F408609

General Info

Members Datasets Scaffolds Average Seq Length
327 179 654 257

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10103375|rootH1_101033752
Length 289
Sequence MEATTIGHNRTGTAMSPIDVKAMTEAADALSPAMPIDTTAMDAERMTYINDADAVGSIPPPASMKGMLKAGMAKIKGGAPSLFMDKIGERIAFERAGTRLYEALITKYEAVQGLGTEALSPADRLPAADGAAAPGTLQRIRMEELQHFRMLCEAMQKMGGDPTAQTPSADVTGVESLGLVQVLNDPRTSLAQSLHALLTVELADRAGWETLIALAGEANQDDLVAGFTLALEDEHRHLVLVQGWYHEAIGLTPIPGMLPPGGSAGLPPDSTTAPTTSPDVTTPGPGADI

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2643221556 Massilia sp. Root1485 Isolate Unclassified
177 2643221684 Massilia sp. Root133 Isolate Unclassified
178 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
179 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 1.53
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 2.45
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10103375 3300003323 Bacteria 1474
2 Ga0006778J45830_1046373 3300003162 Bacteria 2250
3 Ga0006777J48905_1004468 3300003308 Bacteria 2480
4 rootL2_10019940 3300003322 Bacteria 5524
5 rootL2_10176139 3300003322 Bacteria 2454
6 Ga0007416J51690_1006144 3300003577 Bacteria 2311
7 Ga0055542_1010423 3300003762 Bacteria 1698
8 Ga0065712_10233830 3300005290 Bacteria 1003
9 Ga0070658_10014819 3300005327 Bacteria 6247
10 Ga0070676_10005280 3300005328 Bacteria 6869
11 Ga0070683_100018102 3300005329 Bacteria 6235
12 Ga0070670_100009652 3300005331 Bacteria 8237
13 Ga0068869_100026492 3300005334 Bacteria 4037
14 Ga0070675_100012644 3300005354 Bacteria 6622
15 Ga0070671_100010604 3300005355 Bacteria 7398
16 Ga0070673_100014429 3300005364 Bacteria 5504
17 Ga0070667_100161617 3300005367 Bacteria 1973
18 Ga0070662_100090854 3300005457 Bacteria 2293
19 Ga0070681_10013252 3300005458 Bacteria 8192
20 Ga0068867_100003068 3300005459 Bacteria 11772
21 Ga0070684_100219468 3300005535 Bacteria 1735
22 Ga0068855_100004035 3300005563 Bacteria 17925
23 Ga0070664_100278766 3300005564 Bacteria 1507
24 Ga0068857_100024948 3300005577 Bacteria 5266
25 Ga0068857_100481755 3300005577 Unclassified 1163
26 Ga0068854_100090722 3300005578 Bacteria 2273
27 Ga0081538_10028752 3300005981 Bacteria 3814
28 Ga0075363_100016096 3300006048 Bacteria 3690
29 Ga0075428_100100646 3300006844 Bacteria 3151
30 Ga0075430_100030309 3300006846 Bacteria 4593
31 Ga0075429_100098218 3300006880 Bacteria 2555
32 Ga0105245_10147075 3300009098 Bacteria 2224
33 Ga0105243_10298600 3300009148 Bacteria 1459
34 Ga0105241_10009805 3300009174 Bacteria 7038
35 Ga0105237_10184318 3300009545 Bacteria 2087
36 Ga0105238_10031144 3300009551 Bacteria 5430
37 Ga0105246_10310104 3300011119 Bacteria 1278
38 Ga0157375_10017731 3300013308 Bacteria 6435
39 Ga0163163_10287492 3300014325 Bacteria 1696
40 Ga0209148_1000563 3300025254 Bacteria 34884
41 Ga0207645_10009539 3300025907 Bacteria 6707
42 Ga0207705_10073832 3300025909 Bacteria 2475
43 Ga0207705_10232034 3300025909 Bacteria 1404
44 Ga0207657_10051509 3300025919 Bacteria 3578
45 Ga0207650_10179985 3300025925 Bacteria 1684
46 Ga0207659_10009541 3300025926 Bacteria 6070
47 Ga0207687_10090996 3300025927 Bacteria 2224
48 Ga0207644_10264067 3300025931 Bacteria 1377
49 Ga0207706_10108896 3300025933 Bacteria 2438
50 Ga0207706_10524750 3300025933 Unclassified 1021
51 Ga0207689_10045559 3300025942 Bacteria 3626
52 Ga0207679_10222420 3300025945 Bacteria 1589
53 Ga0207667_10003182 3300025949 Bacteria 20300
54 Ga0207651_10007824 3300025960 Bacteria 5721
55 Ga0207640_10485490 3300025981 Bacteria 1026
56 Ga0207648_10013053 3300026089 Bacteria 7747
57 Ga0207674_10065643 3300026116 Bacteria 3657
58 Ga0207674_10501616 3300026116 Unclassified 1173
59 Ga0209974_10014933 3300027876 Bacteria 2579
60 Ga0316178_1148472 3300030735 Bacteria 2247
61 Ga0307408_100000754 3300031548 Bacteria 26065
62 Ga0307408_100072625 3300031548 Bacteria 2548
63 Ga0307413_10065713 3300031824 Bacteria 2260
64 Ga0307406_10000848 3300031901 Bacteria 17206
65 Ga0307409_100021792 3300031995 Bacteria 4402
66 Ga0307416_100106674 3300032002 Bacteria 2456
67 Ga0395899_0000012 3300037312 Bacteria 517561
68 Ga0395899_0008642 3300037312 Bacteria 7834
69 Ga0395899_0092403 3300037312 Bacteria 2191
70 Ga0395900_0000028 3300037418 Bacteria 285042
71 Ga0395900_0197965 3300037418 Bacteria 2034
72 Ga0395900_0583463 3300037418 Bacteria 1060
73 Ga0395898_0094965 3300037466 Bacteria 2865
74 Ga0395898_0228578 3300037466 Bacteria 1774
75 Ga0395901_0000025 3300038443 Bacteria 263463
76 Ga0395901_0146290 3300038443 Bacteria 2483
77 Ga0395901_0309760 3300038443 Bacteria 1635
78 Ga0395901_0350174 3300038443 Bacteria 1524
79 Ga0439449_0004907 3300042007 Bacteria 5150
80 Ga0439450_007729 3300042008 Bacteria 1981
81 Ga0439455_0016685 3300042012 Bacteria 1702
82 Ga0439458_0011386 3300042157 Bacteria 1989
83 Ga0439458_0022857 3300042157 Bacteria 1455
84 Ga0466969_0028849 3300044656 Bacteria 2836
85 Ga0466969_0226145 3300044656 Bacteria 850
86 Ga0466972_0006353 3300044658 Bacteria 5937
87 Ga0466972_0021742 3300044658 Bacteria 3196
88 Ga0466965_0013836 3300044683 Bacteria 3811
89 Ga0466965_0015205 3300044683 Bacteria 3655
90 Ga0466966_0017413 3300044684 Bacteria 4748
91 Ga0466966_0050251 3300044684 Bacteria 2653
92 Ga0466961_0070261 3300044693 Bacteria 2222
93 Ga0466964_0000940 3300044706 Bacteria 9630
94 Ga0466964_0008698 3300044706 Bacteria 3816
95 Ga0466964_0018577 3300044706 Bacteria 2669
96 Ga0466968_0002631 3300044735 Bacteria 6607
97 Ga0466968_0042818 3300044735 Bacteria 1915
98 Ga0466970_0130142 3300044765 Bacteria 1382
99 Ga0466957_0000097 3300044842 Bacteria 35043
100 Ga0466957_0066953 3300044842 Bacteria 2215
101 Ga0466957_0069323 3300044842 Bacteria 2178
102 Ga0466960_0091805 3300044901 Bacteria 1549
103 Ga0466959_0029451 3300045049 Bacteria 4067
104 Ga0466959_0159467 3300045049 Bacteria 1586
105 Ga0466958_0043932 3300045836 Bacteria 2692
106 Ga0495617_000572 3300046452 Bacteria 18915
107 Ga0495603_0013247 3300046455 Bacteria 4986
108 Ga0495603_0227432 3300046455 Bacteria 1076
109 Ga0495629_0009491 3300046459 Bacteria 7113
110 Ga0495629_0094861 3300046459 Bacteria 2082
111 Ga0495638_0001036 3300046460 Bacteria 27487
112 Ga0495638_0173154 3300046460 Bacteria 1237
113 Ga0495653_0040253 3300046463 Bacteria 3653
114 Ga0495582_0093421 3300046473 Bacteria 1679
115 Ga0495605_0000419 3300046474 Bacteria 38606
116 Ga0495584_0000001 3300046491 Bacteria 649329
117 Ga0495584_0000750 3300046491 Bacteria 21431
118 Ga0495584_0001146 3300046491 Bacteria 16371
119 Ga0495584_0003747 3300046491 Bacteria 8284
120 Ga0495584_0028900 3300046491 Bacteria 2810
121 Ga0495584_0084533 3300046491 Bacteria 1598
122 Ga0495584_0086594 3300046491 Bacteria 1579
123 Ga0495584_0088069 3300046491 Bacteria 1565
124 Ga0495585_0000126 3300046492 Bacteria 82816
125 Ga0495585_0000161 3300046492 Bacteria 71753
126 Ga0495585_0001579 3300046492 Bacteria 17716
127 Ga0495585_0001582 3300046492 Bacteria 17662
128 Ga0495585_0015552 3300046492 Bacteria 4421
129 Ga0495585_0029612 3300046492 Bacteria 3116
130 Ga0495585_0036026 3300046492 Bacteria 2794
131 Ga0495585_0042283 3300046492 Bacteria 2553
132 Ga0495585_0083066 3300046492 Bacteria 1733
133 Ga0495585_0095544 3300046492 Bacteria 1596
134 Ga0495594_0000291 3300046499 Bacteria 24617
135 Ga0495594_0112227 3300046499 Bacteria 1537
136 Ga0495596_0000351 3300046500 Bacteria 29830
137 Ga0495596_0001813 3300046500 Bacteria 11872
138 Ga0495596_0011719 3300046500 Bacteria 3768
139 Ga0495596_0039596 3300046500 Bacteria 1861
140 Ga0495607_0002372 3300046501 Bacteria 15372
141 Ga0495607_0007641 3300046501 Bacteria 7448
142 Ga0495583_0000786 3300046506 Bacteria 39550
143 Ga0495583_0059620 3300046506 Bacteria 1709
144 Ga0495583_0060359 3300046506 Bacteria 1695
145 Ga0495606_0003947 3300046507 Bacteria 15245
146 Ga0495606_0004294 3300046507 Bacteria 14362
147 Ga0495606_0064390 3300046507 Bacteria 2333
148 Ga0495606_0128844 3300046507 Bacteria 1506
149 Ga0495606_0178198 3300046507 Bacteria 1227
150 Ga0495606_0209231 3300046507 Bacteria 1106
151 Ga0495616_0009144 3300046513 Bacteria 5813
152 Ga0495616_0010348 3300046513 Bacteria 5404
153 Ga0495616_0010692 3300046513 Bacteria 5298
154 Ga0495616_0036032 3300046513 Bacteria 2555
155 Ga0495620_0013562 3300046515 Bacteria 4170
156 Ga0495630_0020748 3300046517 Bacteria 4848
157 Ga0495631_0015418 3300046518 Bacteria 3662
158 Ga0495631_0026195 3300046518 Bacteria 2680
159 Ga0495631_0052711 3300046518 Bacteria 1776
160 Ga0495632_0004702 3300046519 Bacteria 9224
161 Ga0495643_0006886 3300046522 Bacteria 7405
162 Ga0495643_0049537 3300046522 Bacteria 2265
163 Ga0495643_0061766 3300046522 Bacteria 1985
164 Ga0495643_0086588 3300046522 Bacteria 1622
165 Ga0495644_0021399 3300046523 Bacteria 2467
166 Ga0495644_0086115 3300046523 Bacteria 1184
167 Ga0495644_0185890 3300046523 Bacteria 799
168 Ga0495648_0000202 3300046524 Bacteria 69075
169 Ga0495648_0027360 3300046524 Bacteria 3819
170 Ga0495648_0028207 3300046524 Bacteria 3743
171 Ga0495663_0004302 3300046525 Bacteria 4013
172 Ga0495663_0035442 3300046525 Bacteria 1499
173 Ga0495666_0001389 3300046526 Bacteria 11752
174 Ga0495666_0021005 3300046526 Bacteria 3233
175 Ga0495666_0026977 3300046526 Bacteria 2827
176 Ga0495642_0000300 3300046528 Bacteria 27947
177 Ga0495642_0009897 3300046528 Bacteria 3652
178 Ga0495642_0012067 3300046528 Bacteria 3329
179 Ga0495642_0029434 3300046528 Bacteria 2192
180 Ga0495642_0048527 3300046528 Bacteria 1742
181 Ga0495642_0053861 3300046528 Bacteria 1658
182 Ga0495642_0081089 3300046528 Bacteria 1366
183 Ga0495665_0013377 3300046531 Bacteria 4438
184 Ga0495665_0038487 3300046531 Bacteria 2549
185 Ga0495586_0176626 3300046535 Bacteria 1207
186 Ga0495587_0055952 3300046536 Bacteria 2321
187 Ga0495609_0017090 3300046538 Bacteria 3373
188 Ga0495609_0067168 3300046538 Bacteria 1579
189 Ga0495609_0106132 3300046538 Bacteria 1214
190 Ga0495597_0008132 3300046542 Bacteria 5276
191 Ga0495597_0008270 3300046542 Bacteria 5218
192 Ga0495597_0086545 3300046542 Bacteria 1334
193 Ga0495645_0168701 3300046543 Bacteria 1508
194 Ga0495633_0017141 3300046558 Bacteria 3712
195 Ga0495633_0018773 3300046558 Bacteria 3506
196 Ga0495633_0024795 3300046558 Bacteria 2959
197 Ga0495633_0101511 3300046558 Bacteria 1335
198 Ga0495633_0107570 3300046558 Bacteria 1293
199 Ga0495668_0005585 3300046616 Bacteria 8457
200 Ga0495668_0012197 3300046616 Bacteria 5108
201 Ga0495668_0083088 3300046616 Bacteria 1756
202 Ga0495611_0008211 3300046648 Bacteria 4430
203 Ga0495611_0011091 3300046648 Bacteria 3817
204 Ga0495611_0034145 3300046648 Bacteria 2247
205 Ga0495611_0086136 3300046648 Bacteria 1449
206 Ga0495611_0208354 3300046648 Bacteria 911
207 Ga0495625_0020016 3300046660 Bacteria 5174
208 Ga0495625_0021386 3300046660 Bacteria 4983
209 Ga0495661_0007001 3300046665 Bacteria 7886
210 Ga0495661_0019695 3300046665 Bacteria 4417
211 Ga0495661_0031437 3300046665 Bacteria 3369
212 Ga0495661_0032277 3300046665 Bacteria 3311
213 Ga0495661_0041927 3300046665 Bacteria 2826
214 Ga0495661_0045057 3300046665 Bacteria 2699
215 Ga0495661_0046933 3300046665 Bacteria 2633
216 Ga0495588_0000041 3300046674 Bacteria 377896
217 Ga0495588_0049486 3300046674 Bacteria 2161
218 Ga0495588_0068710 3300046674 Bacteria 1840
219 Ga0495588_0099102 3300046674 Bacteria 1530
220 Ga0495588_0222326 3300046674 Bacteria 996
221 Ga0495623_0146127 3300046679 Bacteria 1402
222 Ga0495669_0000803 3300046684 Bacteria 13414
223 Ga0495670_0000714 3300046691 Bacteria 15834
224 Ga0495670_0004154 3300046691 Bacteria 7096
225 Ga0495670_0038262 3300046691 Bacteria 2392
226 Ga0495670_0183441 3300046691 Bacteria 1105
227 Ga0495670_0230638 3300046691 Bacteria 984
228 Ga0495670_0377671 3300046691 Bacteria 764
229 Ga0495671_0030789 3300046692 Bacteria 2746
230 Ga0495671_0097774 3300046692 Bacteria 1435
231 Ga0495671_0128882 3300046692 Bacteria 1234
232 Ga0495589_0000382 3300046794 Bacteria 33916
233 Ga0495589_0015229 3300046794 Bacteria 3958
234 Ga0495589_0019922 3300046794 Bacteria 3431
235 Ga0495589_0024768 3300046794 Bacteria 3049
236 Ga0495600_0089377 3300046809 Bacteria 2009
237 Ga0495660_0000243 3300046810 Bacteria 53378
238 Ga0495660_0014898 3300046810 Bacteria 4496
239 Ga0495581_0020042 3300047315 Bacteria 3883
240 Ga0495581_0047347 3300047315 Bacteria 2485
241 Ga0495581_0054184 3300047315 Bacteria 2315
242 Ga0495636_0005641 3300047318 Bacteria 4908
243 Ga0495674_0010597 3300047319 Bacteria 8723
244 Ga0495674_0399320 3300047319 Bacteria 1110
245 Ga0495672_0006308 3300047320 Bacteria 9221
246 Ga0495676_0262580 3300047321 Bacteria 1174
247 Ga0495683_0000009 3300047323 Bacteria 241385
248 Ga0495683_0011951 3300047323 Bacteria 4563
249 Ga0495683_0023765 3300047323 Bacteria 3149
250 Ga0495683_0037526 3300047323 Bacteria 2456
251 Ga0495683_0101002 3300047323 Bacteria 1387
252 Ga0495687_001063 3300047443 Bacteria 27126
253 Ga0495687_001751 3300047443 Bacteria 19203
254 Ga0495677_0001915 3300047445 Bacteria 8319
255 Ga0495677_0002711 3300047445 Bacteria 6921
256 Ga0495677_0058180 3300047445 Bacteria 1429
257 Ga0495685_026537 3300047447 Bacteria 1993
258 Ga0495685_036359 3300047447 Bacteria 1691
259 Ga0495681_0002839 3300047470 Bacteria 12241
260 Ga0495681_0035537 3300047470 Bacteria 2473
261 Ga0495681_0052590 3300047470 Bacteria 1910
262 Ga0495681_0064690 3300047470 Bacteria 1674
263 Ga0495681_0064802 3300047470 Bacteria 1672
264 Ga0495593_0010042 3300047673 Bacteria 5484
265 Ga0495593_0011298 3300047673 Bacteria 5131
266 Ga0495602_0211571 3300048088 Bacteria 1471
267 Ga0495614_0118254 3300048089 Bacteria 1167
268 Ga0495626_0000193 3300048091 Bacteria 73924
269 Ga0495626_0002394 3300048091 Bacteria 13076
270 Ga0495626_0003302 3300048091 Bacteria 10418
271 Ga0495626_0075570 3300048091 Bacteria 1505
272 Ga0496100_0149364 3300048903 Bacteria 1665
273 Ga0496106_0066399 3300048909 Bacteria 2747
274 Ga0496111_0239000 3300048914 Bacteria 1349
275 Ga0496112_0562914 3300048915 Unclassified 1073
276 Ga0496113_0288976 3300048916 Bacteria 1311
277 Ga0496115_0010625 3300048918 Bacteria 6885
278 Ga0496115_0023847 3300048918 Bacteria 4751
279 Ga0496115_0256093 3300048918 Bacteria 1440
280 Ga0496122_0047469 3300048925 Bacteria 3315
281 Ga0496123_0009373 3300048926 Bacteria 8825
282 Ga0496124_0052883 3300048927 Bacteria 3448
283 Ga0496124_0078466 3300048927 Bacteria 2721
284 Ga0501033_0358759 3300049570 Unclassified 1020
285 Ga0501034_0003738 3300049571 Bacteria 17197
286 Ga0501036_0083268 3300049572 Bacteria 2704
287 Ga0501036_0297963 3300049572 Bacteria 1349
288 Ga0501039_0206831 3300049575 Bacteria 1543
289 Ga0501041_0042890 3300049577 Bacteria 2750
290 Ga0501042_0040259 3300049578 Bacteria 3323
291 Ga0501042_0271911 3300049578 Bacteria 1223
292 Ga0501046_0394704 3300049580 Unclassified 1000
293 Ga0501047_0434704 3300049581 Bacteria 1143
294 Ga0501048_0096552 3300049582 Bacteria 2084
295 Ga0501048_0534601 3300049582 Bacteria 841
296 Ga0501072_0036940 3300049588 Bacteria 3831
297 Ga0501072_0583446 3300049588 Bacteria 882
298 Ga0501074_0472020 3300049590 Unclassified 889
299 Ga0501075_0005467 3300049591 Bacteria 8685
300 Ga0501075_0226426 3300049591 Bacteria 1426
301 Ga0501076_0007282 3300049592 Bacteria 8051
302 Ga0501076_0186049 3300049592 Bacteria 1694
303 Ga0501076_0451095 3300049592 Bacteria 1059
304 Ga0501249_007698 3300049679 Bacteria 2231
305 Ga0501079_0302658 3300049741 Bacteria 1251
306 Ga0501081_0008660 3300049743 Bacteria 6610
307 Ga0501081_0132882 3300049743 Bacteria 1779
308 Ga0501081_0302369 3300049743 Bacteria 1174
309 Ga0501266_000031 3300049763 Bacteria 42498
310 Ga0501035_0005522 3300049822 Bacteria 11949
311 Ga0501035_0187112 3300049822 Bacteria 1782
312 Ga0501044_0204389 3300049823 Bacteria 1932
313 Ga0501045_0162580 3300049824 Bacteria 1662
314 nmdc:mga03n38_17699_c1 3300050490 Bacteria 2796
315 nmdc:mga09592_129330_c1 3300050508 Bacteria 2172
316 nmdc:mga0qj67_79243_c1 3300050509 Bacteria 2630
317 Ga0587091_003636 3300059511 Bacteria 1958
318 Ga0587068_004532 3300059641 Bacteria 1842
319 Ga0501082_0036494 3300060353 Bacteria 4235
320 Ga0501082_0171268 3300060353 Bacteria 1888
321 Ga0466962_0075919 3300061719 Bacteria 1606
322 Ga0530510_0012042 3300061734 Bacteria 6066
323 Ga0530510_0127178 3300061734 Bacteria 1874
324 2643799015 2643221556 Bacteria 7251154
325 2644473654 2643221684 Bacteria 7145183
326 2842720912 2842718218 Bacteria 4560148
327 8047679384 8047673197 Bacteria 7395230
328 rootH1_10103375
329 Ga0006778J45830_1046373
330 Ga0006777J48905_1004468
331 rootL2_10019940
332 rootL2_10176139
333 Ga0007416J51690_1006144
334 Ga0055542_1010423
335 Ga0065712_10233830
336 Ga0070658_10014819
337 Ga0070676_10005280
338 Ga0070683_100018102
339 Ga0070670_100009652
340 Ga0068869_100026492
341 Ga0070675_100012644
342 Ga0070671_100010604
343 Ga0070673_100014429
344 Ga0070667_100161617
345 Ga0070662_100090854
346 Ga0070681_10013252
347 Ga0068867_100003068
348 Ga0070684_100219468
349 Ga0068855_100004035
350 Ga0070664_100278766
351 Ga0068857_100024948
352 Ga0068857_100481755
353 Ga0068854_100090722
354 Ga0081538_10028752
355 Ga0075363_100016096
356 Ga0075428_100100646
357 Ga0075430_100030309
358 Ga0075429_100098218
359 Ga0105245_10147075
360 Ga0105243_10298600
361 Ga0105241_10009805
362 Ga0105237_10184318
363 Ga0105238_10031144
364 Ga0105246_10310104
365 Ga0157375_10017731
366 Ga0163163_10287492
367 Ga0209148_1000563
368 Ga0207645_10009539
369 Ga0207705_10073832
370 Ga0207705_10232034
371 Ga0207657_10051509
372 Ga0207650_10179985
373 Ga0207659_10009541
374 Ga0207687_10090996
375 Ga0207644_10264067
376 Ga0207706_10108896
377 Ga0207706_10524750
378 Ga0207689_10045559
379 Ga0207679_10222420
380 Ga0207667_10003182
381 Ga0207651_10007824
382 Ga0207640_10485490
383 Ga0207648_10013053
384 Ga0207674_10065643
385 Ga0207674_10501616
386 Ga0209974_10014933
387 Ga0316178_1148472
388 Ga0307408_100000754
389 Ga0307408_100072625
390 Ga0307413_10065713
391 Ga0307406_10000848
392 Ga0307409_100021792
393 Ga0307416_100106674
394 Ga0395899_0000012
395 Ga0395899_0008642
396 Ga0395899_0092403
397 Ga0395900_0000028
398 Ga0395900_0197965
399 Ga0395900_0583463
400 Ga0395898_0094965
401 Ga0395898_0228578
402 Ga0395901_0000025
403 Ga0395901_0146290
404 Ga0395901_0309760
405 Ga0395901_0350174
406 Ga0439449_0004907
407 Ga0439450_007729
408 Ga0439455_0016685
409 Ga0439458_0011386
410 Ga0439458_0022857
411 Ga0466969_0028849
412 Ga0466969_0226145
413 Ga0466972_0006353
414 Ga0466972_0021742
415 Ga0466965_0013836
416 Ga0466965_0015205
417 Ga0466966_0017413
418 Ga0466966_0050251
419 Ga0466961_0070261
420 Ga0466964_0000940
421 Ga0466964_0008698
422 Ga0466964_0018577
423 Ga0466968_0002631
424 Ga0466968_0042818
425 Ga0466970_0130142
426 Ga0466957_0000097
427 Ga0466957_0066953
428 Ga0466957_0069323
429 Ga0466960_0091805
430 Ga0466959_0029451
431 Ga0466959_0159467
432 Ga0466958_0043932
433 Ga0495617_000572
434 Ga0495603_0013247
435 Ga0495603_0227432
436 Ga0495629_0009491
437 Ga0495629_0094861
438 Ga0495638_0001036
439 Ga0495638_0173154
440 Ga0495653_0040253
441 Ga0495582_0093421
442 Ga0495605_0000419
443 Ga0495584_0000001
444 Ga0495584_0000750
445 Ga0495584_0001146
446 Ga0495584_0003747
447 Ga0495584_0028900
448 Ga0495584_0084533
449 Ga0495584_0086594
450 Ga0495584_0088069
451 Ga0495585_0000126
452 Ga0495585_0000161
453 Ga0495585_0001579
454 Ga0495585_0001582
455 Ga0495585_0015552
456 Ga0495585_0029612
457 Ga0495585_0036026
458 Ga0495585_0042283
459 Ga0495585_0083066
460 Ga0495585_0095544
461 Ga0495594_0000291
462 Ga0495594_0112227
463 Ga0495596_0000351
464 Ga0495596_0001813
465 Ga0495596_0011719
466 Ga0495596_0039596
467 Ga0495607_0002372
468 Ga0495607_0007641
469 Ga0495583_0000786
470 Ga0495583_0059620
471 Ga0495583_0060359
472 Ga0495606_0003947
473 Ga0495606_0004294
474 Ga0495606_0064390
475 Ga0495606_0128844
476 Ga0495606_0178198
477 Ga0495606_0209231
478 Ga0495616_0009144
479 Ga0495616_0010348
480 Ga0495616_0010692
481 Ga0495616_0036032
482 Ga0495620_0013562
483 Ga0495630_0020748
484 Ga0495631_0015418
485 Ga0495631_0026195
486 Ga0495631_0052711
487 Ga0495632_0004702
488 Ga0495643_0006886
489 Ga0495643_0049537
490 Ga0495643_0061766
491 Ga0495643_0086588
492 Ga0495644_0021399
493 Ga0495644_0086115
494 Ga0495644_0185890
495 Ga0495648_0000202
496 Ga0495648_0027360
497 Ga0495648_0028207
498 Ga0495663_0004302
499 Ga0495663_0035442
500 Ga0495666_0001389
501 Ga0495666_0021005
502 Ga0495666_0026977
503 Ga0495642_0000300
504 Ga0495642_0009897
505 Ga0495642_0012067
506 Ga0495642_0029434
507 Ga0495642_0048527
508 Ga0495642_0053861
509 Ga0495642_0081089
510 Ga0495665_0013377
511 Ga0495665_0038487
512 Ga0495586_0176626
513 Ga0495587_0055952
514 Ga0495609_0017090
515 Ga0495609_0067168
516 Ga0495609_0106132
517 Ga0495597_0008132
518 Ga0495597_0008270
519 Ga0495597_0086545
520 Ga0495645_0168701
521 Ga0495633_0017141
522 Ga0495633_0018773
523 Ga0495633_0024795
524 Ga0495633_0101511
525 Ga0495633_0107570
526 Ga0495668_0005585
527 Ga0495668_0012197
528 Ga0495668_0083088
529 Ga0495611_0008211
530 Ga0495611_0011091
531 Ga0495611_0034145
532 Ga0495611_0086136
533 Ga0495611_0208354
534 Ga0495625_0020016
535 Ga0495625_0021386
536 Ga0495661_0007001
537 Ga0495661_0019695
538 Ga0495661_0031437
539 Ga0495661_0032277
540 Ga0495661_0041927
541 Ga0495661_0045057
542 Ga0495661_0046933
543 Ga0495588_0000041
544 Ga0495588_0049486
545 Ga0495588_0068710
546 Ga0495588_0099102
547 Ga0495588_0222326
548 Ga0495623_0146127
549 Ga0495669_0000803
550 Ga0495670_0000714
551 Ga0495670_0004154
552 Ga0495670_0038262
553 Ga0495670_0183441
554 Ga0495670_0230638
555 Ga0495670_0377671
556 Ga0495671_0030789
557 Ga0495671_0097774
558 Ga0495671_0128882
559 Ga0495589_0000382
560 Ga0495589_0015229
561 Ga0495589_0019922
562 Ga0495589_0024768
563 Ga0495600_0089377
564 Ga0495660_0000243
565 Ga0495660_0014898
566 Ga0495581_0020042
567 Ga0495581_0047347
568 Ga0495581_0054184
569 Ga0495636_0005641
570 Ga0495674_0010597
571 Ga0495674_0399320
572 Ga0495672_0006308
573 Ga0495676_0262580
574 Ga0495683_0000009
575 Ga0495683_0011951
576 Ga0495683_0023765
577 Ga0495683_0037526
578 Ga0495683_0101002
579 Ga0495687_001063
580 Ga0495687_001751
581 Ga0495677_0001915
582 Ga0495677_0002711
583 Ga0495677_0058180
584 Ga0495685_026537
585 Ga0495685_036359
586 Ga0495681_0002839
587 Ga0495681_0035537
588 Ga0495681_0052590
589 Ga0495681_0064690
590 Ga0495681_0064802
591 Ga0495593_0010042
592 Ga0495593_0011298
593 Ga0495602_0211571
594 Ga0495614_0118254
595 Ga0495626_0000193
596 Ga0495626_0002394
597 Ga0495626_0003302
598 Ga0495626_0075570
599 Ga0496100_0149364
600 Ga0496106_0066399
601 Ga0496111_0239000
602 Ga0496112_0562914
603 Ga0496113_0288976
604 Ga0496115_0010625
605 Ga0496115_0023847
606 Ga0496115_0256093
607 Ga0496122_0047469
608 Ga0496123_0009373
609 Ga0496124_0052883
610 Ga0496124_0078466
611 Ga0501033_0358759
612 Ga0501034_0003738
613 Ga0501036_0083268
614 Ga0501036_0297963
615 Ga0501039_0206831
616 Ga0501041_0042890
617 Ga0501042_0040259
618 Ga0501042_0271911
619 Ga0501046_0394704
620 Ga0501047_0434704
621 Ga0501048_0096552
622 Ga0501048_0534601
623 Ga0501072_0036940
624 Ga0501072_0583446
625 Ga0501074_0472020
626 Ga0501075_0005467
627 Ga0501075_0226426
628 Ga0501076_0007282
629 Ga0501076_0186049
630 Ga0501076_0451095
631 Ga0501249_007698
632 Ga0501079_0302658
633 Ga0501081_0008660
634 Ga0501081_0132882
635 Ga0501081_0302369
636 Ga0501266_000031
637 Ga0501035_0005522
638 Ga0501035_0187112
639 Ga0501044_0204389
640 Ga0501045_0162580
641 nmdc:mga03n38_17699_c1
642 nmdc:mga09592_129330_c1
643 nmdc:mga0qj67_79243_c1
644 Ga0587091_003636
645 Ga0587068_004532
646 Ga0501082_0036494
647 Ga0501082_0171268
648 Ga0466962_0075919
649 Ga0530510_0012042
650 Ga0530510_0127178
651 2643799015
652 2644473654
653 2842720912
654 8047679384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.8635 84 232
3hiu-assembly1.cif.gz_B the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8493 84 236
3hiu-assembly2.cif.gz_D the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8486 79 236
4cvs-assembly1.cif.gz_A-2 structure of apobacterioferritin y45f variant 0.8395 84 238
4cvp-assembly1.cif.gz_A-2 structure of apobacterioferritin 0.8344 84 238
ID Description Score Start End Superfamily
af_P21363_1_168_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8546 86 236 1.20.1260.10
2v15I00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8351 87 229 1.20.1260.10
4cvpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8344 84 238 1.20.1260.10
2xjnF00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8318 87 229 1.20.1260.10
2ux1J00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8315 87 229 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A4V2A550-F1-model_v4 deleted 0.9708 40 236
AF-A0A2N1WCS2-F1-model_v4 deleted 0.9627 105 236
AF-A0A352E8S3-F1-model_v4 deleted 0.9294 36 236
AF-A0A4V2A550-F1-model_v4 deleted 0.929 40 236
AF-A0A2N1WCS2-F1-model_v4 deleted 0.9146 105 236

Map