0395905_0163680 3300037471 Bacteria 2090
255 Ga0395905_0285373 3300037471 Bacteria 1537
256 Ga0395901_0220616 3300038443 Bacteria 1982
257 Ga0439436_0041762 3300041404 Bacteria 1312
258 Ga0451791_0550353 3300041451 Bacteria 834
259 Ga0439433_0039242 3300041999 Bacteria 1099
260 Ga0439433_0055047 3300041999 Bacteria 942
261 Ga0439449_0000682 3300042007 Bacteria 12925
262 Ga0439449_0043694 3300042007 Bacteria 1663
263 Ga0450923_014877 3300042125 Bacteria 1448
264 Ga0450897_000344 3300042128 Bacteria 2488
265 Ga0450894_002073 3300042131 Bacteria 2751
266 Ga0450903_005062 3300042138 Bacteria 2219
267 Ga0450905_019260 3300042142 Bacteria 998
268 Ga0450909_012151 3300042185 Bacteria 1262
269 Ga0439434_0015230 3300042435 Bacteria 2292
270 Ga0451577_0418159 3300042876 Bacteria 1217
271 Ga0451577_0492357 3300042876 Bacteria 1113
272 Ga0451577_0866679 3300042876 Bacteria 814
273 Ga0453683_0006494 3300044673 Bacteria 8029
274 Ga0453683_0007275 3300044673 Bacteria 7541
275 Ga0453684_0099730 3300044712 Bacteria 3556
276 Ga0453684_0194218 3300044712 Bacteria 2372
277 Ga0453684_0406978 3300044712 Bacteria 1522
278 Ga0451576_0018434 3300045051 Bacteria 7651
279 Ga0451576_0020223 3300045051 Bacteria 7250
280 Ga0451576_0111298 3300045051 Bacteria 2849
281 Ga0451576_0704009 3300045051 Bacteria 1061
282 Ga0495597_0000721 3300046542 Bacteria 26390
283 Ga0495597_0187950 3300046542 Bacteria 832
284 Ga0495656_0021184 3300046615 Bacteria 2529
285 Ga0495668_0065003 3300046616 Bacteria 2008
286 Ga0495588_0061775 3300046674 Bacteria 1941
287 Ga0495615_0027494 3300048090 Bacteria 1335
288 Ga0501033_0463485 3300049570 Bacteria 879
289 Ga0501034_0027893 3300049571 Bacteria 5742
290 Ga0501038_0347196 3300049574 Bacteria 1156
291 Ga0501043_0001042 3300049579 Bacteria 24366
292 Ga0501043_0254654 3300049579 Bacteria 1351
293 Ga0501043_0477375 3300049579 Bacteria 934
294 Ga0501046_0000137 3300049580 Bacteria 78496
295 Ga0501047_0001319 3300049581 Bacteria 24366
296 Ga0501047_0273664 3300049581 Bacteria 1534
297 Ga0501048_0008861 3300049582 Bacteria 7575
298 Ga0501223_005429 3300049663 Bacteria 2677
299 Ga0501080_0045052 3300049742 Bacteria 4106
300 Ga0501263_010096 3300049760 Bacteria 1154
301 Ga0501035_0011020 3300049822 Bacteria 8371
302 Ga0501035_0150071 3300049822 Bacteria 2023
303 Ga0501044_0166223 3300049823 Bacteria 2180
304 Ga0501045_0009289 3300049824 Bacteria 6878
305 nmdc:mga03683_10872_c1 3300050489 Bacteria 3274
306 nmdc:mga03683_202127_c1 3300050489 Bacteria 912
307 nmdc:mga03n38_70591_c1 3300050490 Bacteria 1615
308 nmdc:mga0yw44_214912_c1 3300050492 Bacteria 1273
309 nmdc:mga0yw44_8149_c1 3300050492 Bacteria 5205
310 nmdc:mga06z11_167595_c1 3300050494 Bacteria 1259
311 nmdc:mga07m45_159904_c1 3300050496 Bacteria 1307
312 Ga0500644_0006396 3300053088 Bacteria 3016
313 Ga0500583_0007234 3300053092 Bacteria 3890
314 Ga0500651_0151161 3300053093 Bacteria 1394
315 Ga0500650_0009351 3300053098 Bacteria 3930
316 Ga0500593_000865 3300053117 Bacteria 11255
317 Ga0500620_088337 3300053155 Bacteria 1079
318 Ga0500661_001743 3300055283 Bacteria 4101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0477375 Ga0501043_0477375_11_745 214
2 3300005467 Ga0070706_100048072 Ga0070706_1000480723 218
3 3300042876 Ga0451577_0492357 Ga0451577_0492357_396_1061 218
4 3300050496 nmdc:mga07m45_159904_c1 nmdc:mga07m45_159904_c1_91_882 220
5 3300042185 Ga0450909_012151 Ga0450909_012151_207_968 222
6 3300031731 Ga0307405_10316166 Ga0307405_103161662 224
7 3300042138 Ga0450903_005062 Ga0450903_005062_1180_1959 225
8 3300005334 Ga0068869_100782466 Ga0068869_1007824661 226
9 3300005338 Ga0068868_100816183 Ga0068868_1008161831 226
10 3300026023 Ga0207677_10098435 Ga0207677_100984352 226
11 3300042142 Ga0450905_019260 Ga0450905_019260_46_825 226
12 3300031548 Ga0307408_100583619 Ga0307408_1005836191 227
13 3300037471 Ga0395905_0285373 Ga0395905_0285373_240_965 227
14 3300042876 Ga0451577_0866679 Ga0451577_0866679_18_746 227
15 3300005841 Ga0068863_100665088 Ga0068863_1006650881 228
16 3300006237 Ga0097621_100142367 Ga0097621_1001423672 228
17 3300009545 Ga0105237_10231784 Ga0105237_102317843 228
18 3300031616 Ga0307508_10142912 Ga0307508_101429122 228
19 3300042128 Ga0450897_000344 Ga0450897_000344_1368_2147 228
20 3300028786 Ga0307517_10068166 Ga0307517_100681662 231
21 3300031456 Ga0307513_10298093 Ga0307513_102980932 231
22 3300045051 Ga0451576_0111298 Ga0451576_0111298_430_1170 231
23 iso_pu_bacteria 2547132374 2548497801 231
24 iso_pu_bacteria 2643221609 2644059299 231
25 iso_pu_bacteria 2643221611 2644075662 231
26 iso_pu_bacteria 2643221717 2644645192 231
27 iso_pu_bacteria 2738543012 2739240794 231
28 iso_pu_bacteria 2816332133 2816472128 231
29 iso_pu_bacteria 2894023352 2894027320 231
30 3300031507 Ga0307509_10070934 Ga0307509_100709343 232
31 3300046542 Ga0495597_0000721 Ga0495597_0000721_5351_6055 232
32 3300005338 Ga0068868_100071362 Ga0068868_1000713624 233
33 3300005347 Ga0070668_100242989 Ga0070668_1002429892 233
34 3300005353 Ga0070669_100021637 Ga0070669_1000216371 233
35 3300005354 Ga0070675_100140361 Ga0070675_1001403612 233
36 3300005356 Ga0070674_100074513 Ga0070674_1000745132 233
37 3300005441 Ga0070700_100117242 Ga0070700_1001172422 233
38 3300005456 Ga0070678_100132908 Ga0070678_1001329082 233
39 3300005457 Ga0070662_100223421 Ga0070662_1002234212 233
40 3300005564 Ga0070664_100815526 Ga0070664_1008155261 233
41 3300005616 Ga0068852_100181005 Ga0068852_1001810052 233
42 3300005718 Ga0068866_10008889 Ga0068866_100088894 233
43 3300005719 Ga0068861_100093001 Ga0068861_1000930012 233
44 3300005841 Ga0068863_100019027 Ga0068863_1000190275 233
45 3300005842 Ga0068858_100024142 Ga0068858_1000241422 233
46 3300005843 Ga0068860_100078338 Ga0068860_1000783384 233
47 3300005844 Ga0068862_100093712 Ga0068862_1000937121 233
48 3300009098 Ga0105245_10168762 Ga0105245_101687623 233
49 3300009148 Ga0105243_10010904 Ga0105243_100109041 233
50 3300009177 Ga0105248_10041053 Ga0105248_100410532 233
51 3300009553 Ga0105249_10100988 Ga0105249_101009883 233
52 3300013308 Ga0157375_10078426 Ga0157375_100784264 233
53 3300014326 Ga0157380_10010006 Ga0157380_100100065 233
54 3300014968 Ga0157379_10074993 Ga0157379_100749933 233
55 3300017792 Ga0163161_10099478 Ga0163161_100994781 233
56 3300025899 Ga0207642_10043848 Ga0207642_100438482 233
57 3300025903 Ga0207680_10021894 Ga0207680_100218942 233
58 3300025907 Ga0207645_10025288 Ga0207645_100252883 233
59 3300025923 Ga0207681_10000880 Ga0207681_100008806 233
60 3300025926 Ga0207659_10178191 Ga0207659_101781912 233
61 3300025933 Ga0207706_10107050 Ga0207706_101070502 233
62 3300025937 Ga0207669_10034205 Ga0207669_100342052 233
63 3300025941 Ga0207711_10057437 Ga0207711_100574372 233
64 3300025945 Ga0207679_10576799 Ga0207679_105767992 233
65 3300025961 Ga0207712_10070620 Ga0207712_100706203 233
66 3300025972 Ga0207668_10007781 Ga0207668_100077815 233
67 3300025986 Ga0207658_10003937 Ga0207658_100039376 233
68 3300026023 Ga0207677_10071085 Ga0207677_100710852 233
69 3300026035 Ga0207703_10007815 Ga0207703_1000781510 233
70 3300026075 Ga0207708_10143336 Ga0207708_101433361 233
71 3300026088 Ga0207641_10030954 Ga0207641_100309542 233
72 3300026089 Ga0207648_10092271 Ga0207648_100922712 233
73 3300026118 Ga0207675_100058635 Ga0207675_1000586353 233
74 3300026121 Ga0207683_10272759 Ga0207683_102727592 233
75 3300026142 Ga0207698_10143645 Ga0207698_101436452 233
76 3300028381 Ga0268264_10016600 Ga0268264_100166002 233
77 3300028786 Ga0307517_10001975 Ga0307517_1000197535 233
78 3300030522 Ga0307512_10028244 Ga0307512_100282442 233
79 3300031616 Ga0307508_10010916 Ga0307508_100109168 233
80 3300031649 Ga0307514_10093592 Ga0307514_100935922 233
81 3300046615 Ga0495656_0021184 Ga0495656_0021184_712_1449 233
82 3300048090 Ga0495615_0027494 Ga0495615_0027494_52_789 233
83 3300053092 Ga0500583_0007234 Ga0500583_0007234_1641_2375 233
84 iso_pu_bacteria 2881101125 2881104966 233
85 3300005293 Ga0065715_10113633 Ga0065715_101136332 234
86 3300005328 Ga0070676_10053230 Ga0070676_100532302 234
87 3300005331 Ga0070670_100071571 Ga0070670_1000715712 234
88 3300005331 Ga0070670_100207478 Ga0070670_1002074782 234
89 3300005333 Ga0070677_10001407 Ga0070677_100014075 234
90 3300005338 Ga0068868_100022903 Ga0068868_1000229036 234
91 3300005353 Ga0070669_100111276 Ga0070669_1001112762 234
92 3300005354 Ga0070675_100011310 Ga0070675_1000113105 234
93 3300005355 Ga0070671_100006290 Ga0070671_1000062905 234
94 3300005355 Ga0070671_100051021 Ga0070671_1000510212 234
95 3300005356 Ga0070674_100001710 Ga0070674_10000171010 234
96 3300005364 Ga0070673_100189969 Ga0070673_1001899692 234
97 3300005364 Ga0070673_100263965 Ga0070673_1002639652 234
98 3300005366 Ga0070659_100590189 Ga0070659_1005901892 234
99 3300005456 Ga0070678_100012666 Ga0070678_1000126662 234
100 3300005459 Ga0068867_100033315 Ga0068867_1000333153 234
101 3300005543 Ga0070672_100004302 Ga0070672_1000043026 234
102 3300005548 Ga0070665_100184448 Ga0070665_1001844482 234
103 3300005618 Ga0068864_100026910 Ga0068864_1000269103 234
104 3300005841 Ga0068863_100065973 Ga0068863_1000659733 234
105 3300005841 Ga0068863_100601123 Ga0068863_1006011231 234
106 3300006051 Ga0075364_10321313 Ga0075364_103213132 234
107 3300006195 Ga0075366_10255718 Ga0075366_102557182 234
108 3300009098 Ga0105245_10054902 Ga0105245_100549022 234
109 3300013102 Ga0157371_10272057 Ga0157371_102720572 234
110 3300013306 Ga0163162_10309194 Ga0163162_103091942 234
111 3300013308 Ga0157375_10029232 Ga0157375_100292322 234
112 3300014968 Ga0157379_10042509 Ga0157379_100425092 234
113 3300014969 Ga0157376_10451312 Ga0157376_104513122 234
114 3300017792 Ga0163161_10065803 Ga0163161_100658032 234
115 3300025321 Ga0207656_10060290 Ga0207656_100602902 234
116 3300025893 Ga0207682_10003749 Ga0207682_100037494 234
117 3300025908 Ga0207643_10120273 Ga0207643_101202731 234
118 3300025923 Ga0207681_10012083 Ga0207681_100120833 234
119 3300025925 Ga0207650_10004671 Ga0207650_100046717 234
120 3300025925 Ga0207650_10294776 Ga0207650_102947762 234
121 3300025926 Ga0207659_10001102 Ga0207659_1000110217 234
122 3300025927 Ga0207687_10030099 Ga0207687_100300993 234
123 3300025931 Ga0207644_10000537 Ga0207644_1000053710 234
124 3300025932 Ga0207690_10497335 Ga0207690_104973352 234
125 3300025936 Ga0207670_10247824 Ga0207670_102478242 234
126 3300025937 Ga0207669_10015461 Ga0207669_100154612 234
127 3300025942 Ga0207689_10028407 Ga0207689_100284075 234
128 3300025960 Ga0207651_10042229 Ga0207651_100422291 234
129 3300025986 Ga0207658_10514132 Ga0207658_105141321 234
130 3300026088 Ga0207641_10008372 Ga0207641_100083726 234
131 3300026089 Ga0207648_10021799 Ga0207648_100217993 234
132 3300026121 Ga0207683_10014861 Ga0207683_100148615 234
133 3300028379 Ga0268266_10023531 Ga0268266_100235313 234
134 3300031238 Ga0265332_10009255 Ga0265332_100092552 234
135 3300031242 Ga0265329_10020856 Ga0265329_100208562 234
136 3300031548 Ga0307408_100666855 Ga0307408_1006668552 234
137 3300031711 Ga0265314_10005055 Ga0265314_100050556 234
138 3300031731 Ga0307405_10012257 Ga0307405_100122572 234
139 3300031824 Ga0307413_10002721 Ga0307413_100027212 234
140 3300031824 Ga0307413_10059435 Ga0307413_100594352 234
141 3300031852 Ga0307410_10010493 Ga0307410_100104931 234
142 3300031901 Ga0307406_10079701 Ga0307406_100797012 234
143 3300031903 Ga0307407_10325303 Ga0307407_103253032 234
144 3300031911 Ga0307412_10198600 Ga0307412_101986002 234
145 3300031995 Ga0307409_100127565 Ga0307409_1001275652 234
146 3300032005 Ga0307411_10117258 Ga0307411_101172582 234
147 3300032126 Ga0307415_100243856 Ga0307415_1002438562 234
148 3300037471 Ga0395905_0051556 Ga0395905_0051556_891_1610 234
149 3300037471 Ga0395905_0067485 Ga0395905_0067485_1896_2639 234
150 3300042876 Ga0451577_0418159 Ga0451577_0418159_15_734 234
151 3300044673 Ga0453683_0006494 Ga0453683_0006494_6768_7532 234
152 3300044712 Ga0453684_0099730 Ga0453684_0099730_1199_1963 234
153 3300044712 Ga0453684_0406978 Ga0453684_0406978_661_1380 234
154 3300045051 Ga0451576_0020223 Ga0451576_0020223_4294_5058 234
155 3300046542 Ga0495597_0187950 Ga0495597_0187950_20_748 234
156 3300046616 Ga0495668_0065003 Ga0495668_0065003_388_1116 234
157 3300049570 Ga0501033_0463485 Ga0501033_0463485_60_830 234
158 3300049571 Ga0501034_0027893 Ga0501034_0027893_1785_2510 234
159 3300049574 Ga0501038_0347196 Ga0501038_0347196_396_1121 234
160 3300049579 Ga0501043_0254654 Ga0501043_0254654_12_737 234
161 3300049581 Ga0501047_0273664 Ga0501047_0273664_396_1121 234
162 3300049742 Ga0501080_0045052 Ga0501080_0045052_1991_2716 234
163 3300049822 Ga0501035_0011020 Ga0501035_0011020_4292_5017 234
164 3300049823 Ga0501044_0166223 Ga0501044_0166223_868_1593 234
165 3300009176 Ga0105242_10000319 Ga0105242_100003193 235
166 3300025934 Ga0207686_10048867 Ga0207686_100488672 235
167 3300027682 Ga0209971_1000744 Ga0209971_10007445 235
168 3300027876 Ga0209974_10026659 Ga0209974_100266592 235
169 3300031235 Ga0265330_10000044 Ga0265330_1000004426 235
170 3300031238 Ga0265332_10000046 Ga0265332_1000004670 235
171 3300031241 Ga0265325_10013967 Ga0265325_100139675 235
172 3300031247 Ga0265340_10006278 Ga0265340_100062783 235
173 3300031711 Ga0265314_10000130 Ga0265314_1000013026 235
174 3300031901 Ga0307406_10000319 Ga0307406_1000031923 235
175 3300041999 Ga0439433_0039242 Ga0439433_0039242_277_987 235
176 3300042007 Ga0439449_0000682 Ga0439449_0000682_10298_11008 235
177 3300042125 Ga0450923_014877 Ga0450923_014877_151_924 235
178 3300049663 Ga0501223_005429 Ga0501223_005429_1695_2468 235
179 iso_pu_bacteria 2511231002 2511243618 235
180 3300005530 Ga0070679_100179508 Ga0070679_1001795082 236
181 3300005618 Ga0068864_100639588 Ga0068864_1006395882 236
182 3300006038 Ga0075365_10007414 Ga0075365_100074144 236
183 3300006038 Ga0075365_10028359 Ga0075365_100283593 236
184 3300006038 Ga0075365_10104878 Ga0075365_101048782 236
185 3300006042 Ga0075368_10026989 Ga0075368_100269892 236
186 3300006177 Ga0075362_10008749 Ga0075362_100087492 236
187 3300006178 Ga0075367_10139455 Ga0075367_101394552 236
188 3300006195 Ga0075366_10053001 Ga0075366_100530013 236
189 3300014326 Ga0157380_10335067 Ga0157380_103350672 236
190 3300025921 Ga0207652_10324581 Ga0207652_103245812 236
191 3300031238 Ga0265332_10000023 Ga0265332_1000002364 236
192 3300037418 Ga0395900_0539467 Ga0395900_0539467_306_1031 236
193 3300037466 Ga0395898_0273424 Ga0395898_0273424_154_879 236
194 3300037471 Ga0395905_0163680 Ga0395905_0163680_1298_2023 236
195 3300038443 Ga0395901_0220616 Ga0395901_0220616_94_819 236
196 3300044712 Ga0453684_0194218 Ga0453684_0194218_1059_1784 236
197 3300045051 Ga0451576_0704009 Ga0451576_0704009_192_923 236
198 3300046674 Ga0495588_0061775 Ga0495588_0061775_276_995 236
199 3300049579 Ga0501043_0001042 Ga0501043_0001042_4248_4991 236
200 3300049580 Ga0501046_0000137 Ga0501046_0000137_73551_74294 236
201 3300049581 Ga0501047_0001319 Ga0501047_0001319_4248_4991 236
202 3300049582 Ga0501048_0008861 Ga0501048_0008861_2185_2928 236
203 3300049824 Ga0501045_0009289 Ga0501045_0009289_3881_4624 236
204 3300050489 nmdc:mga03683_10872_c1 nmdc:mga03683_10872_c1_2334_3143 236
205 3300050489 nmdc:mga03683_202127_c1 nmdc:mga03683_202127_c1_25_750 236
206 3300050492 nmdc:mga0yw44_214912_c1 nmdc:mga0yw44_214912_c1_281_1000 236
207 3300050492 nmdc:mga0yw44_8149_c1 nmdc:mga0yw44_8149_c1_2898_3623 236
208 3300050494 nmdc:mga06z11_167595_c1 nmdc:mga06z11_167595_c1_267_1076 236
209 3300053155 Ga0500620_088337 Ga0500620_088337_200_916 236
210 3300005331 Ga0070670_100113851 Ga0070670_1001138512 237
211 3300005339 Ga0070660_100017577 Ga0070660_1000175772 237
212 3300005353 Ga0070669_100360997 Ga0070669_1003609972 237
213 3300005530 Ga0070679_100103762 Ga0070679_1001037622 237
214 3300005563 Ga0068855_100043313 Ga0068855_1000433132 237
215 3300005563 Ga0068855_100120515 Ga0068855_1001205152 237
216 3300005616 Ga0068852_100208933 Ga0068852_1002089332 237
217 3300005841 Ga0068863_100162962 Ga0068863_1001629622 237
218 3300009093 Ga0105240_10015617 Ga0105240_100156175 237
219 3300009098 Ga0105245_10047570 Ga0105245_100475702 237
220 3300009148 Ga0105243_10159029 Ga0105243_101590292 237
221 3300009551 Ga0105238_10083758 Ga0105238_100837583 237
222 3300010375 Ga0105239_10142093 Ga0105239_101420932 237
223 3300014969 Ga0157376_10005532 Ga0157376_100055325 237
224 3300025913 Ga0207695_10068359 Ga0207695_100683593 237
225 3300025917 Ga0207660_10047513 Ga0207660_100475132 237
226 3300025919 Ga0207657_10058763 Ga0207657_100587632 237
227 3300025921 Ga0207652_10220052 Ga0207652_102200522 237
228 3300025924 Ga0207694_10051905 Ga0207694_100519052 237
229 3300025925 Ga0207650_10463177 Ga0207650_104631772 237
230 3300025927 Ga0207687_10058388 Ga0207687_100583882 237
231 3300025937 Ga0207669_10243745 Ga0207669_102437452 237
232 3300025941 Ga0207711_10063136 Ga0207711_100631362 237
233 3300025942 Ga0207689_10189678 Ga0207689_101896782 237
234 3300025949 Ga0207667_10063994 Ga0207667_100639942 237
235 3300025949 Ga0207667_10097596 Ga0207667_100975963 237
236 3300026088 Ga0207641_10159372 Ga0207641_101593722 237
237 3300031901 Ga0307406_10229742 Ga0307406_102297422 237
238 3300031901 Ga0307406_10429192 Ga0307406_104291922 237
239 3300031911 Ga0307412_10142527 Ga0307412_101425271 237
240 3300031911 Ga0307412_10547461 Ga0307412_105474611 237
241 3300041404 Ga0439436_0041762 Ga0439436_0041762_268_1047 237
242 3300041999 Ga0439433_0055047 Ga0439433_0055047_59_778 237
243 3300042007 Ga0439449_0043694 Ga0439449_0043694_352_1071 237
244 3300042131 Ga0450894_002073 Ga0450894_002073_1430_2209 237
245 3300042435 Ga0439434_0015230 Ga0439434_0015230_216_995 237
246 3300044673 Ga0453683_0007275 Ga0453683_0007275_1746_2531 237
247 3300045051 Ga0451576_0018434 Ga0451576_0018434_5011_5796 237
248 3300049760 Ga0501263_010096 Ga0501263_010096_236_952 237
249 3300049822 Ga0501035_0150071 Ga0501035_0150071_549_1319 237
250 3300028794 Ga0307515_10001487 Ga0307515_100014876 238
251 3300041451 Ga0451791_0550353 Ga0451791_0550353_21_749 238
252 3300053088 Ga0500644_0006396 Ga0500644_0006396_607_1362 238
253 3300053098 Ga0500650_0009351 Ga0500650_0009351_2423_3178 238
254 3300053117 Ga0500593_000865 Ga0500593_000865_7207_7962 238
255 3300055283 Ga0500661_001743 Ga0500661_001743_3220_3975 238
256 3300002704 JGI25155J39150_1000029 JGI25155J39150_100002911 239
257 3300002705 JGI25156J39149_1000272 JGI25156J39149_100027211 239
258 3300002738 JGI25154J39366_1000053 JGI25154J39366_100005398 239
259 3300002741 JGI25157J39369_1000046 JGI25157J39369_100004611 239
260 3300002774 JGI25150J39212_1003533 JGI25150J39212_10035332 239
261 3300002987 JGI25159J45721_1002528 JGI25159J45721_10025283 239
262 3300002987 JGI25159J45721_1004037 JGI25159J45721_10040371 239
263 3300003187 JGI25151J46595_10003511 JGI25151J46595_100035114 239
264 3300003187 JGI25151J46595_10008613 JGI25151J46595_100086134 239
265 3300003354 JGI25160J50197_1004647 JGI25160J50197_10046475 239
266 3300003374 JGI25161J50226_1000013 JGI25161J50226_1000013174 239
267 3300003771 Ga0055526_1004155 Ga0055526_10041554 239
268 3300003771 Ga0055526_1005732 Ga0055526_10057326 239
269 3300003773 Ga0055537_1000623 Ga0055537_100062313 239
270 3300003775 Ga0055524_1000044 Ga0055524_100004479 239
271 3300003784 Ga0055534_1000397 Ga0055534_100039719 239
272 3300003790 Ga0055528_1000963 Ga0055528_100096318 239
273 3300003791 Ga0055530_10003088 Ga0055530_100030885 239
274 3300003791 Ga0055530_10035930 Ga0055530_100359301 239
275 3300003792 Ga0055540_1000063 Ga0055540_100006389 239
276 3300003794 Ga0055531_10000276 Ga0055531_1000027637 239
277 3300004625 Ga0055543_1006509 Ga0055543_10065091 239
278 3300005262 Ga0065165_1023376 Ga0065165_10233762 239
279 3300005262 Ga0065165_1047536 Ga0065165_10475362 239
280 3300006051 Ga0075364_10143169 Ga0075364_101431692 239
281 3300006946 Ga0079104_1030306 Ga0079104_10303062 239
282 3300006948 Ga0099826_10165921 Ga0099826_101659212 239
283 3300025206 Ga0209435_100003 Ga0209435_100003269 239
284 3300025245 Ga0207425_1000933 Ga0207425_100093311 239
285 3300025245 Ga0207425_1010274 Ga0207425_10102742 239
286 3300025246 Ga0209646_1000008 Ga0209646_1000008269 239
287 3300025250 Ga0209026_1000007 Ga0209026_1000007269 239
288 3300025256 Ga0209759_1000026 Ga0209759_100002611 239
289 3300025258 Ga0209129_1010834 Ga0209129_10108341 239
290 3300025258 Ga0209129_1027520 Ga0209129_10275201 239
291 3300025263 Ga0209565_1000200 Ga0209565_100020017 239
292 3300025263 Ga0209565_1001022 Ga0209565_100102211 239
293 3300025273 Ga0209673_1000009 Ga0209673_1000009492 239
294 3300025273 Ga0209673_1000012 Ga0209673_1000012393 239
295 3300025284 Ga0209130_1000064 Ga0209130_1000064108 239
296 3300025284 Ga0209130_1000225 Ga0209130_100022547 239
297 3300025291 Ga0209675_1000144 Ga0209675_100014457 239
298 3300025291 Ga0209675_1006861 Ga0209675_10068614 239
299 3300025291 Ga0209675_1010506 Ga0209675_10105062 239
300 3300025291 Ga0209675_1018958 Ga0209675_10189581 239
301 3300025292 Ga0209676_1000051 Ga0209676_1000051257 239
302 3300025292 Ga0209676_1002156 Ga0209676_100215611 239
303 3300025294 Ga0209025_1001509 Ga0209025_10015094 239
304 3300025294 Ga0209025_1003958 Ga0209025_100395813 239
305 3300025294 Ga0209025_1007756 Ga0209025_10077566 239
306 3300025294 Ga0209025_1008400 Ga0209025_10084004 239
307 3300025295 Ga0209564_1000797 Ga0209564_100079713 239
308 3300025295 Ga0209564_1000945 Ga0209564_100094513 239
309 3300025295 Ga0209564_1001673 Ga0209564_100167311 239
310 3300025297 Ga0209758_1015888 Ga0209758_10158884 239
311 3300025298 Ga0209050_1000044 Ga0209050_100004489 239
312 3300025298 Ga0209050_1009483 Ga0209050_10094831 239
313 3300025298 Ga0209050_1012356 Ga0209050_10123563 239
314 3300025299 Ga0209256_1000003 Ga0209256_1000003647 239
315 3300025299 Ga0209256_1012334 Ga0209256_10123342 239
316 3300025299 Ga0209256_1031381 Ga0209256_10313812 239
317 3300025302 Ga0207426_1000116 Ga0207426_100011685 239
318 3300025302 Ga0207426_1001529 Ga0207426_10015298 239
319 3300025303 Ga0209051_1000031 Ga0209051_100003189 239
320 3300025304 Ga0209257_1000058 Ga0209257_100005883 239
321 3300025304 Ga0209257_1008829 Ga0209257_10088294 239
322 3300031238 Ga0265332_10000087 Ga0265332_1000008720 239
323 3300031548 Ga0307408_100025613 Ga0307408_1000256132 239
324 3300031901 Ga0307406_10008383 Ga0307406_100083833 239
325 3300032002 Ga0307416_100782343 Ga0307416_1007823432 239
326 3300050490 nmdc:mga03n38_70591_c1 nmdc:mga03n38_70591_c1_544_1302 239
327 3300053093 Ga0500651_0151161 Ga0500651_0151161_311_1030 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13098

Thioredoxin_2

Thioredoxin-like domain

151

273

0.98

PF10411

DsbC_N

Disulfide bond isomerase protein N-terminal domain

59

128

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gv1-assembly1.cif.gz_A crystal structure of disulfide interchange protein from neisseria gonorrhoeae 0.9483 102 239
3gv1-assembly1.cif.gz_A crystal structure of disulfide interchange protein from neisseria gonorrhoeae 0.9288 102 239
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.8191 106 239
6mhh-assembly1.cif.gz_A-3 proteus mirabilis scsc linker (residues 39-49) deletion and n6k mutant 0.8124 106 237
2iyj-assembly1.cif.gz_B crystal structure of the n-terminal dimer domain of e.coli dsbc 0.7956 22 93
ID Description Score Start End Superfamily
3gv1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.926 104 239 3.40.30.10
3gv1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9129 104 239 3.40.30.10
4npbB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8414 108 232 3.40.30.10
4mlyA02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8246 108 234 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8102 106 238 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A519ZB64-F1-model_v4 Thiol:disulfide interchange protein 0.9931 119 236 GO:0042597
AF-A0A158G958-F1-model_v4 Thiol:disulfide interchange protein 0.983 96 233 GO:0042597
AF-A0A3E1R979-F1-model_v4 Thiol:disulfide interchange protein 0.9775 16 236 GO:0016853
GO:0042597
AF-A0A0L0MFP1-F1-model_v4 Thiol:disulfide interchange protein 0.9772 96 235 GO:0042597
AF-A0A257LMM0-F1-model_v4 Thiol:disulfide interchange protein 0.9748 100 236 GO:0042597

Feature Viewer

pLDDT pTM Quality
90.9 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map