F408583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 214 | 321 | 258 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2958041894|2958045419 |
| Length | 234 |
| Sequence | TILVETRGKVGLITLNRPKALNALNSQVMAEVVAAVNAFNADAGIGAMVLTGSEKAFAAGADIKEMQAIAFVDAYTQDLFVGWEELTRARKPIIAAVAGYALGGGCELAMMCDFIIAGDNAKFGQPEITLGVMPGMGGSQRLTRFVGKSKAMDMCLTGRMMDAAEAERCGLVSRVVPAADLTEEALKAAAKIAEFSLPSVMMTKEAVNRAYETTLAEGLRFERRLFHSLFALDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 2 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 3 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 4 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 5 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 69 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 70 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 103 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 113 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 126 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 129 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 204 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 205 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 207 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 209 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 210 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 211 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 0 |
| Isolates | 1.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.59 |
| Nodule | 0.92 |
| Rhizoplane | 7.36 |
| Rhizosphere | 78.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070677_10012128 | 3300005333 | Bacteria | 2987 |
| 2 | Ga0070689_100010914 | 3300005340 | Bacteria | 6491 |
| 3 | Ga0070668_100008941 | 3300005347 | Bacteria | 7437 |
| 4 | Ga0070668_100018393 | 3300005347 | Bacteria | 5246 |
| 5 | Ga0070675_100026872 | 3300005354 | Bacteria | 4621 |
| 6 | Ga0070671_100182991 | 3300005355 | Bacteria | 1774 |
| 7 | Ga0070673_100040687 | 3300005364 | Bacteria | 3568 |
| 8 | Ga0070673_100609367 | 3300005364 | Bacteria | 996 |
| 9 | Ga0070659_100375422 | 3300005366 | Bacteria | 1197 |
| 10 | Ga0070667_100031628 | 3300005367 | Bacteria | 4411 |
| 11 | Ga0070667_100031771 | 3300005367 | Bacteria | 4401 |
| 12 | Ga0070713_100019399 | 3300005436 | Bacteria | 5190 |
| 13 | Ga0070678_100036527 | 3300005456 | Bacteria | 3440 |
| 14 | Ga0070678_100048982 | 3300005456 | Bacteria | 3047 |
| 15 | Ga0070662_100017431 | 3300005457 | Bacteria | 4843 |
| 16 | Ga0070707_100178113 | 3300005468 | Bacteria | 2072 |
| 17 | Ga0070698_100003213 | 3300005471 | Bacteria | 18005 |
| 18 | Ga0070679_100003097 | 3300005530 | Bacteria | 15194 |
| 19 | Ga0070679_100232256 | 3300005530 | Bacteria | 1804 |
| 20 | Ga0070684_100678407 | 3300005535 | Bacteria | 960 |
| 21 | Ga0070697_100208325 | 3300005536 | Bacteria | 1664 |
| 22 | Ga0068853_100032138 | 3300005539 | Bacteria | 4444 |
| 23 | Ga0070672_100132284 | 3300005543 | Bacteria | 2051 |
| 24 | Ga0070665_100099879 | 3300005548 | Bacteria | 2906 |
| 25 | Ga0070665_100270590 | 3300005548 | Bacteria | 1701 |
| 26 | Ga0070704_100006200 | 3300005549 | Bacteria | 7026 |
| 27 | Ga0068855_100020041 | 3300005563 | Bacteria | 8030 |
| 28 | Ga0068855_100089062 | 3300005563 | Bacteria | 3564 |
| 29 | Ga0068855_100743337 | 3300005563 | Bacteria | 1046 |
| 30 | Ga0068857_100059650 | 3300005577 | Bacteria | 3389 |
| 31 | Ga0068857_100438178 | 3300005577 | Bacteria | 1220 |
| 32 | Ga0068856_100034640 | 3300005614 | Bacteria | 4945 |
| 33 | Ga0068852_100042700 | 3300005616 | Bacteria | 3840 |
| 34 | Ga0068859_100192803 | 3300005617 | Bacteria | 2122 |
| 35 | Ga0068859_100283860 | 3300005617 | Bacteria | 1748 |
| 36 | Ga0068859_100420540 | 3300005617 | Bacteria | 1433 |
| 37 | Ga0068864_100064382 | 3300005618 | Bacteria | 3179 |
| 38 | Ga0068863_100266693 | 3300005841 | Bacteria | 1656 |
| 39 | Ga0068863_100294120 | 3300005841 | Bacteria | 1574 |
| 40 | Ga0068863_100514439 | 3300005841 | Bacteria | 1180 |
| 41 | Ga0068863_100524522 | 3300005841 | Bacteria | 1168 |
| 42 | Ga0068858_100235306 | 3300005842 | Bacteria | 1737 |
| 43 | Ga0068860_100001005 | 3300005843 | Bacteria | 31230 |
| 44 | Ga0068860_100006131 | 3300005843 | Bacteria | 12091 |
| 45 | Ga0068860_100042848 | 3300005843 | Bacteria | 4320 |
| 46 | Ga0068860_100127259 | 3300005843 | Bacteria | 2442 |
| 47 | Ga0068862_100003900 | 3300005844 | Bacteria | 12675 |
| 48 | Ga0068862_100042981 | 3300005844 | Bacteria | 3851 |
| 49 | Ga0068862_100131676 | 3300005844 | Bacteria | 2212 |
| 50 | Ga0081455_10001851 | 3300005937 | Bacteria | 25467 |
| 51 | Ga0081455_10007317 | 3300005937 | Bacteria | 11641 |
| 52 | Ga0081455_10067638 | 3300005937 | Bacteria | 2976 |
| 53 | Ga0081538_10059489 | 3300005981 | Bacteria | 2206 |
| 54 | Ga0081540_1074349 | 3300005983 | Bacteria | 1557 |
| 55 | Ga0081539_10007008 | 3300005985 | Bacteria | 10455 |
| 56 | Ga0075365_10035918 | 3300006038 | Bacteria | 3209 |
| 57 | Ga0075365_10164689 | 3300006038 | Bacteria | 1546 |
| 58 | Ga0075365_10182487 | 3300006038 | Bacteria | 1467 |
| 59 | Ga0075365_10193073 | 3300006038 | Bacteria | 1425 |
| 60 | Ga0075363_100147269 | 3300006048 | Bacteria | 1328 |
| 61 | Ga0075362_10012467 | 3300006177 | Bacteria | 3379 |
| 62 | Ga0075367_10018803 | 3300006178 | Bacteria | 3818 |
| 63 | Ga0075367_10233103 | 3300006178 | Bacteria | 1153 |
| 64 | Ga0075366_10007227 | 3300006195 | Bacteria | 6119 |
| 65 | Ga0075370_10010161 | 3300006353 | Bacteria | 4907 |
| 66 | Ga0075370_10054366 | 3300006353 | Bacteria | 2273 |
| 67 | Ga0075428_100624721 | 3300006844 | Bacteria | 1150 |
| 68 | Ga0075433_10167217 | 3300006852 | Bacteria | 1957 |
| 69 | Ga0075434_100039508 | 3300006871 | Bacteria | 4676 |
| 70 | Ga0097620_100192806 | 3300006931 | Bacteria | 2122 |
| 71 | Ga0097620_100283860 | 3300006931 | Bacteria | 1748 |
| 72 | Ga0097620_100420543 | 3300006931 | Bacteria | 1433 |
| 73 | Ga0099794_10043244 | 3300007265 | Bacteria | 2150 |
| 74 | Ga0105243_10140556 | 3300009148 | Bacteria | 2059 |
| 75 | Ga0105241_10196577 | 3300009174 | Bacteria | 1682 |
| 76 | Ga0105242_10219708 | 3300009176 | Bacteria | 1698 |
| 77 | Ga0105237_10109429 | 3300009545 | Bacteria | 2755 |
| 78 | Ga0105238_10036475 | 3300009551 | Bacteria | 4998 |
| 79 | Ga0105238_10533653 | 3300009551 | Bacteria | 1177 |
| 80 | Ga0099796_10144413 | 3300010159 | Bacteria | 932 |
| 81 | Ga0105239_10025157 | 3300010375 | Bacteria | 6557 |
| 82 | Ga0157327_1001603 | 3300012512 | Bacteria | 1448 |
| 83 | Ga0157373_10163456 | 3300013100 | Bacteria | 1566 |
| 84 | Ga0157371_10029522 | 3300013102 | Bacteria | 3963 |
| 85 | Ga0157370_10082675 | 3300013104 | Bacteria | 3020 |
| 86 | Ga0157378_10464140 | 3300013297 | Bacteria | 1259 |
| 87 | Ga0163162_10023860 | 3300013306 | Bacteria | 6036 |
| 88 | Ga0163162_10137657 | 3300013306 | Bacteria | 2553 |
| 89 | Ga0157372_10108950 | 3300013307 | Bacteria | 3171 |
| 90 | Ga0157376_10235105 | 3300014969 | Bacteria | 1704 |
| 91 | Ga0182007_10070870 | 3300015262 | Bacteria | 1142 |
| 92 | Ga0163161_10012339 | 3300017792 | Bacteria | 5930 |
| 93 | Ga0213875_10096966 | 3300021388 | Bacteria | 1375 |
| 94 | Ga0213871_10001196 | 3300021441 | Bacteria | 4187 |
| 95 | Ga0207426_1012906 | 3300025302 | Bacteria | 3120 |
| 96 | Ga0207705_10032117 | 3300025909 | Bacteria | 3750 |
| 97 | Ga0207684_10233656 | 3300025910 | Bacteria | 1586 |
| 98 | Ga0207707_10003527 | 3300025912 | Bacteria | 13853 |
| 99 | Ga0207652_10009517 | 3300025921 | Bacteria | 7814 |
| 100 | Ga0207652_10442175 | 3300025921 | Bacteria | 1172 |
| 101 | Ga0207694_10279889 | 3300025924 | Bacteria | 1370 |
| 102 | Ga0207650_10193733 | 3300025925 | Bacteria | 1625 |
| 103 | Ga0207700_10012529 | 3300025928 | Bacteria | 5474 |
| 104 | Ga0207700_10100402 | 3300025928 | Bacteria | 2306 |
| 105 | Ga0207700_10333114 | 3300025928 | Bacteria | 1318 |
| 106 | Ga0207644_10066648 | 3300025931 | Bacteria | 2622 |
| 107 | Ga0207644_10144780 | 3300025931 | Bacteria | 1833 |
| 108 | Ga0207706_10041584 | 3300025933 | Bacteria | 4074 |
| 109 | Ga0207670_10310086 | 3300025936 | Bacteria | 1238 |
| 110 | Ga0207691_10180333 | 3300025940 | Bacteria | 1846 |
| 111 | Ga0207661_10007715 | 3300025944 | Bacteria | 7659 |
| 112 | Ga0207679_10006048 | 3300025945 | Bacteria | 7628 |
| 113 | Ga0207667_10002821 | 3300025949 | Bacteria | 21552 |
| 114 | Ga0207667_10231862 | 3300025949 | Bacteria | 1890 |
| 115 | Ga0207651_10089824 | 3300025960 | Bacteria | 2244 |
| 116 | Ga0207651_10245906 | 3300025960 | Bacteria | 1461 |
| 117 | Ga0207668_10048547 | 3300025972 | Bacteria | 2913 |
| 118 | Ga0207668_10054485 | 3300025972 | Bacteria | 2776 |
| 119 | Ga0207668_10056560 | 3300025972 | Bacteria | 2732 |
| 120 | Ga0207640_10090052 | 3300025981 | Bacteria | 2122 |
| 121 | Ga0207658_10119301 | 3300025986 | Bacteria | 2100 |
| 122 | Ga0207677_10289767 | 3300026023 | Bacteria | 1348 |
| 123 | Ga0207677_10744412 | 3300026023 | Bacteria | 873 |
| 124 | Ga0207703_10194732 | 3300026035 | Bacteria | 1797 |
| 125 | Ga0207639_10016345 | 3300026041 | Bacteria | 5249 |
| 126 | Ga0207702_10023845 | 3300026078 | Bacteria | 5075 |
| 127 | Ga0207702_10155395 | 3300026078 | Bacteria | 2085 |
| 128 | Ga0207641_10017251 | 3300026088 | Bacteria | 5910 |
| 129 | Ga0207641_10467627 | 3300026088 | Bacteria | 1221 |
| 130 | Ga0207641_10711775 | 3300026088 | Bacteria | 989 |
| 131 | Ga0207676_10166059 | 3300026095 | Bacteria | 1918 |
| 132 | Ga0207676_10338913 | 3300026095 | Bacteria | 1386 |
| 133 | Ga0207674_10117862 | 3300026116 | Bacteria | 2625 |
| 134 | Ga0207674_10141304 | 3300026116 | Bacteria | 2367 |
| 135 | Ga0207675_100110833 | 3300026118 | Bacteria | 2589 |
| 136 | Ga0207683_10024960 | 3300026121 | Bacteria | 5153 |
| 137 | Ga0207683_10056923 | 3300026121 | Bacteria | 3431 |
| 138 | Ga0268266_10004061 | 3300028379 | Bacteria | 14147 |
| 139 | Ga0268266_10039802 | 3300028379 | Bacteria | 4004 |
| 140 | Ga0268265_10033771 | 3300028380 | Bacteria | 3722 |
| 141 | Ga0268265_10058200 | 3300028380 | Bacteria | 2949 |
| 142 | Ga0268265_10153928 | 3300028380 | Bacteria | 1943 |
| 143 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 144 | Ga0268264_10085619 | 3300028381 | Bacteria | 2705 |
| 145 | Ga0268264_10167448 | 3300028381 | Bacteria | 1985 |
| 146 | Ga0265334_10006563 | 3300028573 | Bacteria | 5007 |
| 147 | Ga0307517_10005652 | 3300028786 | Bacteria | 18750 |
| 148 | Ga0307517_10067953 | 3300028786 | Bacteria | 3254 |
| 149 | Ga0307517_10078776 | 3300028786 | Bacteria | 2845 |
| 150 | Ga0265340_10036337 | 3300031247 | Bacteria | 2442 |
| 151 | Ga0307513_10000899 | 3300031456 | Bacteria | 42953 |
| 152 | Ga0307513_10000983 | 3300031456 | Bacteria | 41242 |
| 153 | Ga0307516_10000338 | 3300031730 | Bacteria | 61339 |
| 154 | Ga0307516_10000438 | 3300031730 | Bacteria | 54750 |
| 155 | Ga0307510_10000393 | 3300033180 | Bacteria | 41479 |
| 156 | Ga0373934_0003938 | 3300035086 | Bacteria | 5459 |
| 157 | Ga0373932_0053517 | 3300035112 | Bacteria | 1205 |
| 158 | Ga0373941_0054179 | 3300035115 | Bacteria | 1285 |
| 159 | Ga0373953_0049319 | 3300035117 | Bacteria | 1698 |
| 160 | Ga0373956_0010994 | 3300035119 | Bacteria | 3725 |
| 161 | Ga0373957_0005152 | 3300035120 | Bacteria | 4038 |
| 162 | Ga0373955_0054992 | 3300035172 | Bacteria | 2178 |
| 163 | Ga0373927_0090857 | 3300035695 | Bacteria | 1983 |
| 164 | Ga0373927_0186932 | 3300035695 | Bacteria | 1359 |
| 165 | Ga0373933_0001967 | 3300035724 | Bacteria | 11839 |
| 166 | Ga0373937_0001916 | 3300036401 | Bacteria | 17426 |
| 167 | Ga0373937_0142663 | 3300036401 | Bacteria | 2241 |
| 168 | Ga0373937_0464060 | 3300036401 | Bacteria | 1203 |
| 169 | Ga0373925_0001751 | 3300037068 | Bacteria | 18138 |
| 170 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 171 | Ga0395899_0008576 | 3300037312 | Bacteria | 7870 |
| 172 | Ga0395900_0042361 | 3300037418 | Bacteria | 4691 |
| 173 | Ga0395900_0046371 | 3300037418 | Bacteria | 4475 |
| 174 | Ga0395900_0074822 | 3300037418 | Bacteria | 3481 |
| 175 | Ga0395900_0191774 | 3300037418 | Bacteria | 2072 |
| 176 | Ga0395900_0482191 | 3300037418 | Bacteria | 1192 |
| 177 | Ga0395898_0019368 | 3300037466 | Bacteria | 6927 |
| 178 | Ga0395898_0021926 | 3300037466 | Bacteria | 6470 |
| 179 | Ga0395898_0150214 | 3300037466 | Bacteria | 2229 |
| 180 | Ga0395905_0597957 | 3300037471 | Bacteria | 1005 |
| 181 | Ga0436364_0005451 | 3300037853 | Bacteria | 2374 |
| 182 | Ga0436364_0752967 | 3300037853 | Bacteria | 1438 |
| 183 | Ga0395901_0002710 | 3300038443 | Bacteria | 17843 |
| 184 | Ga0395901_0007074 | 3300038443 | Bacteria | 11341 |
| 185 | Ga0395901_0015701 | 3300038443 | Bacteria | 7714 |
| 186 | Ga0395901_0030636 | 3300038443 | Bacteria | 5543 |
| 187 | Ga0395901_0051838 | 3300038443 | Bacteria | 4265 |
| 188 | Ga0395901_0287141 | 3300038443 | Bacteria | 1708 |
| 189 | Ga0436365_0457672 | 3300039437 | Bacteria | 1423 |
| 190 | Ga0436360_1076911 | 3300039438 | Bacteria | 12198 |
| 191 | Ga0436361_0045943 | 3300039447 | Bacteria | 10776 |
| 192 | Ga0436361_0345649 | 3300039447 | Bacteria | 943 |
| 193 | Ga0436361_0523753 | 3300039447 | Bacteria | 983 |
| 194 | Ga0436363_0516515 | 3300039450 | Bacteria | 1590 |
| 195 | Ga0451851_1188839 | 3300041507 | Bacteria | 748 |
| 196 | Ga0451577_0024678 | 3300042876 | Bacteria | 5466 |
| 197 | Ga0451577_0112039 | 3300042876 | Bacteria | 2441 |
| 198 | Ga0451577_0174301 | 3300042876 | Bacteria | 1938 |
| 199 | Ga0451577_0300820 | 3300042876 | Bacteria | 1454 |
| 200 | Ga0451577_0393755 | 3300042876 | Bacteria | 1257 |
| 201 | Ga0466966_0071594 | 3300044684 | Bacteria | 2172 |
| 202 | Ga0466963_0051763 | 3300044694 | Bacteria | 2723 |
| 203 | Ga0466964_0143089 | 3300044706 | Bacteria | 1101 |
| 204 | Ga0453684_0096303 | 3300044712 | Bacteria | 3636 |
| 205 | Ga0453684_0147473 | 3300044712 | Bacteria | 2800 |
| 206 | Ga0453684_0414883 | 3300044712 | Bacteria | 1505 |
| 207 | Ga0453684_0514054 | 3300044712 | Bacteria | 1324 |
| 208 | Ga0453684_0877405 | 3300044712 | Bacteria | 962 |
| 209 | Ga0451576_0016981 | 3300045051 | Bacteria | 8015 |
| 210 | Ga0466967_0047418 | 3300045976 | Bacteria | 3745 |
| 211 | Ga0495638_0129230 | 3300046460 | Bacteria | 1486 |
| 212 | Ga0495580_0007367 | 3300046472 | Bacteria | 8848 |
| 213 | Ga0495582_0227459 | 3300046473 | Bacteria | 1068 |
| 214 | Ga0495639_0000388 | 3300046475 | Bacteria | 20901 |
| 215 | Ga0495584_0128382 | 3300046491 | Bacteria | 1286 |
| 216 | Ga0495594_0264172 | 3300046499 | Bacteria | 980 |
| 217 | Ga0495583_0104313 | 3300046506 | Bacteria | 1207 |
| 218 | Ga0495644_0197223 | 3300046523 | Bacteria | 776 |
| 219 | Ga0495666_0000304 | 3300046526 | Bacteria | 21414 |
| 220 | Ga0495665_0042865 | 3300046531 | Bacteria | 2407 |
| 221 | Ga0495633_0080077 | 3300046558 | Bacteria | 1521 |
| 222 | Ga0495611_0032336 | 3300046648 | Bacteria | 2305 |
| 223 | Ga0495625_0085616 | 3300046660 | Bacteria | 2187 |
| 224 | Ga0495588_0034168 | 3300046674 | Bacteria | 2572 |
| 225 | Ga0495669_0008979 | 3300046684 | Bacteria | 4212 |
| 226 | Ga0495624_0255065 | 3300046690 | Bacteria | 1060 |
| 227 | Ga0495604_0034176 | 3300047317 | Bacteria | 4023 |
| 228 | Ga0495636_0055860 | 3300047318 | Bacteria | 1661 |
| 229 | Ga0495680_0281344 | 3300047322 | Bacteria | 1172 |
| 230 | Ga0495677_0015539 | 3300047445 | Bacteria | 2766 |
| 231 | Ga0495615_0031598 | 3300048090 | Bacteria | 1271 |
| 232 | Ga0496100_0008509 | 3300048903 | Bacteria | 5724 |
| 233 | Ga0496100_0047840 | 3300048903 | Bacteria | 2758 |
| 234 | Ga0496101_0027250 | 3300048904 | Bacteria | 3979 |
| 235 | Ga0496101_0066731 | 3300048904 | Bacteria | 2625 |
| 236 | Ga0496101_0340436 | 3300048904 | Bacteria | 1178 |
| 237 | Ga0496102_0013616 | 3300048905 | Bacteria | 7050 |
| 238 | Ga0496102_0023737 | 3300048905 | Bacteria | 5450 |
| 239 | Ga0496102_0039600 | 3300048905 | Bacteria | 4259 |
| 240 | Ga0496102_0664767 | 3300048905 | Bacteria | 965 |
| 241 | Ga0496103_0061413 | 3300048906 | Bacteria | 2337 |
| 242 | Ga0496103_0377313 | 3300048906 | Bacteria | 911 |
| 243 | Ga0496104_0058221 | 3300048907 | Bacteria | 3657 |
| 244 | Ga0496105_0002194 | 3300048908 | Bacteria | 14140 |
| 245 | Ga0496106_0313150 | 3300048909 | Bacteria | 1259 |
| 246 | Ga0496106_0342689 | 3300048909 | Bacteria | 1200 |
| 247 | Ga0496107_0093239 | 3300048910 | Bacteria | 2202 |
| 248 | Ga0496108_0109650 | 3300048911 | Bacteria | 2359 |
| 249 | Ga0496108_0131309 | 3300048911 | Bacteria | 2153 |
| 250 | Ga0496110_0087567 | 3300048913 | Bacteria | 2781 |
| 251 | Ga0496111_0046299 | 3300048914 | Bacteria | 3132 |
| 252 | Ga0496112_0034038 | 3300048915 | Bacteria | 4957 |
| 253 | Ga0496112_0233382 | 3300048915 | Bacteria | 1794 |
| 254 | Ga0496112_0407274 | 3300048915 | Bacteria | 1299 |
| 255 | Ga0496114_0162572 | 3300048917 | Bacteria | 1942 |
| 256 | Ga0501032_0000104 | 3300049569 | Bacteria | 71651 |
| 257 | Ga0501033_0000566 | 3300049570 | Bacteria | 34460 |
| 258 | Ga0501033_0107058 | 3300049570 | Bacteria | 2037 |
| 259 | Ga0501034_0000529 | 3300049571 | Bacteria | 61012 |
| 260 | Ga0501034_0007498 | 3300049571 | Bacteria | 11602 |
| 261 | Ga0501034_0026574 | 3300049571 | Bacteria | 5894 |
| 262 | Ga0501036_0000087 | 3300049572 | Bacteria | 58173 |
| 263 | Ga0501036_0004013 | 3300049572 | Bacteria | 11841 |
| 264 | Ga0501037_0000029 | 3300049573 | Bacteria | 139680 |
| 265 | Ga0501037_0151877 | 3300049573 | Bacteria | 1655 |
| 266 | Ga0501038_0000120 | 3300049574 | Bacteria | 66925 |
| 267 | Ga0501039_0000043 | 3300049575 | Bacteria | 109462 |
| 268 | Ga0501039_0002697 | 3300049575 | Bacteria | 13250 |
| 269 | Ga0501039_0153282 | 3300049575 | Bacteria | 1810 |
| 270 | Ga0501040_0008124 | 3300049576 | Bacteria | 6818 |
| 271 | Ga0501042_0016931 | 3300049578 | Bacteria | 5016 |
| 272 | Ga0501043_0000160 | 3300049579 | Bacteria | 61140 |
| 273 | Ga0501046_0007817 | 3300049580 | Bacteria | 9382 |
| 274 | Ga0501046_0063928 | 3300049580 | Bacteria | 2873 |
| 275 | Ga0501048_0002702 | 3300049582 | Bacteria | 13537 |
| 276 | Ga0501068_0085315 | 3300049584 | Bacteria | 1943 |
| 277 | Ga0501069_0089327 | 3300049585 | Bacteria | 1742 |
| 278 | Ga0501070_0037789 | 3300049586 | Bacteria | 4030 |
| 279 | Ga0501071_0001677 | 3300049587 | Bacteria | 12995 |
| 280 | Ga0501072_0001126 | 3300049588 | Bacteria | 19860 |
| 281 | Ga0501072_0530023 | 3300049588 | Bacteria | 931 |
| 282 | Ga0501073_0229595 | 3300049589 | Bacteria | 1282 |
| 283 | Ga0501074_0125426 | 3300049590 | Bacteria | 1836 |
| 284 | Ga0501075_0001155 | 3300049591 | Bacteria | 17068 |
| 285 | Ga0501075_0019180 | 3300049591 | Bacteria | 4960 |
| 286 | Ga0501076_0000538 | 3300049592 | Bacteria | 24148 |
| 287 | Ga0501076_0177498 | 3300049592 | Bacteria | 1736 |
| 288 | Ga0501077_0003995 | 3300049593 | Bacteria | 8903 |
| 289 | Ga0501077_0113662 | 3300049593 | Bacteria | 1717 |
| 290 | Ga0501079_0001207 | 3300049741 | Bacteria | 18093 |
| 291 | Ga0501080_0230920 | 3300049742 | Bacteria | 1691 |
| 292 | Ga0501080_0253988 | 3300049742 | Bacteria | 1603 |
| 293 | Ga0501081_0006860 | 3300049743 | Bacteria | 7405 |
| 294 | Ga0501035_0000057 | 3300049822 | Bacteria | 135297 |
| 295 | Ga0501035_0275315 | 3300049822 | Bacteria | 1424 |
| 296 | Ga0501044_0102361 | 3300049823 | Bacteria | 2880 |
| 297 | Ga0501045_0001420 | 3300049824 | Bacteria | 15968 |
| 298 | Ga0501045_0247981 | 3300049824 | Bacteria | 1326 |
| 299 | nmdc:mga03683_2990_c1 | 3300050489 | Bacteria | 4138 |
| 300 | nmdc:mga0yw44_124120_c1 | 3300050492 | Bacteria | 1666 |
| 301 | nmdc:mga0yw44_217670_c1 | 3300050492 | Bacteria | 1265 |
| 302 | nmdc:mga0yw44_26910_c1 | 3300050492 | Bacteria | 3290 |
| 303 | nmdc:mga06z11_151661_c1 | 3300050494 | Bacteria | 1318 |
| 304 | nmdc:mga06z11_18202_c1 | 3300050494 | Bacteria | 3204 |
| 305 | nmdc:mga06z11_7906_c1 | 3300050494 | Bacteria | 4403 |
| 306 | nmdc:mga07m45_4997_c1 | 3300050496 | Bacteria | 6549 |
| 307 | nmdc:mga0n895_36953_c1 | 3300050512 | Bacteria | 4720 |
| 308 | nmdc:mga0sz30_3789_c1 | 3300050516 | Bacteria | 5445 |
| 309 | Ga0500646_0004013 | 3300053090 | Bacteria | 3744 |
| 310 | Ga0500641_0002690 | 3300053096 | Bacteria | 6280 |
| 311 | Ga0500594_0020850 | 3300053118 | Bacteria | 1639 |
| 312 | Ga0500658_0024690 | 3300053134 | Bacteria | 2304 |
| 313 | Ga0500568_0027871 | 3300053139 | Bacteria | 2359 |
| 314 | Ga0500616_0010218 | 3300053153 | Bacteria | 5630 |
| 315 | Ga0500620_004765 | 3300053155 | Bacteria | 3068 |
| 316 | Ga0501084_0004611 | 3300054114 | Bacteria | 11257 |
| 317 | Ga0590071_004210 | 3300059421 | Bacteria | 3505 |
| 318 | Ga0501082_0004303 | 3300060353 | Bacteria | 12449 |
| 319 | Ga0501082_0062193 | 3300060353 | Bacteria | 3213 |
| 320 | Ga0501082_0184598 | 3300060353 | Bacteria | 1815 |
| 321 | Ga0530510_0001878 | 3300061734 | Bacteria | 14333 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300012512 | Ga0157327_1001603 | Ga0157327_10016033 | 224 |
| 2 | 3300044712 | Ga0453684_0414883 | Ga0453684_0414883_271_951 | 226 |
| 3 | 3300046523 | Ga0495644_0197223 | Ga0495644_0197223_79_759 | 226 |
| 4 | iso_pu_bacteria | 2958041894 | 2958045419 | 234 |
| 5 | 3300039450 | Ga0436363_0516515 | Ga0436363_0516515_230_1003 | 237 |
| 6 | 3300041507 | Ga0451851_1188839 | Ga0451851_1188839_14_736 | 240 |
| 7 | 3300048904 | Ga0496101_0066731 | Ga0496101_0066731_1702_2478 | 249 |
| 8 | iso_pu_bacteria | 2512047086 | 2512535109 | 253 |
| 9 | iso_pu_bacteria | 2856364286 | 2856371186 | 253 |
| 10 | iso_pu_bacteria | 2891633521 | 2891636791 | 253 |
| 11 | iso_pu_bacteria | 2913308742 | 2913311672 | 255 |
| 12 | 3300021388 | Ga0213875_10096966 | Ga0213875_100969661 | 257 |
| 13 | 3300026023 | Ga0207677_10744412 | Ga0207677_107444121 | 257 |
| 14 | 3300037853 | Ga0436364_0005451 | Ga0436364_0005451_566_1339 | 257 |
| 15 | 3300044694 | Ga0466963_0051763 | Ga0466963_0051763_1742_2515 | 257 |
| 16 | 3300046460 | Ga0495638_0129230 | Ga0495638_0129230_609_1382 | 257 |
| 17 | 3300048090 | Ga0495615_0031598 | Ga0495615_0031598_50_823 | 257 |
| 18 | 3300048903 | Ga0496100_0008509 | Ga0496100_0008509_3569_4342 | 257 |
| 19 | 3300049569 | Ga0501032_0000104 | Ga0501032_0000104_8694_9470 | 257 |
| 20 | 3300049570 | Ga0501033_0000566 | Ga0501033_0000566_8696_9472 | 257 |
| 21 | 3300049571 | Ga0501034_0000529 | Ga0501034_0000529_8694_9470 | 257 |
| 22 | 3300049572 | Ga0501036_0000087 | Ga0501036_0000087_8694_9470 | 257 |
| 23 | 3300049572 | Ga0501036_0004013 | Ga0501036_0004013_10016_10789 | 257 |
| 24 | 3300049573 | Ga0501037_0000029 | Ga0501037_0000029_8686_9462 | 257 |
| 25 | 3300049574 | Ga0501038_0000120 | Ga0501038_0000120_3840_4616 | 257 |
| 26 | 3300049575 | Ga0501039_0000043 | Ga0501039_0000043_8674_9450 | 257 |
| 27 | 3300049575 | Ga0501039_0002697 | Ga0501039_0002697_11172_11945 | 257 |
| 28 | 3300049576 | Ga0501040_0008124 | Ga0501040_0008124_705_1478 | 257 |
| 29 | 3300049578 | Ga0501042_0016931 | Ga0501042_0016931_3843_4616 | 257 |
| 30 | 3300049579 | Ga0501043_0000160 | Ga0501043_0000160_8694_9470 | 257 |
| 31 | 3300049580 | Ga0501046_0007817 | Ga0501046_0007817_6156_6932 | 257 |
| 32 | 3300049582 | Ga0501048_0002702 | Ga0501048_0002702_7807_8580 | 257 |
| 33 | 3300049585 | Ga0501069_0089327 | Ga0501069_0089327_715_1488 | 257 |
| 34 | 3300049587 | Ga0501071_0001677 | Ga0501071_0001677_11348_12121 | 257 |
| 35 | 3300049588 | Ga0501072_0001126 | Ga0501072_0001126_14009_14782 | 257 |
| 36 | 3300049590 | Ga0501074_0125426 | Ga0501074_0125426_665_1438 | 257 |
| 37 | 3300049591 | Ga0501075_0001155 | Ga0501075_0001155_3917_4690 | 257 |
| 38 | 3300049591 | Ga0501075_0019180 | Ga0501075_0019180_1660_2433 | 257 |
| 39 | 3300049592 | Ga0501076_0000538 | Ga0501076_0000538_897_1670 | 257 |
| 40 | 3300049592 | Ga0501076_0177498 | Ga0501076_0177498_224_997 | 257 |
| 41 | 3300049593 | Ga0501077_0003995 | Ga0501077_0003995_1177_1950 | 257 |
| 42 | 3300049593 | Ga0501077_0113662 | Ga0501077_0113662_395_1168 | 257 |
| 43 | 3300049741 | Ga0501079_0001207 | Ga0501079_0001207_4912_5685 | 257 |
| 44 | 3300049742 | Ga0501080_0230920 | Ga0501080_0230920_712_1485 | 257 |
| 45 | 3300049743 | Ga0501081_0006860 | Ga0501081_0006860_4009_4782 | 257 |
| 46 | 3300049822 | Ga0501035_0000057 | Ga0501035_0000057_8666_9442 | 257 |
| 47 | 3300049824 | Ga0501045_0001420 | Ga0501045_0001420_7709_8482 | 257 |
| 48 | 3300054114 | Ga0501084_0004611 | Ga0501084_0004611_9454_10227 | 257 |
| 49 | 3300060353 | Ga0501082_0004303 | Ga0501082_0004303_5447_6220 | 257 |
| 50 | 3300060353 | Ga0501082_0184598 | Ga0501082_0184598_445_1218 | 257 |
| 51 | 3300061734 | Ga0530510_0001878 | Ga0530510_0001878_5844_6617 | 257 |
| 52 | 3300005333 | Ga0070677_10012128 | Ga0070677_100121283 | 258 |
| 53 | 3300005340 | Ga0070689_100010914 | Ga0070689_1000109148 | 258 |
| 54 | 3300005347 | Ga0070668_100008941 | Ga0070668_1000089413 | 258 |
| 55 | 3300005347 | Ga0070668_100018393 | Ga0070668_1000183932 | 258 |
| 56 | 3300005354 | Ga0070675_100026872 | Ga0070675_1000268724 | 258 |
| 57 | 3300005355 | Ga0070671_100182991 | Ga0070671_1001829911 | 258 |
| 58 | 3300005364 | Ga0070673_100040687 | Ga0070673_1000406873 | 258 |
| 59 | 3300005364 | Ga0070673_100609367 | Ga0070673_1006093672 | 258 |
| 60 | 3300005366 | Ga0070659_100375422 | Ga0070659_1003754221 | 258 |
| 61 | 3300005367 | Ga0070667_100031628 | Ga0070667_1000316283 | 258 |
| 62 | 3300005367 | Ga0070667_100031771 | Ga0070667_1000317712 | 258 |
| 63 | 3300005436 | Ga0070713_100019399 | Ga0070713_1000193993 | 258 |
| 64 | 3300005456 | Ga0070678_100036527 | Ga0070678_1000365272 | 258 |
| 65 | 3300005456 | Ga0070678_100048982 | Ga0070678_1000489823 | 258 |
| 66 | 3300005457 | Ga0070662_100017431 | Ga0070662_1000174314 | 258 |
| 67 | 3300005468 | Ga0070707_100178113 | Ga0070707_1001781132 | 258 |
| 68 | 3300005471 | Ga0070698_100003213 | Ga0070698_10000321317 | 258 |
| 69 | 3300005530 | Ga0070679_100003097 | Ga0070679_10000309710 | 258 |
| 70 | 3300005530 | Ga0070679_100232256 | Ga0070679_1002322563 | 258 |
| 71 | 3300005535 | Ga0070684_100678407 | Ga0070684_1006784072 | 258 |
| 72 | 3300005536 | Ga0070697_100208325 | Ga0070697_1002083252 | 258 |
| 73 | 3300005539 | Ga0068853_100032138 | Ga0068853_1000321382 | 258 |
| 74 | 3300005543 | Ga0070672_100132284 | Ga0070672_1001322842 | 258 |
| 75 | 3300005548 | Ga0070665_100099879 | Ga0070665_1000998792 | 258 |
| 76 | 3300005548 | Ga0070665_100270590 | Ga0070665_1002705901 | 258 |
| 77 | 3300005549 | Ga0070704_100006200 | Ga0070704_1000062004 | 258 |
| 78 | 3300005563 | Ga0068855_100020041 | Ga0068855_1000200416 | 258 |
| 79 | 3300005563 | Ga0068855_100089062 | Ga0068855_1000890623 | 258 |
| 80 | 3300005563 | Ga0068855_100743337 | Ga0068855_1007433372 | 258 |
| 81 | 3300005577 | Ga0068857_100059650 | Ga0068857_1000596502 | 258 |
| 82 | 3300005577 | Ga0068857_100438178 | Ga0068857_1004381782 | 258 |
| 83 | 3300005614 | Ga0068856_100034640 | Ga0068856_1000346403 | 258 |
| 84 | 3300005616 | Ga0068852_100042700 | Ga0068852_1000427004 | 258 |
| 85 | 3300005617 | Ga0068859_100192803 | Ga0068859_1001928033 | 258 |
| 86 | 3300005617 | Ga0068859_100283860 | Ga0068859_1002838602 | 258 |
| 87 | 3300005617 | Ga0068859_100420540 | Ga0068859_1004205402 | 258 |
| 88 | 3300005618 | Ga0068864_100064382 | Ga0068864_1000643823 | 258 |
| 89 | 3300005841 | Ga0068863_100266693 | Ga0068863_1002666932 | 258 |
| 90 | 3300005841 | Ga0068863_100294120 | Ga0068863_1002941202 | 258 |
| 91 | 3300005841 | Ga0068863_100514439 | Ga0068863_1005144392 | 258 |
| 92 | 3300005841 | Ga0068863_100524522 | Ga0068863_1005245222 | 258 |
| 93 | 3300005842 | Ga0068858_100235306 | Ga0068858_1002353062 | 258 |
| 94 | 3300005843 | Ga0068860_100001005 | Ga0068860_10000100511 | 258 |
| 95 | 3300005843 | Ga0068860_100006131 | Ga0068860_10000613112 | 258 |
| 96 | 3300005843 | Ga0068860_100042848 | Ga0068860_1000428482 | 258 |
| 97 | 3300005843 | Ga0068860_100127259 | Ga0068860_1001272592 | 258 |
| 98 | 3300005844 | Ga0068862_100003900 | Ga0068862_1000039009 | 258 |
| 99 | 3300005844 | Ga0068862_100042981 | Ga0068862_1000429813 | 258 |
| 100 | 3300005844 | Ga0068862_100131676 | Ga0068862_1001316762 | 258 |
| 101 | 3300005937 | Ga0081455_10001851 | Ga0081455_100018517 | 258 |
| 102 | 3300005937 | Ga0081455_10007317 | Ga0081455_1000731711 | 258 |
| 103 | 3300005937 | Ga0081455_10067638 | Ga0081455_100676384 | 258 |
| 104 | 3300005981 | Ga0081538_10059489 | Ga0081538_100594892 | 258 |
| 105 | 3300005983 | Ga0081540_1074349 | Ga0081540_10743491 | 258 |
| 106 | 3300005985 | Ga0081539_10007008 | Ga0081539_100070088 | 258 |
| 107 | 3300006038 | Ga0075365_10035918 | Ga0075365_100359184 | 258 |
| 108 | 3300006038 | Ga0075365_10164689 | Ga0075365_101646892 | 258 |
| 109 | 3300006038 | Ga0075365_10182487 | Ga0075365_101824872 | 258 |
| 110 | 3300006038 | Ga0075365_10193073 | Ga0075365_101930732 | 258 |
| 111 | 3300006048 | Ga0075363_100147269 | Ga0075363_1001472691 | 258 |
| 112 | 3300006177 | Ga0075362_10012467 | Ga0075362_100124674 | 258 |
| 113 | 3300006178 | Ga0075367_10018803 | Ga0075367_100188034 | 258 |
| 114 | 3300006178 | Ga0075367_10233103 | Ga0075367_102331032 | 258 |
| 115 | 3300006195 | Ga0075366_10007227 | Ga0075366_100072275 | 258 |
| 116 | 3300006353 | Ga0075370_10010161 | Ga0075370_100101612 | 258 |
| 117 | 3300006353 | Ga0075370_10054366 | Ga0075370_100543661 | 258 |
| 118 | 3300006844 | Ga0075428_100624721 | Ga0075428_1006247212 | 258 |
| 119 | 3300006852 | Ga0075433_10167217 | Ga0075433_101672172 | 258 |
| 120 | 3300006871 | Ga0075434_100039508 | Ga0075434_1000395083 | 258 |
| 121 | 3300006931 | Ga0097620_100192806 | Ga0097620_1001928062 | 258 |
| 122 | 3300006931 | Ga0097620_100283860 | Ga0097620_1002838602 | 258 |
| 123 | 3300006931 | Ga0097620_100420543 | Ga0097620_1004205432 | 258 |
| 124 | 3300007265 | Ga0099794_10043244 | Ga0099794_100432442 | 258 |
| 125 | 3300009148 | Ga0105243_10140556 | Ga0105243_101405563 | 258 |
| 126 | 3300009174 | Ga0105241_10196577 | Ga0105241_101965772 | 258 |
| 127 | 3300009176 | Ga0105242_10219708 | Ga0105242_102197083 | 258 |
| 128 | 3300009545 | Ga0105237_10109429 | Ga0105237_101094293 | 258 |
| 129 | 3300009551 | Ga0105238_10036475 | Ga0105238_100364753 | 258 |
| 130 | 3300009551 | Ga0105238_10533653 | Ga0105238_105336532 | 258 |
| 131 | 3300010159 | Ga0099796_10144413 | Ga0099796_101444131 | 258 |
| 132 | 3300010375 | Ga0105239_10025157 | Ga0105239_100251577 | 258 |
| 133 | 3300013100 | Ga0157373_10163456 | Ga0157373_101634562 | 258 |
| 134 | 3300013102 | Ga0157371_10029522 | Ga0157371_100295224 | 258 |
| 135 | 3300013104 | Ga0157370_10082675 | Ga0157370_100826754 | 258 |
| 136 | 3300013297 | Ga0157378_10464140 | Ga0157378_104641402 | 258 |
| 137 | 3300013306 | Ga0163162_10023860 | Ga0163162_100238605 | 258 |
| 138 | 3300013306 | Ga0163162_10137657 | Ga0163162_101376573 | 258 |
| 139 | 3300013307 | Ga0157372_10108950 | Ga0157372_101089503 | 258 |
| 140 | 3300014969 | Ga0157376_10235105 | Ga0157376_102351052 | 258 |
| 141 | 3300015262 | Ga0182007_10070870 | Ga0182007_100708701 | 258 |
| 142 | 3300017792 | Ga0163161_10012339 | Ga0163161_100123395 | 258 |
| 143 | 3300021441 | Ga0213871_10001196 | Ga0213871_100011963 | 258 |
| 144 | 3300025302 | Ga0207426_1012906 | Ga0207426_10129064 | 258 |
| 145 | 3300025909 | Ga0207705_10032117 | Ga0207705_100321174 | 258 |
| 146 | 3300025910 | Ga0207684_10233656 | Ga0207684_102336562 | 258 |
| 147 | 3300025912 | Ga0207707_10003527 | Ga0207707_1000352715 | 258 |
| 148 | 3300025921 | Ga0207652_10009517 | Ga0207652_100095174 | 258 |
| 149 | 3300025921 | Ga0207652_10442175 | Ga0207652_104421752 | 258 |
| 150 | 3300025924 | Ga0207694_10279889 | Ga0207694_102798892 | 258 |
| 151 | 3300025925 | Ga0207650_10193733 | Ga0207650_101937332 | 258 |
| 152 | 3300025928 | Ga0207700_10012529 | Ga0207700_100125293 | 258 |
| 153 | 3300025928 | Ga0207700_10100402 | Ga0207700_101004021 | 258 |
| 154 | 3300025928 | Ga0207700_10333114 | Ga0207700_103331142 | 258 |
| 155 | 3300025931 | Ga0207644_10066648 | Ga0207644_100666481 | 258 |
| 156 | 3300025931 | Ga0207644_10144780 | Ga0207644_101447801 | 258 |
| 157 | 3300025933 | Ga0207706_10041584 | Ga0207706_100415844 | 258 |
| 158 | 3300025936 | Ga0207670_10310086 | Ga0207670_103100862 | 258 |
| 159 | 3300025940 | Ga0207691_10180333 | Ga0207691_101803332 | 258 |
| 160 | 3300025944 | Ga0207661_10007715 | Ga0207661_100077158 | 258 |
| 161 | 3300025945 | Ga0207679_10006048 | Ga0207679_100060485 | 258 |
| 162 | 3300025949 | Ga0207667_10002821 | Ga0207667_1000282118 | 258 |
| 163 | 3300025949 | Ga0207667_10231862 | Ga0207667_102318622 | 258 |
| 164 | 3300025960 | Ga0207651_10089824 | Ga0207651_100898243 | 258 |
| 165 | 3300025960 | Ga0207651_10245906 | Ga0207651_102459062 | 258 |
| 166 | 3300025972 | Ga0207668_10048547 | Ga0207668_100485471 | 258 |
| 167 | 3300025972 | Ga0207668_10054485 | Ga0207668_100544852 | 258 |
| 168 | 3300025972 | Ga0207668_10056560 | Ga0207668_100565603 | 258 |
| 169 | 3300025981 | Ga0207640_10090052 | Ga0207640_100900523 | 258 |
| 170 | 3300025986 | Ga0207658_10119301 | Ga0207658_101193012 | 258 |
| 171 | 3300026023 | Ga0207677_10289767 | Ga0207677_102897671 | 258 |
| 172 | 3300026035 | Ga0207703_10194732 | Ga0207703_101947321 | 258 |
| 173 | 3300026041 | Ga0207639_10016345 | Ga0207639_100163454 | 258 |
| 174 | 3300026078 | Ga0207702_10023845 | Ga0207702_100238454 | 258 |
| 175 | 3300026078 | Ga0207702_10155395 | Ga0207702_101553952 | 258 |
| 176 | 3300026088 | Ga0207641_10017251 | Ga0207641_100172514 | 258 |
| 177 | 3300026088 | Ga0207641_10467627 | Ga0207641_104676272 | 258 |
| 178 | 3300026088 | Ga0207641_10711775 | Ga0207641_107117751 | 258 |
| 179 | 3300026095 | Ga0207676_10166059 | Ga0207676_101660592 | 258 |
| 180 | 3300026095 | Ga0207676_10338913 | Ga0207676_103389132 | 258 |
| 181 | 3300026116 | Ga0207674_10117862 | Ga0207674_101178623 | 258 |
| 182 | 3300026116 | Ga0207674_10141304 | Ga0207674_101413042 | 258 |
| 183 | 3300026118 | Ga0207675_100110833 | Ga0207675_1001108331 | 258 |
| 184 | 3300026121 | Ga0207683_10024960 | Ga0207683_100249605 | 258 |
| 185 | 3300026121 | Ga0207683_10056923 | Ga0207683_100569232 | 258 |
| 186 | 3300028379 | Ga0268266_10004061 | Ga0268266_100040618 | 258 |
| 187 | 3300028379 | Ga0268266_10039802 | Ga0268266_100398023 | 258 |
| 188 | 3300028380 | Ga0268265_10033771 | Ga0268265_100337714 | 258 |
| 189 | 3300028380 | Ga0268265_10058200 | Ga0268265_100582003 | 258 |
| 190 | 3300028380 | Ga0268265_10153928 | Ga0268265_101539282 | 258 |
| 191 | 3300028381 | Ga0268264_10000014 | Ga0268264_10000014321 | 258 |
| 192 | 3300028381 | Ga0268264_10085619 | Ga0268264_100856192 | 258 |
| 193 | 3300028381 | Ga0268264_10167448 | Ga0268264_101674482 | 258 |
| 194 | 3300028573 | Ga0265334_10006563 | Ga0265334_100065634 | 258 |
| 195 | 3300028786 | Ga0307517_10005652 | Ga0307517_100056525 | 258 |
| 196 | 3300028786 | Ga0307517_10067953 | Ga0307517_100679532 | 258 |
| 197 | 3300028786 | Ga0307517_10078776 | Ga0307517_100787763 | 258 |
| 198 | 3300031247 | Ga0265340_10036337 | Ga0265340_100363372 | 258 |
| 199 | 3300031456 | Ga0307513_10000899 | Ga0307513_1000089944 | 258 |
| 200 | 3300031456 | Ga0307513_10000983 | Ga0307513_1000098345 | 258 |
| 201 | 3300031730 | Ga0307516_10000338 | Ga0307516_1000033818 | 258 |
| 202 | 3300031730 | Ga0307516_10000438 | Ga0307516_1000043832 | 258 |
| 203 | 3300033180 | Ga0307510_10000393 | Ga0307510_1000039331 | 258 |
| 204 | 3300035086 | Ga0373934_0003938 | Ga0373934_0003938_778_1554 | 258 |
| 205 | 3300035112 | Ga0373932_0053517 | Ga0373932_0053517_75_851 | 258 |
| 206 | 3300035115 | Ga0373941_0054179 | Ga0373941_0054179_162_941 | 258 |
| 207 | 3300035117 | Ga0373953_0049319 | Ga0373953_0049319_827_1603 | 258 |
| 208 | 3300035119 | Ga0373956_0010994 | Ga0373956_0010994_2809_3585 | 258 |
| 209 | 3300035120 | Ga0373957_0005152 | Ga0373957_0005152_1214_1990 | 258 |
| 210 | 3300035172 | Ga0373955_0054992 | Ga0373955_0054992_571_1347 | 258 |
| 211 | 3300035695 | Ga0373927_0090857 | Ga0373927_0090857_609_1388 | 258 |
| 212 | 3300035695 | Ga0373927_0186932 | Ga0373927_0186932_417_1196 | 258 |
| 213 | 3300035724 | Ga0373933_0001967 | Ga0373933_0001967_10134_10910 | 258 |
| 214 | 3300036401 | Ga0373937_0001916 | Ga0373937_0001916_11590_12366 | 258 |
| 215 | 3300036401 | Ga0373937_0142663 | Ga0373937_0142663_707_1483 | 258 |
| 216 | 3300036401 | Ga0373937_0464060 | Ga0373937_0464060_355_1131 | 258 |
| 217 | 3300037068 | Ga0373925_0001751 | Ga0373925_0001751_8333_9109 | 258 |
| 218 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_592315_593091 | 258 |
| 219 | 3300037312 | Ga0395899_0008576 | Ga0395899_0008576_6273_7052 | 258 |
| 220 | 3300037418 | Ga0395900_0042361 | Ga0395900_0042361_755_1534 | 258 |
| 221 | 3300037418 | Ga0395900_0046371 | Ga0395900_0046371_1135_1917 | 258 |
| 222 | 3300037418 | Ga0395900_0074822 | Ga0395900_0074822_1255_2034 | 258 |
| 223 | 3300037418 | Ga0395900_0191774 | Ga0395900_0191774_753_1535 | 258 |
| 224 | 3300037418 | Ga0395900_0482191 | Ga0395900_0482191_252_1031 | 258 |
| 225 | 3300037466 | Ga0395898_0019368 | Ga0395898_0019368_3924_4703 | 258 |
| 226 | 3300037466 | Ga0395898_0021926 | Ga0395898_0021926_1089_1871 | 258 |
| 227 | 3300037466 | Ga0395898_0150214 | Ga0395898_0150214_31_810 | 258 |
| 228 | 3300037471 | Ga0395905_0597957 | Ga0395905_0597957_70_852 | 258 |
| 229 | 3300037853 | Ga0436364_0752967 | Ga0436364_0752967_167_943 | 258 |
| 230 | 3300038443 | Ga0395901_0002710 | Ga0395901_0002710_16840_17616 | 258 |
| 231 | 3300038443 | Ga0395901_0007074 | Ga0395901_0007074_7313_8092 | 258 |
| 232 | 3300038443 | Ga0395901_0015701 | Ga0395901_0015701_4890_5669 | 258 |
| 233 | 3300038443 | Ga0395901_0030636 | Ga0395901_0030636_1225_2004 | 258 |
| 234 | 3300038443 | Ga0395901_0051838 | Ga0395901_0051838_3173_3955 | 258 |
| 235 | 3300038443 | Ga0395901_0287141 | Ga0395901_0287141_123_899 | 258 |
| 236 | 3300039437 | Ga0436365_0457672 | Ga0436365_0457672_397_1176 | 258 |
| 237 | 3300039438 | Ga0436360_1076911 | Ga0436360_1076911_8636_9415 | 258 |
| 238 | 3300039447 | Ga0436361_0045943 | Ga0436361_0045943_2526_3302 | 258 |
| 239 | 3300039447 | Ga0436361_0345649 | Ga0436361_0345649_32_808 | 258 |
| 240 | 3300039447 | Ga0436361_0523753 | Ga0436361_0523753_98_874 | 258 |
| 241 | 3300042876 | Ga0451577_0024678 | Ga0451577_0024678_676_1452 | 258 |
| 242 | 3300042876 | Ga0451577_0112039 | Ga0451577_0112039_681_1457 | 258 |
| 243 | 3300042876 | Ga0451577_0174301 | Ga0451577_0174301_800_1630 | 258 |
| 244 | 3300042876 | Ga0451577_0300820 | Ga0451577_0300820_301_1077 | 258 |
| 245 | 3300042876 | Ga0451577_0393755 | Ga0451577_0393755_299_1075 | 258 |
| 246 | 3300044684 | Ga0466966_0071594 | Ga0466966_0071594_640_1416 | 258 |
| 247 | 3300044706 | Ga0466964_0143089 | Ga0466964_0143089_139_918 | 258 |
| 248 | 3300044712 | Ga0453684_0096303 | Ga0453684_0096303_2186_2962 | 258 |
| 249 | 3300044712 | Ga0453684_0147473 | Ga0453684_0147473_942_1718 | 258 |
| 250 | 3300044712 | Ga0453684_0514054 | Ga0453684_0514054_525_1301 | 258 |
| 251 | 3300044712 | Ga0453684_0877405 | Ga0453684_0877405_73_849 | 258 |
| 252 | 3300045051 | Ga0451576_0016981 | Ga0451576_0016981_891_1721 | 258 |
| 253 | 3300045976 | Ga0466967_0047418 | Ga0466967_0047418_2846_3625 | 258 |
| 254 | 3300046472 | Ga0495580_0007367 | Ga0495580_0007367_6587_7363 | 258 |
| 255 | 3300046473 | Ga0495582_0227459 | Ga0495582_0227459_187_966 | 258 |
| 256 | 3300046475 | Ga0495639_0000388 | Ga0495639_0000388_18745_19521 | 258 |
| 257 | 3300046491 | Ga0495584_0128382 | Ga0495584_0128382_100_876 | 258 |
| 258 | 3300046499 | Ga0495594_0264172 | Ga0495594_0264172_145_921 | 258 |
| 259 | 3300046506 | Ga0495583_0104313 | Ga0495583_0104313_144_920 | 258 |
| 260 | 3300046526 | Ga0495666_0000304 | Ga0495666_0000304_1578_2354 | 258 |
| 261 | 3300046531 | Ga0495665_0042865 | Ga0495665_0042865_1477_2253 | 258 |
| 262 | 3300046558 | Ga0495633_0080077 | Ga0495633_0080077_325_1101 | 258 |
| 263 | 3300046648 | Ga0495611_0032336 | Ga0495611_0032336_497_1273 | 258 |
| 264 | 3300046660 | Ga0495625_0085616 | Ga0495625_0085616_453_1229 | 258 |
| 265 | 3300046674 | Ga0495588_0034168 | Ga0495588_0034168_927_1703 | 258 |
| 266 | 3300046684 | Ga0495669_0008979 | Ga0495669_0008979_879_1655 | 258 |
| 267 | 3300046690 | Ga0495624_0255065 | Ga0495624_0255065_255_1031 | 258 |
| 268 | 3300047317 | Ga0495604_0034176 | Ga0495604_0034176_1888_2664 | 258 |
| 269 | 3300047318 | Ga0495636_0055860 | Ga0495636_0055860_369_1145 | 258 |
| 270 | 3300047322 | Ga0495680_0281344 | Ga0495680_0281344_155_931 | 258 |
| 271 | 3300047445 | Ga0495677_0015539 | Ga0495677_0015539_1215_1991 | 258 |
| 272 | 3300048903 | Ga0496100_0047840 | Ga0496100_0047840_1147_1923 | 258 |
| 273 | 3300048904 | Ga0496101_0027250 | Ga0496101_0027250_2956_3732 | 258 |
| 274 | 3300048904 | Ga0496101_0340436 | Ga0496101_0340436_347_1123 | 258 |
| 275 | 3300048905 | Ga0496102_0013616 | Ga0496102_0013616_3863_4639 | 258 |
| 276 | 3300048905 | Ga0496102_0023737 | Ga0496102_0023737_3565_4341 | 258 |
| 277 | 3300048905 | Ga0496102_0039600 | Ga0496102_0039600_682_1458 | 258 |
| 278 | 3300048905 | Ga0496102_0664767 | Ga0496102_0664767_165_941 | 258 |
| 279 | 3300048906 | Ga0496103_0061413 | Ga0496103_0061413_836_1612 | 258 |
| 280 | 3300048906 | Ga0496103_0377313 | Ga0496103_0377313_91_867 | 258 |
| 281 | 3300048907 | Ga0496104_0058221 | Ga0496104_0058221_1154_1930 | 258 |
| 282 | 3300048908 | Ga0496105_0002194 | Ga0496105_0002194_3536_4312 | 258 |
| 283 | 3300048909 | Ga0496106_0313150 | Ga0496106_0313150_288_1064 | 258 |
| 284 | 3300048909 | Ga0496106_0342689 | Ga0496106_0342689_83_859 | 258 |
| 285 | 3300048910 | Ga0496107_0093239 | Ga0496107_0093239_595_1371 | 258 |
| 286 | 3300048911 | Ga0496108_0109650 | Ga0496108_0109650_936_1712 | 258 |
| 287 | 3300048911 | Ga0496108_0131309 | Ga0496108_0131309_627_1403 | 258 |
| 288 | 3300048913 | Ga0496110_0087567 | Ga0496110_0087567_1075_1851 | 258 |
| 289 | 3300048914 | Ga0496111_0046299 | Ga0496111_0046299_850_1626 | 258 |
| 290 | 3300048915 | Ga0496112_0034038 | Ga0496112_0034038_3445_4221 | 258 |
| 291 | 3300048915 | Ga0496112_0233382 | Ga0496112_0233382_448_1230 | 258 |
| 292 | 3300048915 | Ga0496112_0407274 | Ga0496112_0407274_225_1001 | 258 |
| 293 | 3300048917 | Ga0496114_0162572 | Ga0496114_0162572_773_1549 | 258 |
| 294 | 3300049570 | Ga0501033_0107058 | Ga0501033_0107058_384_1163 | 258 |
| 295 | 3300049571 | Ga0501034_0007498 | Ga0501034_0007498_1986_2762 | 258 |
| 296 | 3300049571 | Ga0501034_0026574 | Ga0501034_0026574_1999_2775 | 258 |
| 297 | 3300049573 | Ga0501037_0151877 | Ga0501037_0151877_295_1077 | 258 |
| 298 | 3300049575 | Ga0501039_0153282 | Ga0501039_0153282_221_997 | 258 |
| 299 | 3300049580 | Ga0501046_0063928 | Ga0501046_0063928_497_1279 | 258 |
| 300 | 3300049584 | Ga0501068_0085315 | Ga0501068_0085315_702_1478 | 258 |
| 301 | 3300049586 | Ga0501070_0037789 | Ga0501070_0037789_1188_1964 | 258 |
| 302 | 3300049588 | Ga0501072_0530023 | Ga0501072_0530023_112_888 | 258 |
| 303 | 3300049589 | Ga0501073_0229595 | Ga0501073_0229595_13_792 | 258 |
| 304 | 3300049742 | Ga0501080_0253988 | Ga0501080_0253988_486_1265 | 258 |
| 305 | 3300049822 | Ga0501035_0275315 | Ga0501035_0275315_192_974 | 258 |
| 306 | 3300049823 | Ga0501044_0102361 | Ga0501044_0102361_652_1434 | 258 |
| 307 | 3300049824 | Ga0501045_0247981 | Ga0501045_0247981_351_1127 | 258 |
| 308 | 3300050489 | nmdc:mga03683_2990_c1 | nmdc:mga03683_2990_c1_956_1735 | 258 |
| 309 | 3300050492 | nmdc:mga0yw44_124120_c1 | nmdc:mga0yw44_124120_c1_77_856 | 258 |
| 310 | 3300050492 | nmdc:mga0yw44_217670_c1 | nmdc:mga0yw44_217670_c1_51_842 | 258 |
| 311 | 3300050492 | nmdc:mga0yw44_26910_c1 | nmdc:mga0yw44_26910_c1_239_1018 | 258 |
| 312 | 3300050494 | nmdc:mga06z11_151661_c1 | nmdc:mga06z11_151661_c1_397_1188 | 258 |
| 313 | 3300050494 | nmdc:mga06z11_18202_c1 | nmdc:mga06z11_18202_c1_2137_2916 | 258 |
| 314 | 3300050494 | nmdc:mga06z11_7906_c1 | nmdc:mga06z11_7906_c1_2035_2814 | 258 |
| 315 | 3300050496 | nmdc:mga07m45_4997_c1 | nmdc:mga07m45_4997_c1_2269_3048 | 258 |
| 316 | 3300050512 | nmdc:mga0n895_36953_c1 | nmdc:mga0n895_36953_c1_2909_3685 | 258 |
| 317 | 3300050516 | nmdc:mga0sz30_3789_c1 | nmdc:mga0sz30_3789_c1_4231_5010 | 258 |
| 318 | 3300053090 | Ga0500646_0004013 | Ga0500646_0004013_2444_3220 | 258 |
| 319 | 3300053096 | Ga0500641_0002690 | Ga0500641_0002690_4440_5219 | 258 |
| 320 | 3300053118 | Ga0500594_0020850 | Ga0500594_0020850_788_1564 | 258 |
| 321 | 3300053134 | Ga0500658_0024690 | Ga0500658_0024690_14_805 | 258 |
| 322 | 3300053139 | Ga0500568_0027871 | Ga0500568_0027871_1168_1944 | 258 |
| 323 | 3300053153 | Ga0500616_0010218 | Ga0500616_0010218_3626_4405 | 258 |
| 324 | 3300053155 | Ga0500620_004765 | Ga0500620_004765_1942_2721 | 258 |
| 325 | 3300059421 | Ga0590071_004210 | Ga0590071_004210_1209_1985 | 258 |
| 326 | 3300060353 | Ga0501082_0062193 | Ga0501082_0062193_235_1011 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h81-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis | 0.9812 | 5 | 258 |
| 5xzd-assembly1.cif.gz_F | structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism | 0.9773 | 5 | 233 |
| 3q0g-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa | 0.9758 | 5 | 257 |
| 5xzd-assembly1.cif.gz_D | structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism | 0.9748 | 4 | 233 |
| 3q0g-assembly2.cif.gz_D | crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa | 0.9746 | 5 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76082_198_255_1.10.12.10 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9821 | 203 | 256 | 1.10.12.10 |
| 3q0jB02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9782 | 201 | 255 | 1.10.12.10 |
| 3q0jE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9779 | 201 | 255 | 1.10.12.10 |
| 3h81B02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9773 | 201 | 257 | 1.10.12.10 |
| 4fjwE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9764 | 201 | 255 | 1.10.12.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839HM19-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9845 | 4 | 258 |
GO:0006635
GO:0016836 |
| AF-A0A840VBQ3-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9842 | 4 | 258 |
GO:0006635
GO:0016836 |
| AF-A0A522QB63-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9823 | 5 | 258 |
GO:0004300
GO:0006635 |
| AF-A0A1B8UKW5-F1-model_v4 | Enoyl-CoA hydratase | 0.9822 | 1 | 258 |
GO:0006635
GO:0016836 |
| AF-B8C2B7-F1-model_v4 | Enoyl-CoA hydratase | 0.9819 | 10 | 258 |
GO:0004300
GO:0005739 GO:0006635 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar