F408583

General Info

Members Datasets Scaffolds Average Seq Length
326 214 321 258

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958041894|2958045419
Length 234
Sequence TILVETRGKVGLITLNRPKALNALNSQVMAEVVAAVNAFNADAGIGAMVLTGSEKAFAAGADIKEMQAIAFVDAYTQDLFVGWEELTRARKPIIAAVAGYALGGGCELAMMCDFIIAGDNAKFGQPEITLGVMPGMGGSQRLTRFVGKSKAMDMCLTGRMMDAAEAERCGLVSRVVPAADLTEEALKAAAKIAEFSLPSVMMTKEAVNRAYETTLAEGLRFERRLFHSLFALDD

Samples

Sample ID Description Type Environment
1 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
2 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
3 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
4 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
5 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0.92
Rhizoplane 7.36
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10012128 3300005333 Bacteria 2987
2 Ga0070689_100010914 3300005340 Bacteria 6491
3 Ga0070668_100008941 3300005347 Bacteria 7437
4 Ga0070668_100018393 3300005347 Bacteria 5246
5 Ga0070675_100026872 3300005354 Bacteria 4621
6 Ga0070671_100182991 3300005355 Bacteria 1774
7 Ga0070673_100040687 3300005364 Bacteria 3568
8 Ga0070673_100609367 3300005364 Bacteria 996
9 Ga0070659_100375422 3300005366 Bacteria 1197
10 Ga0070667_100031628 3300005367 Bacteria 4411
11 Ga0070667_100031771 3300005367 Bacteria 4401
12 Ga0070713_100019399 3300005436 Bacteria 5190
13 Ga0070678_100036527 3300005456 Bacteria 3440
14 Ga0070678_100048982 3300005456 Bacteria 3047
15 Ga0070662_100017431 3300005457 Bacteria 4843
16 Ga0070707_100178113 3300005468 Bacteria 2072
17 Ga0070698_100003213 3300005471 Bacteria 18005
18 Ga0070679_100003097 3300005530 Bacteria 15194
19 Ga0070679_100232256 3300005530 Bacteria 1804
20 Ga0070684_100678407 3300005535 Bacteria 960
21 Ga0070697_100208325 3300005536 Bacteria 1664
22 Ga0068853_100032138 3300005539 Bacteria 4444
23 Ga0070672_100132284 3300005543 Bacteria 2051
24 Ga0070665_100099879 3300005548 Bacteria 2906
25 Ga0070665_100270590 3300005548 Bacteria 1701
26 Ga0070704_100006200 3300005549 Bacteria 7026
27 Ga0068855_100020041 3300005563 Bacteria 8030
28 Ga0068855_100089062 3300005563 Bacteria 3564
29 Ga0068855_100743337 3300005563 Bacteria 1046
30 Ga0068857_100059650 3300005577 Bacteria 3389
31 Ga0068857_100438178 3300005577 Bacteria 1220
32 Ga0068856_100034640 3300005614 Bacteria 4945
33 Ga0068852_100042700 3300005616 Bacteria 3840
34 Ga0068859_100192803 3300005617 Bacteria 2122
35 Ga0068859_100283860 3300005617 Bacteria 1748
36 Ga0068859_100420540 3300005617 Bacteria 1433
37 Ga0068864_100064382 3300005618 Bacteria 3179
38 Ga0068863_100266693 3300005841 Bacteria 1656
39 Ga0068863_100294120 3300005841 Bacteria 1574
40 Ga0068863_100514439 3300005841 Bacteria 1180
41 Ga0068863_100524522 3300005841 Bacteria 1168
42 Ga0068858_100235306 3300005842 Bacteria 1737
43 Ga0068860_100001005 3300005843 Bacteria 31230
44 Ga0068860_100006131 3300005843 Bacteria 12091
45 Ga0068860_100042848 3300005843 Bacteria 4320
46 Ga0068860_100127259 3300005843 Bacteria 2442
47 Ga0068862_100003900 3300005844 Bacteria 12675
48 Ga0068862_100042981 3300005844 Bacteria 3851
49 Ga0068862_100131676 3300005844 Bacteria 2212
50 Ga0081455_10001851 3300005937 Bacteria 25467
51 Ga0081455_10007317 3300005937 Bacteria 11641
52 Ga0081455_10067638 3300005937 Bacteria 2976
53 Ga0081538_10059489 3300005981 Bacteria 2206
54 Ga0081540_1074349 3300005983 Bacteria 1557
55 Ga0081539_10007008 3300005985 Bacteria 10455
56 Ga0075365_10035918 3300006038 Bacteria 3209
57 Ga0075365_10164689 3300006038 Bacteria 1546
58 Ga0075365_10182487 3300006038 Bacteria 1467
59 Ga0075365_10193073 3300006038 Bacteria 1425
60 Ga0075363_100147269 3300006048 Bacteria 1328
61 Ga0075362_10012467 3300006177 Bacteria 3379
62 Ga0075367_10018803 3300006178 Bacteria 3818
63 Ga0075367_10233103 3300006178 Bacteria 1153
64 Ga0075366_10007227 3300006195 Bacteria 6119
65 Ga0075370_10010161 3300006353 Bacteria 4907
66 Ga0075370_10054366 3300006353 Bacteria 2273
67 Ga0075428_100624721 3300006844 Bacteria 1150
68 Ga0075433_10167217 3300006852 Bacteria 1957
69 Ga0075434_100039508 3300006871 Bacteria 4676
70 Ga0097620_100192806 3300006931 Bacteria 2122
71 Ga0097620_100283860 3300006931 Bacteria 1748
72 Ga0097620_100420543 3300006931 Bacteria 1433
73 Ga0099794_10043244 3300007265 Bacteria 2150
74 Ga0105243_10140556 3300009148 Bacteria 2059
75 Ga0105241_10196577 3300009174 Bacteria 1682
76 Ga0105242_10219708 3300009176 Bacteria 1698
77 Ga0105237_10109429 3300009545 Bacteria 2755
78 Ga0105238_10036475 3300009551 Bacteria 4998
79 Ga0105238_10533653 3300009551 Bacteria 1177
80 Ga0099796_10144413 3300010159 Bacteria 932
81 Ga0105239_10025157 3300010375 Bacteria 6557
82 Ga0157327_1001603 3300012512 Bacteria 1448
83 Ga0157373_10163456 3300013100 Bacteria 1566
84 Ga0157371_10029522 3300013102 Bacteria 3963
85 Ga0157370_10082675 3300013104 Bacteria 3020
86 Ga0157378_10464140 3300013297 Bacteria 1259
87 Ga0163162_10023860 3300013306 Bacteria 6036
88 Ga0163162_10137657 3300013306 Bacteria 2553
89 Ga0157372_10108950 3300013307 Bacteria 3171
90 Ga0157376_10235105 3300014969 Bacteria 1704
91 Ga0182007_10070870 3300015262 Bacteria 1142
92 Ga0163161_10012339 3300017792 Bacteria 5930
93 Ga0213875_10096966 3300021388 Bacteria 1375
94 Ga0213871_10001196 3300021441 Bacteria 4187
95 Ga0207426_1012906 3300025302 Bacteria 3120
96 Ga0207705_10032117 3300025909 Bacteria 3750
97 Ga0207684_10233656 3300025910 Bacteria 1586
98 Ga0207707_10003527 3300025912 Bacteria 13853
99 Ga0207652_10009517 3300025921 Bacteria 7814
100 Ga0207652_10442175 3300025921 Bacteria 1172
101 Ga0207694_10279889 3300025924 Bacteria 1370
102 Ga0207650_10193733 3300025925 Bacteria 1625
103 Ga0207700_10012529 3300025928 Bacteria 5474
104 Ga0207700_10100402 3300025928 Bacteria 2306
105 Ga0207700_10333114 3300025928 Bacteria 1318
106 Ga0207644_10066648 3300025931 Bacteria 2622
107 Ga0207644_10144780 3300025931 Bacteria 1833
108 Ga0207706_10041584 3300025933 Bacteria 4074
109 Ga0207670_10310086 3300025936 Bacteria 1238
110 Ga0207691_10180333 3300025940 Bacteria 1846
111 Ga0207661_10007715 3300025944 Bacteria 7659
112 Ga0207679_10006048 3300025945 Bacteria 7628
113 Ga0207667_10002821 3300025949 Bacteria 21552
114 Ga0207667_10231862 3300025949 Bacteria 1890
115 Ga0207651_10089824 3300025960 Bacteria 2244
116 Ga0207651_10245906 3300025960 Bacteria 1461
117 Ga0207668_10048547 3300025972 Bacteria 2913
118 Ga0207668_10054485 3300025972 Bacteria 2776
119 Ga0207668_10056560 3300025972 Bacteria 2732
120 Ga0207640_10090052 3300025981 Bacteria 2122
121 Ga0207658_10119301 3300025986 Bacteria 2100
122 Ga0207677_10289767 3300026023 Bacteria 1348
123 Ga0207677_10744412 3300026023 Bacteria 873
124 Ga0207703_10194732 3300026035 Bacteria 1797
125 Ga0207639_10016345 3300026041 Bacteria 5249
126 Ga0207702_10023845 3300026078 Bacteria 5075
127 Ga0207702_10155395 3300026078 Bacteria 2085
128 Ga0207641_10017251 3300026088 Bacteria 5910
129 Ga0207641_10467627 3300026088 Bacteria 1221
130 Ga0207641_10711775 3300026088 Bacteria 989
131 Ga0207676_10166059 3300026095 Bacteria 1918
132 Ga0207676_10338913 3300026095 Bacteria 1386
133 Ga0207674_10117862 3300026116 Bacteria 2625
134 Ga0207674_10141304 3300026116 Bacteria 2367
135 Ga0207675_100110833 3300026118 Bacteria 2589
136 Ga0207683_10024960 3300026121 Bacteria 5153
137 Ga0207683_10056923 3300026121 Bacteria 3431
138 Ga0268266_10004061 3300028379 Bacteria 14147
139 Ga0268266_10039802 3300028379 Bacteria 4004
140 Ga0268265_10033771 3300028380 Bacteria 3722
141 Ga0268265_10058200 3300028380 Bacteria 2949
142 Ga0268265_10153928 3300028380 Bacteria 1943
143 Ga0268264_10000014 3300028381 Bacteria 509962
144 Ga0268264_10085619 3300028381 Bacteria 2705
145 Ga0268264_10167448 3300028381 Bacteria 1985
146 Ga0265334_10006563 3300028573 Bacteria 5007
147 Ga0307517_10005652 3300028786 Bacteria 18750
148 Ga0307517_10067953 3300028786 Bacteria 3254
149 Ga0307517_10078776 3300028786 Bacteria 2845
150 Ga0265340_10036337 3300031247 Bacteria 2442
151 Ga0307513_10000899 3300031456 Bacteria 42953
152 Ga0307513_10000983 3300031456 Bacteria 41242
153 Ga0307516_10000338 3300031730 Bacteria 61339
154 Ga0307516_10000438 3300031730 Bacteria 54750
155 Ga0307510_10000393 3300033180 Bacteria 41479
156 Ga0373934_0003938 3300035086 Bacteria 5459
157 Ga0373932_0053517 3300035112 Bacteria 1205
158 Ga0373941_0054179 3300035115 Bacteria 1285
159 Ga0373953_0049319 3300035117 Bacteria 1698
160 Ga0373956_0010994 3300035119 Bacteria 3725
161 Ga0373957_0005152 3300035120 Bacteria 4038
162 Ga0373955_0054992 3300035172 Bacteria 2178
163 Ga0373927_0090857 3300035695 Bacteria 1983
164 Ga0373927_0186932 3300035695 Bacteria 1359
165 Ga0373933_0001967 3300035724 Bacteria 11839
166 Ga0373937_0001916 3300036401 Bacteria 17426
167 Ga0373937_0142663 3300036401 Bacteria 2241
168 Ga0373937_0464060 3300036401 Bacteria 1203
169 Ga0373925_0001751 3300037068 Bacteria 18138
170 Ga0395899_0000003 3300037312 Bacteria 1232684
171 Ga0395899_0008576 3300037312 Bacteria 7870
172 Ga0395900_0042361 3300037418 Bacteria 4691
173 Ga0395900_0046371 3300037418 Bacteria 4475
174 Ga0395900_0074822 3300037418 Bacteria 3481
175 Ga0395900_0191774 3300037418 Bacteria 2072
176 Ga0395900_0482191 3300037418 Bacteria 1192
177 Ga0395898_0019368 3300037466 Bacteria 6927
178 Ga0395898_0021926 3300037466 Bacteria 6470
179 Ga0395898_0150214 3300037466 Bacteria 2229
180 Ga0395905_0597957 3300037471 Bacteria 1005
181 Ga0436364_0005451 3300037853 Bacteria 2374
182 Ga0436364_0752967 3300037853 Bacteria 1438
183 Ga0395901_0002710 3300038443 Bacteria 17843
184 Ga0395901_0007074 3300038443 Bacteria 11341
185 Ga0395901_0015701 3300038443 Bacteria 7714
186 Ga0395901_0030636 3300038443 Bacteria 5543
187 Ga0395901_0051838 3300038443 Bacteria 4265
188 Ga0395901_0287141 3300038443 Bacteria 1708
189 Ga0436365_0457672 3300039437 Bacteria 1423
190 Ga0436360_1076911 3300039438 Bacteria 12198
191 Ga0436361_0045943 3300039447 Bacteria 10776
192 Ga0436361_0345649 3300039447 Bacteria 943
193 Ga0436361_0523753 3300039447 Bacteria 983
194 Ga0436363_0516515 3300039450 Bacteria 1590
195 Ga0451851_1188839 3300041507 Bacteria 748
196 Ga0451577_0024678 3300042876 Bacteria 5466
197 Ga0451577_0112039 3300042876 Bacteria 2441
198 Ga0451577_0174301 3300042876 Bacteria 1938
199 Ga0451577_0300820 3300042876 Bacteria 1454
200 Ga0451577_0393755 3300042876 Bacteria 1257
201 Ga0466966_0071594 3300044684 Bacteria 2172
202 Ga0466963_0051763 3300044694 Bacteria 2723
203 Ga0466964_0143089 3300044706 Bacteria 1101
204 Ga0453684_0096303 3300044712 Bacteria 3636
205 Ga0453684_0147473 3300044712 Bacteria 2800
206 Ga0453684_0414883 3300044712 Bacteria 1505
207 Ga0453684_0514054 3300044712 Bacteria 1324
208 Ga0453684_0877405 3300044712 Bacteria 962
209 Ga0451576_0016981 3300045051 Bacteria 8015
210 Ga0466967_0047418 3300045976 Bacteria 3745
211 Ga0495638_0129230 3300046460 Bacteria 1486
212 Ga0495580_0007367 3300046472 Bacteria 8848
213 Ga0495582_0227459 3300046473 Bacteria 1068
214 Ga0495639_0000388 3300046475 Bacteria 20901
215 Ga0495584_0128382 3300046491 Bacteria 1286
216 Ga0495594_0264172 3300046499 Bacteria 980
217 Ga0495583_0104313 3300046506 Bacteria 1207
218 Ga0495644_0197223 3300046523 Bacteria 776
219 Ga0495666_0000304 3300046526 Bacteria 21414
220 Ga0495665_0042865 3300046531 Bacteria 2407
221 Ga0495633_0080077 3300046558 Bacteria 1521
222 Ga0495611_0032336 3300046648 Bacteria 2305
223 Ga0495625_0085616 3300046660 Bacteria 2187
224 Ga0495588_0034168 3300046674 Bacteria 2572
225 Ga0495669_0008979 3300046684 Bacteria 4212
226 Ga0495624_0255065 3300046690 Bacteria 1060
227 Ga0495604_0034176 3300047317 Bacteria 4023
228 Ga0495636_0055860 3300047318 Bacteria 1661
229 Ga0495680_0281344 3300047322 Bacteria 1172
230 Ga0495677_0015539 3300047445 Bacteria 2766
231 Ga0495615_0031598 3300048090 Bacteria 1271
232 Ga0496100_0008509 3300048903 Bacteria 5724
233 Ga0496100_0047840 3300048903 Bacteria 2758
234 Ga0496101_0027250 3300048904 Bacteria 3979
235 Ga0496101_0066731 3300048904 Bacteria 2625
236 Ga0496101_0340436 3300048904 Bacteria 1178
237 Ga0496102_0013616 3300048905 Bacteria 7050
238 Ga0496102_0023737 3300048905 Bacteria 5450
239 Ga0496102_0039600 3300048905 Bacteria 4259
240 Ga0496102_0664767 3300048905 Bacteria 965
241 Ga0496103_0061413 3300048906 Bacteria 2337
242 Ga0496103_0377313 3300048906 Bacteria 911
243 Ga0496104_0058221 3300048907 Bacteria 3657
244 Ga0496105_0002194 3300048908 Bacteria 14140
245 Ga0496106_0313150 3300048909 Bacteria 1259
246 Ga0496106_0342689 3300048909 Bacteria 1200
247 Ga0496107_0093239 3300048910 Bacteria 2202
248 Ga0496108_0109650 3300048911 Bacteria 2359
249 Ga0496108_0131309 3300048911 Bacteria 2153
250 Ga0496110_0087567 3300048913 Bacteria 2781
251 Ga0496111_0046299 3300048914 Bacteria 3132
252 Ga0496112_0034038 3300048915 Bacteria 4957
253 Ga0496112_0233382 3300048915 Bacteria 1794
254 Ga0496112_0407274 3300048915 Bacteria 1299
255 Ga0496114_0162572 3300048917 Bacteria 1942
256 Ga0501032_0000104 3300049569 Bacteria 71651
257 Ga0501033_0000566 3300049570 Bacteria 34460
258 Ga0501033_0107058 3300049570 Bacteria 2037
259 Ga0501034_0000529 3300049571 Bacteria 61012
260 Ga0501034_0007498 3300049571 Bacteria 11602
261 Ga0501034_0026574 3300049571 Bacteria 5894
262 Ga0501036_0000087 3300049572 Bacteria 58173
263 Ga0501036_0004013 3300049572 Bacteria 11841
264 Ga0501037_0000029 3300049573 Bacteria 139680
265 Ga0501037_0151877 3300049573 Bacteria 1655
266 Ga0501038_0000120 3300049574 Bacteria 66925
267 Ga0501039_0000043 3300049575 Bacteria 109462
268 Ga0501039_0002697 3300049575 Bacteria 13250
269 Ga0501039_0153282 3300049575 Bacteria 1810
270 Ga0501040_0008124 3300049576 Bacteria 6818
271 Ga0501042_0016931 3300049578 Bacteria 5016
272 Ga0501043_0000160 3300049579 Bacteria 61140
273 Ga0501046_0007817 3300049580 Bacteria 9382
274 Ga0501046_0063928 3300049580 Bacteria 2873
275 Ga0501048_0002702 3300049582 Bacteria 13537
276 Ga0501068_0085315 3300049584 Bacteria 1943
277 Ga0501069_0089327 3300049585 Bacteria 1742
278 Ga0501070_0037789 3300049586 Bacteria 4030
279 Ga0501071_0001677 3300049587 Bacteria 12995
280 Ga0501072_0001126 3300049588 Bacteria 19860
281 Ga0501072_0530023 3300049588 Bacteria 931
282 Ga0501073_0229595 3300049589 Bacteria 1282
283 Ga0501074_0125426 3300049590 Bacteria 1836
284 Ga0501075_0001155 3300049591 Bacteria 17068
285 Ga0501075_0019180 3300049591 Bacteria 4960
286 Ga0501076_0000538 3300049592 Bacteria 24148
287 Ga0501076_0177498 3300049592 Bacteria 1736
288 Ga0501077_0003995 3300049593 Bacteria 8903
289 Ga0501077_0113662 3300049593 Bacteria 1717
290 Ga0501079_0001207 3300049741 Bacteria 18093
291 Ga0501080_0230920 3300049742 Bacteria 1691
292 Ga0501080_0253988 3300049742 Bacteria 1603
293 Ga0501081_0006860 3300049743 Bacteria 7405
294 Ga0501035_0000057 3300049822 Bacteria 135297
295 Ga0501035_0275315 3300049822 Bacteria 1424
296 Ga0501044_0102361 3300049823 Bacteria 2880
297 Ga0501045_0001420 3300049824 Bacteria 15968
298 Ga0501045_0247981 3300049824 Bacteria 1326
299 nmdc:mga03683_2990_c1 3300050489 Bacteria 4138
300 nmdc:mga0yw44_124120_c1 3300050492 Bacteria 1666
301 nmdc:mga0yw44_217670_c1 3300050492 Bacteria 1265
302 nmdc:mga0yw44_26910_c1 3300050492 Bacteria 3290
303 nmdc:mga06z11_151661_c1 3300050494 Bacteria 1318
304 nmdc:mga06z11_18202_c1 3300050494 Bacteria 3204
305 nmdc:mga06z11_7906_c1 3300050494 Bacteria 4403
306 nmdc:mga07m45_4997_c1 3300050496 Bacteria 6549
307 nmdc:mga0n895_36953_c1 3300050512 Bacteria 4720
308 nmdc:mga0sz30_3789_c1 3300050516 Bacteria 5445
309 Ga0500646_0004013 3300053090 Bacteria 3744
310 Ga0500641_0002690 3300053096 Bacteria 6280
311 Ga0500594_0020850 3300053118 Bacteria 1639
312 Ga0500658_0024690 3300053134 Bacteria 2304
313 Ga0500568_0027871 3300053139 Bacteria 2359
314 Ga0500616_0010218 3300053153 Bacteria 5630
315 Ga0500620_004765 3300053155 Bacteria 3068
316 Ga0501084_0004611 3300054114 Bacteria 11257
317 Ga0590071_004210 3300059421 Bacteria 3505
318 Ga0501082_0004303 3300060353 Bacteria 12449
319 Ga0501082_0062193 3300060353 Bacteria 3213
320 Ga0501082_0184598 3300060353 Bacteria 1815
321 Ga0530510_0001878 3300061734 Bacteria 14333

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012512 Ga0157327_1001603 Ga0157327_10016033 224
2 3300044712 Ga0453684_0414883 Ga0453684_0414883_271_951 226
3 3300046523 Ga0495644_0197223 Ga0495644_0197223_79_759 226
4 iso_pu_bacteria 2958041894 2958045419 234
5 3300039450 Ga0436363_0516515 Ga0436363_0516515_230_1003 237
6 3300041507 Ga0451851_1188839 Ga0451851_1188839_14_736 240
7 3300048904 Ga0496101_0066731 Ga0496101_0066731_1702_2478 249
8 iso_pu_bacteria 2512047086 2512535109 253
9 iso_pu_bacteria 2856364286 2856371186 253
10 iso_pu_bacteria 2891633521 2891636791 253
11 iso_pu_bacteria 2913308742 2913311672 255
12 3300021388 Ga0213875_10096966 Ga0213875_100969661 257
13 3300026023 Ga0207677_10744412 Ga0207677_107444121 257
14 3300037853 Ga0436364_0005451 Ga0436364_0005451_566_1339 257
15 3300044694 Ga0466963_0051763 Ga0466963_0051763_1742_2515 257
16 3300046460 Ga0495638_0129230 Ga0495638_0129230_609_1382 257
17 3300048090 Ga0495615_0031598 Ga0495615_0031598_50_823 257
18 3300048903 Ga0496100_0008509 Ga0496100_0008509_3569_4342 257
19 3300049569 Ga0501032_0000104 Ga0501032_0000104_8694_9470 257
20 3300049570 Ga0501033_0000566 Ga0501033_0000566_8696_9472 257
21 3300049571 Ga0501034_0000529 Ga0501034_0000529_8694_9470 257
22 3300049572 Ga0501036_0000087 Ga0501036_0000087_8694_9470 257
23 3300049572 Ga0501036_0004013 Ga0501036_0004013_10016_10789 257
24 3300049573 Ga0501037_0000029 Ga0501037_0000029_8686_9462 257
25 3300049574 Ga0501038_0000120 Ga0501038_0000120_3840_4616 257
26 3300049575 Ga0501039_0000043 Ga0501039_0000043_8674_9450 257
27 3300049575 Ga0501039_0002697 Ga0501039_0002697_11172_11945 257
28 3300049576 Ga0501040_0008124 Ga0501040_0008124_705_1478 257
29 3300049578 Ga0501042_0016931 Ga0501042_0016931_3843_4616 257
30 3300049579 Ga0501043_0000160 Ga0501043_0000160_8694_9470 257
31 3300049580 Ga0501046_0007817 Ga0501046_0007817_6156_6932 257
32 3300049582 Ga0501048_0002702 Ga0501048_0002702_7807_8580 257
33 3300049585 Ga0501069_0089327 Ga0501069_0089327_715_1488 257
34 3300049587 Ga0501071_0001677 Ga0501071_0001677_11348_12121 257
35 3300049588 Ga0501072_0001126 Ga0501072_0001126_14009_14782 257
36 3300049590 Ga0501074_0125426 Ga0501074_0125426_665_1438 257
37 3300049591 Ga0501075_0001155 Ga0501075_0001155_3917_4690 257
38 3300049591 Ga0501075_0019180 Ga0501075_0019180_1660_2433 257
39 3300049592 Ga0501076_0000538 Ga0501076_0000538_897_1670 257
40 3300049592 Ga0501076_0177498 Ga0501076_0177498_224_997 257
41 3300049593 Ga0501077_0003995 Ga0501077_0003995_1177_1950 257
42 3300049593 Ga0501077_0113662 Ga0501077_0113662_395_1168 257
43 3300049741 Ga0501079_0001207 Ga0501079_0001207_4912_5685 257
44 3300049742 Ga0501080_0230920 Ga0501080_0230920_712_1485 257
45 3300049743 Ga0501081_0006860 Ga0501081_0006860_4009_4782 257
46 3300049822 Ga0501035_0000057 Ga0501035_0000057_8666_9442 257
47 3300049824 Ga0501045_0001420 Ga0501045_0001420_7709_8482 257
48 3300054114 Ga0501084_0004611 Ga0501084_0004611_9454_10227 257
49 3300060353 Ga0501082_0004303 Ga0501082_0004303_5447_6220 257
50 3300060353 Ga0501082_0184598 Ga0501082_0184598_445_1218 257
51 3300061734 Ga0530510_0001878 Ga0530510_0001878_5844_6617 257
52 3300005333 Ga0070677_10012128 Ga0070677_100121283 258
53 3300005340 Ga0070689_100010914 Ga0070689_1000109148 258
54 3300005347 Ga0070668_100008941 Ga0070668_1000089413 258
55 3300005347 Ga0070668_100018393 Ga0070668_1000183932 258
56 3300005354 Ga0070675_100026872 Ga0070675_1000268724 258
57 3300005355 Ga0070671_100182991 Ga0070671_1001829911 258
58 3300005364 Ga0070673_100040687 Ga0070673_1000406873 258
59 3300005364 Ga0070673_100609367 Ga0070673_1006093672 258
60 3300005366 Ga0070659_100375422 Ga0070659_1003754221 258
61 3300005367 Ga0070667_100031628 Ga0070667_1000316283 258
62 3300005367 Ga0070667_100031771 Ga0070667_1000317712 258
63 3300005436 Ga0070713_100019399 Ga0070713_1000193993 258
64 3300005456 Ga0070678_100036527 Ga0070678_1000365272 258
65 3300005456 Ga0070678_100048982 Ga0070678_1000489823 258
66 3300005457 Ga0070662_100017431 Ga0070662_1000174314 258
67 3300005468 Ga0070707_100178113 Ga0070707_1001781132 258
68 3300005471 Ga0070698_100003213 Ga0070698_10000321317 258
69 3300005530 Ga0070679_100003097 Ga0070679_10000309710 258
70 3300005530 Ga0070679_100232256 Ga0070679_1002322563 258
71 3300005535 Ga0070684_100678407 Ga0070684_1006784072 258
72 3300005536 Ga0070697_100208325 Ga0070697_1002083252 258
73 3300005539 Ga0068853_100032138 Ga0068853_1000321382 258
74 3300005543 Ga0070672_100132284 Ga0070672_1001322842 258
75 3300005548 Ga0070665_100099879 Ga0070665_1000998792 258
76 3300005548 Ga0070665_100270590 Ga0070665_1002705901 258
77 3300005549 Ga0070704_100006200 Ga0070704_1000062004 258
78 3300005563 Ga0068855_100020041 Ga0068855_1000200416 258
79 3300005563 Ga0068855_100089062 Ga0068855_1000890623 258
80 3300005563 Ga0068855_100743337 Ga0068855_1007433372 258
81 3300005577 Ga0068857_100059650 Ga0068857_1000596502 258
82 3300005577 Ga0068857_100438178 Ga0068857_1004381782 258
83 3300005614 Ga0068856_100034640 Ga0068856_1000346403 258
84 3300005616 Ga0068852_100042700 Ga0068852_1000427004 258
85 3300005617 Ga0068859_100192803 Ga0068859_1001928033 258
86 3300005617 Ga0068859_100283860 Ga0068859_1002838602 258
87 3300005617 Ga0068859_100420540 Ga0068859_1004205402 258
88 3300005618 Ga0068864_100064382 Ga0068864_1000643823 258
89 3300005841 Ga0068863_100266693 Ga0068863_1002666932 258
90 3300005841 Ga0068863_100294120 Ga0068863_1002941202 258
91 3300005841 Ga0068863_100514439 Ga0068863_1005144392 258
92 3300005841 Ga0068863_100524522 Ga0068863_1005245222 258
93 3300005842 Ga0068858_100235306 Ga0068858_1002353062 258
94 3300005843 Ga0068860_100001005 Ga0068860_10000100511 258
95 3300005843 Ga0068860_100006131 Ga0068860_10000613112 258
96 3300005843 Ga0068860_100042848 Ga0068860_1000428482 258
97 3300005843 Ga0068860_100127259 Ga0068860_1001272592 258
98 3300005844 Ga0068862_100003900 Ga0068862_1000039009 258
99 3300005844 Ga0068862_100042981 Ga0068862_1000429813 258
100 3300005844 Ga0068862_100131676 Ga0068862_1001316762 258
101 3300005937 Ga0081455_10001851 Ga0081455_100018517 258
102 3300005937 Ga0081455_10007317 Ga0081455_1000731711 258
103 3300005937 Ga0081455_10067638 Ga0081455_100676384 258
104 3300005981 Ga0081538_10059489 Ga0081538_100594892 258
105 3300005983 Ga0081540_1074349 Ga0081540_10743491 258
106 3300005985 Ga0081539_10007008 Ga0081539_100070088 258
107 3300006038 Ga0075365_10035918 Ga0075365_100359184 258
108 3300006038 Ga0075365_10164689 Ga0075365_101646892 258
109 3300006038 Ga0075365_10182487 Ga0075365_101824872 258
110 3300006038 Ga0075365_10193073 Ga0075365_101930732 258
111 3300006048 Ga0075363_100147269 Ga0075363_1001472691 258
112 3300006177 Ga0075362_10012467 Ga0075362_100124674 258
113 3300006178 Ga0075367_10018803 Ga0075367_100188034 258
114 3300006178 Ga0075367_10233103 Ga0075367_102331032 258
115 3300006195 Ga0075366_10007227 Ga0075366_100072275 258
116 3300006353 Ga0075370_10010161 Ga0075370_100101612 258
117 3300006353 Ga0075370_10054366 Ga0075370_100543661 258
118 3300006844 Ga0075428_100624721 Ga0075428_1006247212 258
119 3300006852 Ga0075433_10167217 Ga0075433_101672172 258
120 3300006871 Ga0075434_100039508 Ga0075434_1000395083 258
121 3300006931 Ga0097620_100192806 Ga0097620_1001928062 258
122 3300006931 Ga0097620_100283860 Ga0097620_1002838602 258
123 3300006931 Ga0097620_100420543 Ga0097620_1004205432 258
124 3300007265 Ga0099794_10043244 Ga0099794_100432442 258
125 3300009148 Ga0105243_10140556 Ga0105243_101405563 258
126 3300009174 Ga0105241_10196577 Ga0105241_101965772 258
127 3300009176 Ga0105242_10219708 Ga0105242_102197083 258
128 3300009545 Ga0105237_10109429 Ga0105237_101094293 258
129 3300009551 Ga0105238_10036475 Ga0105238_100364753 258
130 3300009551 Ga0105238_10533653 Ga0105238_105336532 258
131 3300010159 Ga0099796_10144413 Ga0099796_101444131 258
132 3300010375 Ga0105239_10025157 Ga0105239_100251577 258
133 3300013100 Ga0157373_10163456 Ga0157373_101634562 258
134 3300013102 Ga0157371_10029522 Ga0157371_100295224 258
135 3300013104 Ga0157370_10082675 Ga0157370_100826754 258
136 3300013297 Ga0157378_10464140 Ga0157378_104641402 258
137 3300013306 Ga0163162_10023860 Ga0163162_100238605 258
138 3300013306 Ga0163162_10137657 Ga0163162_101376573 258
139 3300013307 Ga0157372_10108950 Ga0157372_101089503 258
140 3300014969 Ga0157376_10235105 Ga0157376_102351052 258
141 3300015262 Ga0182007_10070870 Ga0182007_100708701 258
142 3300017792 Ga0163161_10012339 Ga0163161_100123395 258
143 3300021441 Ga0213871_10001196 Ga0213871_100011963 258
144 3300025302 Ga0207426_1012906 Ga0207426_10129064 258
145 3300025909 Ga0207705_10032117 Ga0207705_100321174 258
146 3300025910 Ga0207684_10233656 Ga0207684_102336562 258
147 3300025912 Ga0207707_10003527 Ga0207707_1000352715 258
148 3300025921 Ga0207652_10009517 Ga0207652_100095174 258
149 3300025921 Ga0207652_10442175 Ga0207652_104421752 258
150 3300025924 Ga0207694_10279889 Ga0207694_102798892 258
151 3300025925 Ga0207650_10193733 Ga0207650_101937332 258
152 3300025928 Ga0207700_10012529 Ga0207700_100125293 258
153 3300025928 Ga0207700_10100402 Ga0207700_101004021 258
154 3300025928 Ga0207700_10333114 Ga0207700_103331142 258
155 3300025931 Ga0207644_10066648 Ga0207644_100666481 258
156 3300025931 Ga0207644_10144780 Ga0207644_101447801 258
157 3300025933 Ga0207706_10041584 Ga0207706_100415844 258
158 3300025936 Ga0207670_10310086 Ga0207670_103100862 258
159 3300025940 Ga0207691_10180333 Ga0207691_101803332 258
160 3300025944 Ga0207661_10007715 Ga0207661_100077158 258
161 3300025945 Ga0207679_10006048 Ga0207679_100060485 258
162 3300025949 Ga0207667_10002821 Ga0207667_1000282118 258
163 3300025949 Ga0207667_10231862 Ga0207667_102318622 258
164 3300025960 Ga0207651_10089824 Ga0207651_100898243 258
165 3300025960 Ga0207651_10245906 Ga0207651_102459062 258
166 3300025972 Ga0207668_10048547 Ga0207668_100485471 258
167 3300025972 Ga0207668_10054485 Ga0207668_100544852 258
168 3300025972 Ga0207668_10056560 Ga0207668_100565603 258
169 3300025981 Ga0207640_10090052 Ga0207640_100900523 258
170 3300025986 Ga0207658_10119301 Ga0207658_101193012 258
171 3300026023 Ga0207677_10289767 Ga0207677_102897671 258
172 3300026035 Ga0207703_10194732 Ga0207703_101947321 258
173 3300026041 Ga0207639_10016345 Ga0207639_100163454 258
174 3300026078 Ga0207702_10023845 Ga0207702_100238454 258
175 3300026078 Ga0207702_10155395 Ga0207702_101553952 258
176 3300026088 Ga0207641_10017251 Ga0207641_100172514 258
177 3300026088 Ga0207641_10467627 Ga0207641_104676272 258
178 3300026088 Ga0207641_10711775 Ga0207641_107117751 258
179 3300026095 Ga0207676_10166059 Ga0207676_101660592 258
180 3300026095 Ga0207676_10338913 Ga0207676_103389132 258
181 3300026116 Ga0207674_10117862 Ga0207674_101178623 258
182 3300026116 Ga0207674_10141304 Ga0207674_101413042 258
183 3300026118 Ga0207675_100110833 Ga0207675_1001108331 258
184 3300026121 Ga0207683_10024960 Ga0207683_100249605 258
185 3300026121 Ga0207683_10056923 Ga0207683_100569232 258
186 3300028379 Ga0268266_10004061 Ga0268266_100040618 258
187 3300028379 Ga0268266_10039802 Ga0268266_100398023 258
188 3300028380 Ga0268265_10033771 Ga0268265_100337714 258
189 3300028380 Ga0268265_10058200 Ga0268265_100582003 258
190 3300028380 Ga0268265_10153928 Ga0268265_101539282 258
191 3300028381 Ga0268264_10000014 Ga0268264_10000014321 258
192 3300028381 Ga0268264_10085619 Ga0268264_100856192 258
193 3300028381 Ga0268264_10167448 Ga0268264_101674482 258
194 3300028573 Ga0265334_10006563 Ga0265334_100065634 258
195 3300028786 Ga0307517_10005652 Ga0307517_100056525 258
196 3300028786 Ga0307517_10067953 Ga0307517_100679532 258
197 3300028786 Ga0307517_10078776 Ga0307517_100787763 258
198 3300031247 Ga0265340_10036337 Ga0265340_100363372 258
199 3300031456 Ga0307513_10000899 Ga0307513_1000089944 258
200 3300031456 Ga0307513_10000983 Ga0307513_1000098345 258
201 3300031730 Ga0307516_10000338 Ga0307516_1000033818 258
202 3300031730 Ga0307516_10000438 Ga0307516_1000043832 258
203 3300033180 Ga0307510_10000393 Ga0307510_1000039331 258
204 3300035086 Ga0373934_0003938 Ga0373934_0003938_778_1554 258
205 3300035112 Ga0373932_0053517 Ga0373932_0053517_75_851 258
206 3300035115 Ga0373941_0054179 Ga0373941_0054179_162_941 258
207 3300035117 Ga0373953_0049319 Ga0373953_0049319_827_1603 258
208 3300035119 Ga0373956_0010994 Ga0373956_0010994_2809_3585 258
209 3300035120 Ga0373957_0005152 Ga0373957_0005152_1214_1990 258
210 3300035172 Ga0373955_0054992 Ga0373955_0054992_571_1347 258
211 3300035695 Ga0373927_0090857 Ga0373927_0090857_609_1388 258
212 3300035695 Ga0373927_0186932 Ga0373927_0186932_417_1196 258
213 3300035724 Ga0373933_0001967 Ga0373933_0001967_10134_10910 258
214 3300036401 Ga0373937_0001916 Ga0373937_0001916_11590_12366 258
215 3300036401 Ga0373937_0142663 Ga0373937_0142663_707_1483 258
216 3300036401 Ga0373937_0464060 Ga0373937_0464060_355_1131 258
217 3300037068 Ga0373925_0001751 Ga0373925_0001751_8333_9109 258
218 3300037312 Ga0395899_0000003 Ga0395899_0000003_592315_593091 258
219 3300037312 Ga0395899_0008576 Ga0395899_0008576_6273_7052 258
220 3300037418 Ga0395900_0042361 Ga0395900_0042361_755_1534 258
221 3300037418 Ga0395900_0046371 Ga0395900_0046371_1135_1917 258
222 3300037418 Ga0395900_0074822 Ga0395900_0074822_1255_2034 258
223 3300037418 Ga0395900_0191774 Ga0395900_0191774_753_1535 258
224 3300037418 Ga0395900_0482191 Ga0395900_0482191_252_1031 258
225 3300037466 Ga0395898_0019368 Ga0395898_0019368_3924_4703 258
226 3300037466 Ga0395898_0021926 Ga0395898_0021926_1089_1871 258
227 3300037466 Ga0395898_0150214 Ga0395898_0150214_31_810 258
228 3300037471 Ga0395905_0597957 Ga0395905_0597957_70_852 258
229 3300037853 Ga0436364_0752967 Ga0436364_0752967_167_943 258
230 3300038443 Ga0395901_0002710 Ga0395901_0002710_16840_17616 258
231 3300038443 Ga0395901_0007074 Ga0395901_0007074_7313_8092 258
232 3300038443 Ga0395901_0015701 Ga0395901_0015701_4890_5669 258
233 3300038443 Ga0395901_0030636 Ga0395901_0030636_1225_2004 258
234 3300038443 Ga0395901_0051838 Ga0395901_0051838_3173_3955 258
235 3300038443 Ga0395901_0287141 Ga0395901_0287141_123_899 258
236 3300039437 Ga0436365_0457672 Ga0436365_0457672_397_1176 258
237 3300039438 Ga0436360_1076911 Ga0436360_1076911_8636_9415 258
238 3300039447 Ga0436361_0045943 Ga0436361_0045943_2526_3302 258
239 3300039447 Ga0436361_0345649 Ga0436361_0345649_32_808 258
240 3300039447 Ga0436361_0523753 Ga0436361_0523753_98_874 258
241 3300042876 Ga0451577_0024678 Ga0451577_0024678_676_1452 258
242 3300042876 Ga0451577_0112039 Ga0451577_0112039_681_1457 258
243 3300042876 Ga0451577_0174301 Ga0451577_0174301_800_1630 258
244 3300042876 Ga0451577_0300820 Ga0451577_0300820_301_1077 258
245 3300042876 Ga0451577_0393755 Ga0451577_0393755_299_1075 258
246 3300044684 Ga0466966_0071594 Ga0466966_0071594_640_1416 258
247 3300044706 Ga0466964_0143089 Ga0466964_0143089_139_918 258
248 3300044712 Ga0453684_0096303 Ga0453684_0096303_2186_2962 258
249 3300044712 Ga0453684_0147473 Ga0453684_0147473_942_1718 258
250 3300044712 Ga0453684_0514054 Ga0453684_0514054_525_1301 258
251 3300044712 Ga0453684_0877405 Ga0453684_0877405_73_849 258
252 3300045051 Ga0451576_0016981 Ga0451576_0016981_891_1721 258
253 3300045976 Ga0466967_0047418 Ga0466967_0047418_2846_3625 258
254 3300046472 Ga0495580_0007367 Ga0495580_0007367_6587_7363 258
255 3300046473 Ga0495582_0227459 Ga0495582_0227459_187_966 258
256 3300046475 Ga0495639_0000388 Ga0495639_0000388_18745_19521 258
257 3300046491 Ga0495584_0128382 Ga0495584_0128382_100_876 258
258 3300046499 Ga0495594_0264172 Ga0495594_0264172_145_921 258
259 3300046506 Ga0495583_0104313 Ga0495583_0104313_144_920 258
260 3300046526 Ga0495666_0000304 Ga0495666_0000304_1578_2354 258
261 3300046531 Ga0495665_0042865 Ga0495665_0042865_1477_2253 258
262 3300046558 Ga0495633_0080077 Ga0495633_0080077_325_1101 258
263 3300046648 Ga0495611_0032336 Ga0495611_0032336_497_1273 258
264 3300046660 Ga0495625_0085616 Ga0495625_0085616_453_1229 258
265 3300046674 Ga0495588_0034168 Ga0495588_0034168_927_1703 258
266 3300046684 Ga0495669_0008979 Ga0495669_0008979_879_1655 258
267 3300046690 Ga0495624_0255065 Ga0495624_0255065_255_1031 258
268 3300047317 Ga0495604_0034176 Ga0495604_0034176_1888_2664 258
269 3300047318 Ga0495636_0055860 Ga0495636_0055860_369_1145 258
270 3300047322 Ga0495680_0281344 Ga0495680_0281344_155_931 258
271 3300047445 Ga0495677_0015539 Ga0495677_0015539_1215_1991 258
272 3300048903 Ga0496100_0047840 Ga0496100_0047840_1147_1923 258
273 3300048904 Ga0496101_0027250 Ga0496101_0027250_2956_3732 258
274 3300048904 Ga0496101_0340436 Ga0496101_0340436_347_1123 258
275 3300048905 Ga0496102_0013616 Ga0496102_0013616_3863_4639 258
276 3300048905 Ga0496102_0023737 Ga0496102_0023737_3565_4341 258
277 3300048905 Ga0496102_0039600 Ga0496102_0039600_682_1458 258
278 3300048905 Ga0496102_0664767 Ga0496102_0664767_165_941 258
279 3300048906 Ga0496103_0061413 Ga0496103_0061413_836_1612 258
280 3300048906 Ga0496103_0377313 Ga0496103_0377313_91_867 258
281 3300048907 Ga0496104_0058221 Ga0496104_0058221_1154_1930 258
282 3300048908 Ga0496105_0002194 Ga0496105_0002194_3536_4312 258
283 3300048909 Ga0496106_0313150 Ga0496106_0313150_288_1064 258
284 3300048909 Ga0496106_0342689 Ga0496106_0342689_83_859 258
285 3300048910 Ga0496107_0093239 Ga0496107_0093239_595_1371 258
286 3300048911 Ga0496108_0109650 Ga0496108_0109650_936_1712 258
287 3300048911 Ga0496108_0131309 Ga0496108_0131309_627_1403 258
288 3300048913 Ga0496110_0087567 Ga0496110_0087567_1075_1851 258
289 3300048914 Ga0496111_0046299 Ga0496111_0046299_850_1626 258
290 3300048915 Ga0496112_0034038 Ga0496112_0034038_3445_4221 258
291 3300048915 Ga0496112_0233382 Ga0496112_0233382_448_1230 258
292 3300048915 Ga0496112_0407274 Ga0496112_0407274_225_1001 258
293 3300048917 Ga0496114_0162572 Ga0496114_0162572_773_1549 258
294 3300049570 Ga0501033_0107058 Ga0501033_0107058_384_1163 258
295 3300049571 Ga0501034_0007498 Ga0501034_0007498_1986_2762 258
296 3300049571 Ga0501034_0026574 Ga0501034_0026574_1999_2775 258
297 3300049573 Ga0501037_0151877 Ga0501037_0151877_295_1077 258
298 3300049575 Ga0501039_0153282 Ga0501039_0153282_221_997 258
299 3300049580 Ga0501046_0063928 Ga0501046_0063928_497_1279 258
300 3300049584 Ga0501068_0085315 Ga0501068_0085315_702_1478 258
301 3300049586 Ga0501070_0037789 Ga0501070_0037789_1188_1964 258
302 3300049588 Ga0501072_0530023 Ga0501072_0530023_112_888 258
303 3300049589 Ga0501073_0229595 Ga0501073_0229595_13_792 258
304 3300049742 Ga0501080_0253988 Ga0501080_0253988_486_1265 258
305 3300049822 Ga0501035_0275315 Ga0501035_0275315_192_974 258
306 3300049823 Ga0501044_0102361 Ga0501044_0102361_652_1434 258
307 3300049824 Ga0501045_0247981 Ga0501045_0247981_351_1127 258
308 3300050489 nmdc:mga03683_2990_c1 nmdc:mga03683_2990_c1_956_1735 258
309 3300050492 nmdc:mga0yw44_124120_c1 nmdc:mga0yw44_124120_c1_77_856 258
310 3300050492 nmdc:mga0yw44_217670_c1 nmdc:mga0yw44_217670_c1_51_842 258
311 3300050492 nmdc:mga0yw44_26910_c1 nmdc:mga0yw44_26910_c1_239_1018 258
312 3300050494 nmdc:mga06z11_151661_c1 nmdc:mga06z11_151661_c1_397_1188 258
313 3300050494 nmdc:mga06z11_18202_c1 nmdc:mga06z11_18202_c1_2137_2916 258
314 3300050494 nmdc:mga06z11_7906_c1 nmdc:mga06z11_7906_c1_2035_2814 258
315 3300050496 nmdc:mga07m45_4997_c1 nmdc:mga07m45_4997_c1_2269_3048 258
316 3300050512 nmdc:mga0n895_36953_c1 nmdc:mga0n895_36953_c1_2909_3685 258
317 3300050516 nmdc:mga0sz30_3789_c1 nmdc:mga0sz30_3789_c1_4231_5010 258
318 3300053090 Ga0500646_0004013 Ga0500646_0004013_2444_3220 258
319 3300053096 Ga0500641_0002690 Ga0500641_0002690_4440_5219 258
320 3300053118 Ga0500594_0020850 Ga0500594_0020850_788_1564 258
321 3300053134 Ga0500658_0024690 Ga0500658_0024690_14_805 258
322 3300053139 Ga0500568_0027871 Ga0500568_0027871_1168_1944 258
323 3300053153 Ga0500616_0010218 Ga0500616_0010218_3626_4405 258
324 3300053155 Ga0500620_004765 Ga0500620_004765_1942_2721 258
325 3300059421 Ga0590071_004210 Ga0590071_004210_1209_1985 258
326 3300060353 Ga0501082_0062193 Ga0501082_0062193_235_1011 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

5

234

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

10

189

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9812 5 258
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9773 5 233
3q0g-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa 0.9758 5 257
5xzd-assembly1.cif.gz_D structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9748 4 233
3q0g-assembly2.cif.gz_D crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa 0.9746 5 255
ID Description Score Start End Superfamily
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9821 203 256 1.10.12.10
3q0jB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9782 201 255 1.10.12.10
3q0jE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9779 201 255 1.10.12.10
3h81B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9773 201 257 1.10.12.10
4fjwE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9764 201 255 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A839HM19-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9845 4 258 GO:0006635
GO:0016836
AF-A0A840VBQ3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9842 4 258 GO:0006635
GO:0016836
AF-A0A522QB63-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9823 5 258 GO:0004300
GO:0006635
AF-A0A1B8UKW5-F1-model_v4 Enoyl-CoA hydratase 0.9822 1 258 GO:0006635
GO:0016836
AF-B8C2B7-F1-model_v4 Enoyl-CoA hydratase 0.9819 10 258 GO:0004300
GO:0005739
GO:0006635

Feature Viewer

pLDDT pTM Quality
90.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map