F408508

General Info

Members Datasets Scaffolds Average Seq Length
326 196 306 417

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0029865|Ga0496115_0029865_927_2252
Length 441
Sequence MNQAPAGLVQAGAEQAGVGGRAPPFGLWERMLAGRYLRAKRSQGGVALISIISFFGIMVAVAVLIVVMSVMNGFREELLGKILGFNGHIFVSGGVLDGAARDPAVQRILKAPGVTQATPVIEAQVIAMGPNQTTGAIVRGLSPKDLKATSIVANNLTKGDLRGYGQGEYGGDVIVMGDRLAEQLGVRAGDSIALVSPSGGATAFGSAPVQKSYIVGATFTAGMSQYDQAYIFMPFEQAQLFFGREGTADVIEVRVTNPDKAATLKAAVARAAGPTAMVADWTQRDASYWGALKVERNVMRLILMLIVAIAALNIISGLTMLVKNKGRDIAILRTIGGGQGAILRIFFMAGATIGVLGTAAGLALGALVSVYIDPIQAFVEWATGQAVFSSDVYFLNRLPAKVDWMEVAIIVAFSMVMSMICTLPPAWRASRLDPVEALRYE

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
190 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
191 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 0
Isolates 6.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.54
Nodule 0
Rhizoplane 2.45
Rhizosphere 63.19
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1003960 3300003773 Bacteria 4387
2 Ga0055524_1005354 3300003775 Bacteria 5748
3 Ga0055536_1002051 3300003781 Bacteria 11513
4 Ga0055536_1002072 3300003781 Bacteria 11453
5 Ga0055528_1007921 3300003790 Bacteria 4632
6 Ga0055530_10000647 3300003791 Bacteria 29932
7 Ga0055530_10001148 3300003791 Bacteria 20593
8 Ga0055530_10002587 3300003791 Bacteria 11453
9 Ga0055531_10001482 3300003794 Bacteria 17267
10 Ga0055531_10002532 3300003794 Bacteria 12150
11 Ga0055543_1007538 3300004625 Bacteria 2501
12 Ga0065165_1000552 3300005262 Bacteria 56291
13 Ga0065165_1000845 3300005262 Bacteria 40173
14 Ga0065165_1010534 3300005262 Bacteria 3977
15 Ga0070658_10046806 3300005327 Bacteria 3500
16 Ga0070670_100000037 3300005331 Bacteria 156070
17 Ga0070670_100052858 3300005331 Bacteria 3489
18 Ga0070666_10004507 3300005335 Bacteria 8488
19 Ga0070666_10046554 3300005335 Bacteria 2910
20 Ga0070680_100018622 3300005336 Bacteria 5490
21 Ga0070660_100009396 3300005339 Bacteria 6874
22 Ga0070660_100024858 3300005339 Bacteria 4448
23 Ga0070691_10003066 3300005341 Bacteria 7485
24 Ga0070668_100001202 3300005347 Bacteria 18371
25 Ga0070668_100009664 3300005347 Bacteria 7153
26 Ga0070668_100014227 3300005347 Bacteria 5945
27 Ga0070668_100062447 3300005347 Bacteria 2886
28 Ga0070668_100082846 3300005347 Bacteria 2517
29 Ga0070669_100008486 3300005353 Bacteria 7334
30 Ga0070671_100047065 3300005355 Bacteria 3587
31 Ga0070671_100131714 3300005355 Bacteria 2106
32 Ga0070659_100000882 3300005366 Bacteria 21920
33 Ga0070659_100002791 3300005366 Bacteria 12431
34 Ga0070667_100000083 3300005367 Bacteria 118261
35 Ga0070667_100002986 3300005367 Bacteria 14534
36 Ga0070667_100025765 3300005367 Bacteria 4891
37 Ga0070667_100079011 3300005367 Bacteria 2811
38 Ga0070662_100118917 3300005457 Bacteria 2023
39 Ga0070681_10034711 3300005458 Bacteria 5065
40 Ga0070681_10035504 3300005458 Bacteria 5009
41 Ga0070681_10072427 3300005458 Bacteria 3408
42 Ga0070679_100005360 3300005530 Bacteria 11867
43 Ga0070679_100014519 3300005530 Bacteria 7567
44 Ga0068853_100073801 3300005539 Bacteria 2975
45 Ga0068853_100155274 3300005539 Bacteria 2062
46 Ga0070665_100000116 3300005548 Bacteria 150141
47 Ga0070665_100000883 3300005548 Bacteria 38439
48 Ga0070665_100001867 3300005548 Bacteria 23910
49 Ga0070665_100055981 3300005548 Bacteria 3955
50 Ga0068855_100042748 3300005563 Bacteria 5369
51 Ga0068855_100045832 3300005563 Bacteria 5170
52 Ga0070664_100101027 3300005564 Bacteria 2508
53 Ga0068852_100016843 3300005616 Bacteria 5714
54 Ga0068859_100001659 3300005617 Bacteria 22653
55 Ga0068859_100141049 3300005617 Bacteria 2483
56 Ga0068859_100158098 3300005617 Bacteria 2345
57 Ga0068864_100000116 3300005618 Bacteria 79213
58 Ga0068864_100000363 3300005618 Bacteria 39706
59 Ga0068861_100027997 3300005719 Bacteria 4110
60 Ga0068861_100141472 3300005719 Bacteria 1964
61 Ga0068863_100000007 3300005841 Bacteria 257578
62 Ga0068863_100000512 3300005841 Bacteria 39481
63 Ga0068863_100002761 3300005841 Bacteria 17386
64 Ga0068858_100000853 3300005842 Bacteria 31569
65 Ga0068858_100003765 3300005842 Bacteria 14999
66 Ga0068858_100012285 3300005842 Bacteria 8078
67 Ga0068860_100000348 3300005843 Bacteria 62147
68 Ga0068860_100001231 3300005843 Bacteria 27931
69 Ga0068860_100026449 3300005843 Bacteria 5593
70 Ga0068860_100210822 3300005843 Bacteria 1885
71 Ga0068862_100000235 3300005844 Bacteria 61301
72 Ga0068862_100004650 3300005844 Bacteria 11565
73 Ga0068862_100039459 3300005844 Bacteria 4010
74 Ga0075368_10000828 3300006042 Bacteria 9530
75 Ga0075363_100100307 3300006048 Bacteria 1602
76 Ga0075367_10004477 3300006178 Bacteria 6829
77 Ga0075369_10041872 3300006186 Bacteria 1961
78 Ga0075366_10004488 3300006195 Bacteria 7486
79 Ga0075366_10055451 3300006195 Bacteria 2354
80 Ga0068865_100004105 3300006881 Bacteria 8752
81 Ga0097620_100001659 3300006931 Bacteria 22653
82 Ga0097620_100141043 3300006931 Bacteria 2483
83 Ga0097620_100158103 3300006931 Bacteria 2345
84 Ga0105240_10004218 3300009093 Bacteria 21976
85 Ga0105240_10035333 3300009093 Bacteria 6442
86 Ga0105247_10034840 3300009101 Bacteria 3066
87 Ga0105241_10043386 3300009174 Bacteria 3406
88 Ga0105248_10000438 3300009177 Bacteria 47263
89 Ga0105248_10015678 3300009177 Bacteria 8352
90 Ga0105238_10023041 3300009551 Bacteria 6350
91 Ga0105238_10025279 3300009551 Bacteria 6052
92 Ga0105249_10042807 3300009553 Bacteria 4120
93 Ga0105249_10460478 3300009553 Bacteria 1312
94 Ga0105239_10417455 3300010375 Bacteria 1520
95 Ga0163162_10052599 3300013306 Bacteria 4091
96 Ga0157372_10247133 3300013307 Bacteria 2071
97 Ga0163163_10033553 3300014325 Bacteria 4967
98 Ga0157379_10005938 3300014968 Bacteria 10514
99 Ga0157379_10063600 3300014968 Bacteria 3298
100 Ga0209026_1000925 3300025250 Bacteria 15013
101 Ga0209565_1000332 3300025263 Bacteria 42136
102 Ga0209673_1000523 3300025273 Bacteria 62816
103 Ga0209676_1000327 3300025292 Bacteria 91596
104 Ga0209676_1000409 3300025292 Bacteria 77127
105 Ga0209564_1003150 3300025295 Bacteria 11615
106 Ga0209564_1020702 3300025295 Bacteria 2398
107 Ga0209758_1007327 3300025297 Bacteria 7557
108 Ga0209758_1012854 3300025297 Bacteria 4636
109 Ga0209050_1000101 3300025298 Bacteria 230076
110 Ga0209050_1001254 3300025298 Bacteria 29280
111 Ga0209050_1003251 3300025298 Bacteria 12240
112 Ga0209050_1021363 3300025298 Bacteria 2363
113 Ga0209256_1003700 3300025299 Bacteria 10386
114 Ga0209256_1019981 3300025299 Bacteria 2110
115 Ga0209051_1000338 3300025303 Bacteria 70301
116 Ga0209257_1000220 3300025304 Bacteria 135116
117 Ga0209257_1000386 3300025304 Bacteria 88085
118 Ga0209257_1001334 3300025304 Bacteria 29951
119 Ga0209257_1004143 3300025304 Bacteria 11538
120 Ga0209257_1004190 3300025304 Bacteria 11433
121 Ga0207680_10078737 3300025903 Bacteria 2065
122 Ga0207680_10124927 3300025903 Bacteria 1688
123 Ga0207705_10165315 3300025909 Bacteria 1664
124 Ga0207707_10050393 3300025912 Bacteria 3627
125 Ga0207707_10124172 3300025912 Bacteria 2257
126 Ga0207695_10001229 3300025913 Bacteria 43850
127 Ga0207695_10013177 3300025913 Bacteria 9866
128 Ga0207695_10036359 3300025913 Bacteria 5325
129 Ga0207660_10014801 3300025917 Bacteria 5141
130 Ga0207657_10001137 3300025919 Bacteria 28234
131 Ga0207657_10069638 3300025919 Bacteria 2984
132 Ga0207681_10050897 3300025923 Bacteria 2804
133 Ga0207694_10109394 3300025924 Bacteria 2197
134 Ga0207650_10000062 3300025925 Bacteria 149776
135 Ga0207650_10046935 3300025925 Bacteria 3182
136 Ga0207644_10005911 3300025931 Bacteria 7979
137 Ga0207690_10000053 3300025932 Bacteria 105125
138 Ga0207690_10030130 3300025932 Bacteria 3457
139 Ga0207706_10100532 3300025933 Bacteria 2544
140 Ga0207711_10000962 3300025941 Bacteria 27597
141 Ga0207711_10004232 3300025941 Bacteria 12282
142 Ga0207711_10019042 3300025941 Bacteria 5712
143 Ga0207679_10083003 3300025945 Bacteria 2454
144 Ga0207667_10161660 3300025949 Bacteria 2303
145 Ga0207667_10191117 3300025949 Bacteria 2101
146 Ga0207712_10020958 3300025961 Bacteria 4287
147 Ga0207668_10000028 3300025972 Bacteria 125361
148 Ga0207668_10000130 3300025972 Bacteria 53528
149 Ga0207668_10006139 3300025972 Bacteria 7088
150 Ga0207658_10000218 3300025986 Bacteria 60270
151 Ga0207658_10002378 3300025986 Bacteria 13790
152 Ga0207658_10004629 3300025986 Bacteria 9536
153 Ga0207658_10057742 3300025986 Bacteria 2885
154 Ga0207703_10000038 3300026035 Bacteria 175917
155 Ga0207703_10001849 3300026035 Bacteria 18837
156 Ga0207703_10005735 3300026035 Bacteria 9952
157 Ga0207641_10000012 3300026088 Bacteria 375486
158 Ga0207641_10005569 3300026088 Bacteria 10733
159 Ga0207641_10009593 3300026088 Bacteria 7976
160 Ga0207676_10000179 3300026095 Bacteria 55697
161 Ga0207675_100038104 3300026118 Bacteria 4486
162 Ga0207683_10276874 3300026121 Bacteria 1533
163 Ga0207698_10256320 3300026142 Bacteria 1604
164 Ga0268266_10000064 3300028379 Bacteria 249533
165 Ga0268266_10003430 3300028379 Bacteria 15845
166 Ga0268266_10021826 3300028379 Bacteria 5454
167 Ga0268265_10000600 3300028380 Bacteria 36213
168 Ga0268265_10003284 3300028380 Bacteria 11727
169 Ga0268265_10026073 3300028380 Bacteria 4155
170 Ga0268264_10000046 3300028381 Bacteria 364597
171 Ga0268264_10000059 3300028381 Bacteria 306927
172 Ga0307517_10006007 3300028786 Bacteria 18094
173 Ga0307517_10027435 3300028786 Bacteria 6840
174 Ga0307515_10074813 3300028794 Bacteria 4523
175 Ga0265338_10016622 3300028800 Bacteria 7985
176 Ga0307511_10091735 3300030521 Bacteria 2054
177 Ga0265327_10003424 3300031251 Bacteria 15169
178 Ga0307513_10000261 3300031456 Bacteria 76045
179 Ga0307513_10004825 3300031456 Bacteria 17901
180 Ga0307513_10025085 3300031456 Bacteria 6918
181 Ga0265314_10129450 3300031711 Bacteria 1577
182 Ga0307516_10000352 3300031730 Bacteria 59644
183 Ga0307510_10057077 3300033180 Bacteria 4057
184 Ga0373936_0040705 3300035113 Bacteria 1862
185 Ga0373927_0000526 3300035695 Bacteria 29046
186 Ga0373925_0000061 3300037068 Bacteria 117783
187 Ga0395899_0000167 3300037312 Bacteria 100973
188 Ga0395900_0000009 3300037418 Bacteria 476249
189 Ga0395900_0075282 3300037418 Bacteria 3470
190 Ga0395900_0102045 3300037418 Bacteria 2947
191 Ga0395905_0025918 3300037471 Bacteria 5526
192 Ga0395905_0067606 3300037471 Bacteria 3347
193 Ga0395901_0000014 3300038443 Bacteria 375100
194 Ga0395901_0249413 3300038443 Bacteria 1850
195 Ga0436365_0707086 3300039437 Bacteria 6061
196 Ga0436365_0742244 3300039437 Bacteria 2064
197 Ga0436361_1160523 3300039447 Bacteria 18060
198 Ga0495627_001337 3300046453 Bacteria 14939
199 Ga0495590_0000792 3300046457 Bacteria 14394
200 Ga0495629_0025567 3300046459 Bacteria 4195
201 Ga0495638_0001417 3300046460 Bacteria 21767
202 Ga0495638_0001694 3300046460 Bacteria 19434
203 Ga0495638_0008423 3300046460 Bacteria 7315
204 Ga0495638_0035473 3300046460 Bacteria 3179
205 Ga0495638_0048791 3300046460 Bacteria 2649
206 Ga0495650_0000017 3300046471 Bacteria 542552
207 Ga0495650_0021143 3300046471 Bacteria 3154
208 Ga0495594_0009555 3300046499 Bacteria 5014
209 Ga0495607_0034406 3300046501 Bacteria 3074
210 Ga0495583_0000020 3300046506 Bacteria 296185
211 Ga0495606_0034886 3300046507 Bacteria 3446
212 Ga0495610_0000908 3300046512 Bacteria 27545
213 Ga0495610_0003965 3300046512 Bacteria 11200
214 Ga0495610_0046297 3300046512 Bacteria 2147
215 Ga0495616_0001591 3300046513 Bacteria 15584
216 Ga0495637_0013320 3300046520 Bacteria 3904
217 Ga0495648_0000948 3300046524 Bacteria 30025
218 Ga0495648_0044027 3300046524 Bacteria 2790
219 Ga0495648_0046587 3300046524 Bacteria 2686
220 Ga0495654_0000216 3300046530 Bacteria 54273
221 Ga0495654_0080498 3300046530 Bacteria 1528
222 Ga0495609_0009915 3300046538 Bacteria 4591
223 Ga0495597_0000930 3300046542 Bacteria 22738
224 Ga0495622_0001609 3300046557 Bacteria 11147
225 Ga0495668_0004319 3300046616 Bacteria 10158
226 Ga0495668_0006335 3300046616 Bacteria 7768
227 Ga0495668_0027740 3300046616 Bacteria 3208
228 Ga0495625_0002350 3300046660 Bacteria 20629
229 Ga0495625_0005019 3300046660 Bacteria 12277
230 Ga0495625_0031712 3300046660 Bacteria 3928
231 Ga0495625_0244872 3300046660 Bacteria 1166
232 Ga0495669_0000003 3300046684 Bacteria 267741
233 Ga0495669_0000234 3300046684 Bacteria 32800
234 Ga0495660_0027967 3300046810 Bacteria 3188
235 Ga0495672_0003460 3300047320 Bacteria 13502
236 Ga0495672_0055358 3300047320 Bacteria 2315
237 Ga0495673_0000078 3300047469 Bacteria 203066
238 Ga0495673_0000401 3300047469 Bacteria 50743
239 Ga0495673_0005884 3300047469 Bacteria 7323
240 Ga0495686_0003214 3300047472 Bacteria 14390
241 Ga0495686_0022496 3300047472 Bacteria 4172
242 Ga0495686_0059714 3300047472 Bacteria 2372
243 Ga0495593_0048502 3300047673 Bacteria 2257
244 Ga0496102_0119343 3300048905 Bacteria 2462
245 Ga0496107_0001524 3300048910 Bacteria 14388
246 Ga0496109_0034156 3300048912 Bacteria 4578
247 Ga0496112_0033630 3300048915 Bacteria 4985
248 Ga0496112_0039818 3300048915 Bacteria 4593
249 Ga0496115_0000794 3300048918 Bacteria 23158
250 Ga0496115_0021393 3300048918 Bacteria 4997
251 Ga0496115_0029865 3300048918 Bacteria 4285
252 Ga0496118_0010326 3300048921 Bacteria 9260
253 Ga0496119_0018966 3300048922 Bacteria 5093
254 Ga0496121_0000009 3300048924 Bacteria 836971
255 Ga0496121_0001613 3300048924 Bacteria 37440
256 Ga0496124_0006812 3300048927 Bacteria 12334
257 Ga0496125_0050636 3300048928 Bacteria 3437
258 Ga0496126_0001877 3300048929 Bacteria 30562
259 Ga0495678_001720 3300049459 Bacteria 16374
260 Ga0501033_0002053 3300049570 Bacteria 17511
261 Ga0501034_0049237 3300049571 Bacteria 4252
262 Ga0501037_0038854 3300049573 Bacteria 3505
263 Ga0501047_0020852 3300049581 Bacteria 6295
264 Ga0501044_0010562 3300049823 Bacteria 10014
265 Ga0501044_0032519 3300049823 Bacteria 5483
266 Ga0501044_0298055 3300049823 Bacteria 1542
267 nmdc:mga00v17_6375_c1 3300050491 Bacteria 6258
268 nmdc:mga0k408_21766_c1 3300050493 Bacteria 3605
269 nmdc:mga0k408_29158_c1 3300050493 Bacteria 3140
270 nmdc:mga0k408_84344_c1 3300050493 Bacteria 1864
271 nmdc:mga06z11_22383_c1 3300050494 Bacteria 2951
272 nmdc:mga07m45_187_c1 3300050496 Bacteria 14451
273 Ga0500635_0000775 3300053080 Bacteria 7950
274 Ga0500578_0000420 3300053086 Bacteria 51926
275 Ga0500643_015299 3300053087 Bacteria 2635
276 Ga0500644_0000274 3300053088 Bacteria 28730
277 Ga0500641_0000432 3300053096 Bacteria 15273
278 Ga0500641_0008067 3300053096 Bacteria 3752
279 Ga0500555_004969 3300053103 Bacteria 3773
280 Ga0500556_0000587 3300053104 Bacteria 23997
281 Ga0500556_0002730 3300053104 Bacteria 5451
282 Ga0500562_000145 3300053108 Bacteria 20904
283 Ga0500562_002063 3300053108 Bacteria 5019
284 Ga0500562_010322 3300053108 Bacteria 2366
285 Ga0500594_0000135 3300053118 Bacteria 20576
286 Ga0500595_002803 3300053119 Bacteria 8386
287 Ga0500608_000080 3300053122 Bacteria 40873
288 Ga0500608_048249 3300053122 Bacteria 2045
289 Ga0500618_000112 3300053125 Bacteria 65643
290 Ga0500559_0000111 3300053136 Bacteria 64064
291 Ga0500559_0006497 3300053136 Bacteria 5276
292 Ga0500559_0023754 3300053136 Bacteria 2603
293 Ga0500564_000021 3300053138 Bacteria 47765
294 Ga0500577_0001570 3300053142 Bacteria 5843
295 Ga0500590_009133 3300053148 Bacteria 4978
296 Ga0500604_0020699 3300053151 Bacteria 1854
297 Ga0500619_004914 3300053154 Bacteria 2925
298 Ga0500622_0000526 3300053156 Bacteria 35500
299 Ga0500622_0005215 3300053156 Bacteria 7862
300 Ga0500622_0006535 3300053156 Bacteria 6739
301 Ga0500639_054137 3300053163 Bacteria 2086
302 Ga0500637_0013338 3300053178 Bacteria 4307
303 Ga0500645_001393 3300053730 Bacteria 12327
304 Ga0500645_004105 3300053730 Bacteria 5692
305 Ga0500645_010976 3300053730 Bacteria 2975
306 Ga0500596_000346 3300053735 Bacteria 8329

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053108 Ga0500562_000145 Ga0500562_000145_12299_13534 352
2 3300005341 Ga0070691_10003066 Ga0070691_100030665 360
3 3300005458 Ga0070681_10035504 Ga0070681_100355043 360
4 3300005530 Ga0070679_100005360 Ga0070679_10000536010 360
5 3300005539 Ga0068853_100155274 Ga0068853_1001552742 360
6 3300005563 Ga0068855_100045832 Ga0068855_1000458323 360
7 3300025912 Ga0207707_10124172 Ga0207707_101241722 360
8 3300025913 Ga0207695_10001229 Ga0207695_100012294 360
9 3300025924 Ga0207694_10109394 Ga0207694_101093942 360
10 3300025949 Ga0207667_10161660 Ga0207667_101616602 360
11 3300053151 Ga0500604_0020699 Ga0500604_0020699_734_1816 360
12 3300046616 Ga0495668_0004319 Ga0495668_0004319_19_1173 370
13 3300046660 Ga0495625_0244872 Ga0495625_0244872_18_1142 370
14 3300053154 Ga0500619_004914 Ga0500619_004914_10_1134 372
15 3300050491 nmdc:mga00v17_6375_c1 nmdc:mga00v17_6375_c1_2600_3850 378
16 3300035113 Ga0373936_0040705 Ga0373936_0040705_590_1825 380
17 3300005548 Ga0070665_100055981 Ga0070665_1000559812 384
18 3300037312 Ga0395899_0000167 Ga0395899_0000167_66588_67877 386
19 3300037418 Ga0395900_0000009 Ga0395900_0000009_338501_339790 386
20 3300038443 Ga0395901_0000014 Ga0395901_0000014_289706_290995 386
21 3300005347 Ga0070668_100009664 Ga0070668_1000096647 387
22 3300005367 Ga0070667_100079011 Ga0070667_1000790112 387
23 3300005617 Ga0068859_100158098 Ga0068859_1001580982 387
24 3300005843 Ga0068860_100001231 Ga0068860_10000123113 387
25 3300005844 Ga0068862_100004650 Ga0068862_10000465010 387
26 3300006931 Ga0097620_100158103 Ga0097620_1001581032 387
27 3300028380 Ga0268265_10003284 Ga0268265_1000328411 387
28 3300028381 Ga0268264_10000046 Ga0268264_10000046180 387
29 3300048915 Ga0496112_0039818 Ga0496112_0039818_2515_3810 387
30 3300005719 Ga0068861_100141472 Ga0068861_1001414722 389
31 3300009093 Ga0105240_10004218 Ga0105240_1000421813 389
32 3300025913 Ga0207695_10013177 Ga0207695_1001317710 389
33 3300028786 Ga0307517_10027435 Ga0307517_100274352 389
34 3300031456 Ga0307513_10004825 Ga0307513_100048253 389
35 3300047320 Ga0495672_0055358 Ga0495672_0055358_375_1610 389
36 3300047472 Ga0495686_0059714 Ga0495686_0059714_178_1473 389
37 3300046512 Ga0495610_0046297 Ga0495610_0046297_313_1590 391
38 3300005618 Ga0068864_100000363 Ga0068864_10000036323 392
39 3300005841 Ga0068863_100000007 Ga0068863_100000007211 392
40 3300005842 Ga0068858_100000853 Ga0068858_1000008532 392
41 3300014968 Ga0157379_10063600 Ga0157379_100636003 392
42 3300026035 Ga0207703_10000038 Ga0207703_1000003837 392
43 3300026088 Ga0207641_10000012 Ga0207641_1000001298 392
44 3300026095 Ga0207676_10000179 Ga0207676_1000017919 392
45 3300006042 Ga0075368_10000828 Ga0075368_100008289 393
46 3300006178 Ga0075367_10004477 Ga0075367_100044774 393
47 3300006195 Ga0075366_10055451 Ga0075366_100554512 393
48 3300033180 Ga0307510_10057077 Ga0307510_100570772 393
49 3300050493 nmdc:mga0k408_84344_c1 nmdc:mga0k408_84344_c1_245_1540 393
50 3300050494 nmdc:mga06z11_22383_c1 nmdc:mga06z11_22383_c1_654_1949 393
51 3300050496 nmdc:mga07m45_187_c1 nmdc:mga07m45_187_c1_13102_14397 393
52 3300005347 Ga0070668_100062447 Ga0070668_1000624473 394
53 3300005367 Ga0070667_100002986 Ga0070667_1000029869 394
54 3300005548 Ga0070665_100000883 Ga0070665_10000088318 394
55 3300005844 Ga0068862_100039459 Ga0068862_1000394592 394
56 3300025972 Ga0207668_10000028 Ga0207668_10000028124 394
57 3300025986 Ga0207658_10002378 Ga0207658_100023789 394
58 3300028379 Ga0268266_10003430 Ga0268266_100034301 394
59 3300039437 Ga0436365_0707086 Ga0436365_0707086_2225_3511 394
60 3300046507 Ga0495606_0034886 Ga0495606_0034886_746_2020 394
61 3300005331 Ga0070670_100000037 Ga0070670_10000003718 395
62 3300005335 Ga0070666_10004507 Ga0070666_100045079 395
63 3300005347 Ga0070668_100001202 Ga0070668_10000120216 395
64 3300005367 Ga0070667_100000083 Ga0070667_10000008318 395
65 3300005548 Ga0070665_100001867 Ga0070665_10000186719 395
66 3300005618 Ga0068864_100000116 Ga0068864_10000011648 395
67 3300005841 Ga0068863_100000512 Ga0068863_1000005129 395
68 3300005842 Ga0068858_100012285 Ga0068858_10001228510 395
69 3300005843 Ga0068860_100000348 Ga0068860_10000034842 395
70 3300005844 Ga0068862_100000235 Ga0068862_10000023547 395
71 3300009101 Ga0105247_10034840 Ga0105247_100348403 395
72 3300009177 Ga0105248_10015678 Ga0105248_100156785 395
73 3300009553 Ga0105249_10042807 Ga0105249_100428071 395
74 3300025925 Ga0207650_10000062 Ga0207650_1000006271 395
75 3300025941 Ga0207711_10019042 Ga0207711_100190423 395
76 3300025961 Ga0207712_10020958 Ga0207712_100209585 395
77 3300025972 Ga0207668_10000130 Ga0207668_100001306 395
78 3300025986 Ga0207658_10000218 Ga0207658_1000021834 395
79 3300026035 Ga0207703_10001849 Ga0207703_100018492 395
80 3300026088 Ga0207641_10009593 Ga0207641_100095932 395
81 3300028379 Ga0268266_10021826 Ga0268266_100218263 395
82 3300028380 Ga0268265_10000600 Ga0268265_1000060023 395
83 3300028381 Ga0268264_10000059 Ga0268264_10000059290 395
84 3300049823 Ga0501044_0298055 Ga0501044_0298055_115_1425 395
85 3300009177 Ga0105248_10000438 Ga0105248_1000043817 396
86 3300025941 Ga0207711_10000962 Ga0207711_100009622 396
87 3300009551 Ga0105238_10023041 Ga0105238_100230412 397
88 3300009553 Ga0105249_10460478 Ga0105249_104604781 397
89 3300010375 Ga0105239_10417455 Ga0105239_104174551 397
90 3300013306 Ga0163162_10052599 Ga0163162_100525994 397
91 3300013307 Ga0157372_10247133 Ga0157372_102471332 397
92 3300014325 Ga0163163_10033553 Ga0163163_100335535 397
93 3300014968 Ga0157379_10005938 Ga0157379_1000593810 397
94 3300039447 Ga0436361_1160523 Ga0436361_1160523_418_1683 397
95 3300046499 Ga0495594_0009555 Ga0495594_0009555_2443_3678 397
96 3300048912 Ga0496109_0034156 Ga0496109_0034156_828_2063 397
97 3300048915 Ga0496112_0033630 Ga0496112_0033630_516_1751 397
98 3300049581 Ga0501047_0020852 Ga0501047_0020852_2655_3890 397
99 3300053096 Ga0500641_0008067 Ga0500641_0008067_1589_2824 397
100 3300005262 Ga0065165_1000845 Ga0065165_100084511 398
101 3300025295 Ga0209564_1003150 Ga0209564_100315010 398
102 3300037418 Ga0395900_0102045 Ga0395900_0102045_102_1391 398
103 3300046684 Ga0495669_0000003 Ga0495669_0000003_242866_244149 398
104 3300050493 nmdc:mga0k408_29158_c1 nmdc:mga0k408_29158_c1_1061_2335 398
105 3300046810 Ga0495660_0027967 Ga0495660_0027967_1460_2734 399
106 3300053087 Ga0500643_015299 Ga0500643_015299_67_1341 399
107 3300003781 Ga0055536_1002051 Ga0055536_10020512 400
108 3300003791 Ga0055530_10001148 Ga0055530_100011489 400
109 3300025292 Ga0209676_1000409 Ga0209676_100040918 400
110 3300025298 Ga0209050_1003251 Ga0209050_10032512 400
111 3300025303 Ga0209051_1000338 Ga0209051_100033857 400
112 3300025304 Ga0209257_1004143 Ga0209257_10041432 400
113 3300046660 Ga0495625_0002350 Ga0495625_0002350_1114_2388 400
114 3300038443 Ga0395901_0249413 Ga0395901_0249413_79_1386 401
115 3300039437 Ga0436365_0742244 Ga0436365_0742244_478_1773 401
116 3300046453 Ga0495627_001337 Ga0495627_001337_1621_2898 401
117 3300046471 Ga0495650_0000017 Ga0495650_0000017_130999_132273 401
118 3300046506 Ga0495583_0000020 Ga0495583_0000020_133147_134421 401
119 3300046524 Ga0495648_0046587 Ga0495648_0046587_24_1298 401
120 3300046530 Ga0495654_0000216 Ga0495654_0000216_3688_4962 401
121 3300046616 Ga0495668_0006335 Ga0495668_0006335_4252_5526 401
122 3300047469 Ga0495673_0000078 Ga0495673_0000078_189502_190779 401
123 3300053125 Ga0500618_000112 Ga0500618_000112_20250_21524 401
124 3300053136 Ga0500559_0000111 Ga0500559_0000111_36037_37311 401
125 3300053142 Ga0500577_0001570 Ga0500577_0001570_3994_5271 401
126 3300006881 Ga0068865_100004105 Ga0068865_1000041055 402
127 3300025298 Ga0209050_1021363 Ga0209050_10213632 402
128 3300025299 Ga0209256_1003700 Ga0209256_10037002 402
129 3300046459 Ga0495629_0025567 Ga0495629_0025567_741_2051 402
130 3300046460 Ga0495638_0001694 Ga0495638_0001694_7955_9229 402
131 3300046460 Ga0495638_0035473 Ga0495638_0035473_146_1420 402
132 3300046501 Ga0495607_0034406 Ga0495607_0034406_535_1809 402
133 3300046513 Ga0495616_0001591 Ga0495616_0001591_10898_12172 402
134 3300046524 Ga0495648_0044027 Ga0495648_0044027_952_2226 402
135 3300046530 Ga0495654_0080498 Ga0495654_0080498_47_1321 402
136 3300046538 Ga0495609_0009915 Ga0495609_0009915_1123_2433 402
137 3300046542 Ga0495597_0000930 Ga0495597_0000930_13399_14709 402
138 3300046557 Ga0495622_0001609 Ga0495622_0001609_2976_4286 402
139 3300047469 Ga0495673_0005884 Ga0495673_0005884_4126_5400 402
140 3300047673 Ga0495593_0048502 Ga0495593_0048502_800_2110 402
141 3300048905 Ga0496102_0119343 Ga0496102_0119343_911_2221 402
142 3300048910 Ga0496107_0001524 Ga0496107_0001524_6581_7855 402
143 3300048921 Ga0496118_0010326 Ga0496118_0010326_7514_8824 402
144 3300048922 Ga0496119_0018966 Ga0496119_0018966_2118_3428 402
145 3300048924 Ga0496121_0000009 Ga0496121_0000009_688912_690222 402
146 3300048924 Ga0496121_0001613 Ga0496121_0001613_3988_5262 402
147 3300053080 Ga0500635_0000775 Ga0500635_0000775_2892_4202 402
148 3300053119 Ga0500595_002803 Ga0500595_002803_6304_7614 402
149 3300053122 Ga0500608_048249 Ga0500608_048249_458_1768 402
150 3300053136 Ga0500559_0006497 Ga0500559_0006497_1138_2448 402
151 3300053148 Ga0500590_009133 Ga0500590_009133_2246_3556 402
152 3300053163 Ga0500639_054137 Ga0500639_054137_29_1339 402
153 3300053178 Ga0500637_0013338 Ga0500637_0013338_1121_2431 402
154 3300053735 Ga0500596_000346 Ga0500596_000346_5600_6910 402
155 3300003794 Ga0055531_10001482 Ga0055531_100014828 403
156 3300025304 Ga0209257_1000386 Ga0209257_100038623 403
157 3300026121 Ga0207683_10276874 Ga0207683_102768741 403
158 3300048918 Ga0496115_0000794 Ga0496115_0000794_15763_17049 403
159 3300053103 Ga0500555_004969 Ga0500555_004969_1902_3212 403
160 3300005458 Ga0070681_10034711 Ga0070681_100347113 405
161 3300005616 Ga0068852_100016843 Ga0068852_1000168432 405
162 3300025909 Ga0207705_10165315 Ga0207705_101653152 405
163 3300025912 Ga0207707_10050393 Ga0207707_100503932 405
164 3300026142 Ga0207698_10256320 Ga0207698_102563202 405
165 3300037471 Ga0395905_0025918 Ga0395905_0025918_1765_3081 405
166 iso_pu_bacteria 2582581280 2585153108 406
167 iso_pu_bacteria 2582581293 2585196670 406
168 iso_pu_bacteria 2643221545 2643751426 406
169 iso_pu_bacteria 2643221552 2643778216 406
170 iso_pu_bacteria 2643221584 2643928405 406
171 iso_pu_bacteria 2643221691 2644510521 406
172 iso_pu_bacteria 2818991435 2819536591 406
173 iso_pu_bacteria 2818991454 2819645752 406
174 3300009174 Ga0105241_10043386 Ga0105241_100433864 407
175 3300031711 Ga0265314_10129450 Ga0265314_101294502 407
176 3300053096 Ga0500641_0000432 Ga0500641_0000432_13259_14527 407
177 3300053108 Ga0500562_002063 Ga0500562_002063_3562_4830 407
178 3300053156 Ga0500622_0006535 Ga0500622_0006535_964_2232 407
179 3300053730 Ga0500645_001393 Ga0500645_001393_1541_2809 407
180 iso_pu_bacteria 2510917020 2511125399 407
181 iso_pu_bacteria 2582581279 2585148518 407
182 iso_pu_bacteria 2585428106 2587916713 407
183 iso_pu_bacteria 2643221583 2643923498 407
184 iso_pu_bacteria 2643221614 2644084966 407
185 iso_pu_bacteria 2643221640 2644225755 407
186 iso_pu_bacteria 2643221642 2644235244 407
187 iso_pu_bacteria 2643221661 2644342518 407
188 iso_pu_bacteria 2643221666 2644365818 407
189 iso_pu_bacteria 2857504554 2857506356 407
190 iso_pu_bacteria 2928531327 2928535379 407
191 3300028800 Ga0265338_10016622 Ga0265338_100166222 408
192 3300005347 Ga0070668_100082846 Ga0070668_1000828462 409
193 3300005617 Ga0068859_100141049 Ga0068859_1001410492 409
194 3300005719 Ga0068861_100027997 Ga0068861_1000279972 409
195 3300005843 Ga0068860_100210822 Ga0068860_1002108222 409
196 3300006931 Ga0097620_100141043 Ga0097620_1001410432 409
197 3300025304 Ga0209257_1004190 Ga0209257_10041905 409
198 3300025986 Ga0207658_10057742 Ga0207658_100577423 409
199 3300026118 Ga0207675_100038104 Ga0207675_1000381046 409
200 3300028380 Ga0268265_10026073 Ga0268265_100260736 409
201 3300046684 Ga0495669_0000234 Ga0495669_0000234_16955_18238 409
202 3300049570 Ga0501033_0002053 Ga0501033_0002053_8185_9462 409
203 3300049571 Ga0501034_0049237 Ga0501034_0049237_1813_3090 409
204 3300049573 Ga0501037_0038854 Ga0501037_0038854_1775_3052 409
205 3300049823 Ga0501044_0010562 Ga0501044_0010562_7558_8835 409
206 3300049823 Ga0501044_0032519 Ga0501044_0032519_2596_3885 409
207 3300003773 Ga0055537_1003960 Ga0055537_10039604 410
208 3300003775 Ga0055524_1005354 Ga0055524_10053542 410
209 3300003781 Ga0055536_1002072 Ga0055536_10020722 410
210 3300003790 Ga0055528_1007921 Ga0055528_10079212 410
211 3300003791 Ga0055530_10000647 Ga0055530_1000064711 410
212 3300003791 Ga0055530_10002587 Ga0055530_100025879 410
213 3300003794 Ga0055531_10002532 Ga0055531_100025322 410
214 3300004625 Ga0055543_1007538 Ga0055543_10075382 410
215 3300005262 Ga0065165_1000552 Ga0065165_100055246 410
216 3300005262 Ga0065165_1010534 Ga0065165_10105343 410
217 3300005327 Ga0070658_10046806 Ga0070658_100468062 410
218 3300005331 Ga0070670_100052858 Ga0070670_1000528583 410
219 3300005335 Ga0070666_10046554 Ga0070666_100465544 410
220 3300005336 Ga0070680_100018622 Ga0070680_1000186224 410
221 3300005339 Ga0070660_100009396 Ga0070660_1000093965 410
222 3300005339 Ga0070660_100024858 Ga0070660_1000248581 410
223 3300005347 Ga0070668_100014227 Ga0070668_1000142274 410
224 3300005353 Ga0070669_100008486 Ga0070669_1000084868 410
225 3300005355 Ga0070671_100047065 Ga0070671_1000470651 410
226 3300005355 Ga0070671_100131714 Ga0070671_1001317142 410
227 3300005366 Ga0070659_100000882 Ga0070659_10000088210 410
228 3300005366 Ga0070659_100002791 Ga0070659_1000027913 410
229 3300005367 Ga0070667_100025765 Ga0070667_1000257652 410
230 3300005457 Ga0070662_100118917 Ga0070662_1001189172 410
231 3300005458 Ga0070681_10072427 Ga0070681_100724273 410
232 3300005530 Ga0070679_100014519 Ga0070679_1000145195 410
233 3300005539 Ga0068853_100073801 Ga0068853_1000738012 410
234 3300005548 Ga0070665_100000116 Ga0070665_100000116111 410
235 3300005563 Ga0068855_100042748 Ga0068855_1000427483 410
236 3300005564 Ga0070664_100101027 Ga0070664_1001010272 410
237 3300005617 Ga0068859_100001659 Ga0068859_10000165911 410
238 3300005841 Ga0068863_100002761 Ga0068863_10000276115 410
239 3300005842 Ga0068858_100003765 Ga0068858_10000376514 410
240 3300005843 Ga0068860_100026449 Ga0068860_1000264494 410
241 3300006048 Ga0075363_100100307 Ga0075363_1001003072 410
242 3300006186 Ga0075369_10041872 Ga0075369_100418721 410
243 3300006195 Ga0075366_10004488 Ga0075366_100044886 410
244 3300006931 Ga0097620_100001659 Ga0097620_10000165913 410
245 3300009093 Ga0105240_10035333 Ga0105240_100353333 410
246 3300009551 Ga0105238_10025279 Ga0105238_100252794 410
247 3300025250 Ga0209026_1000925 Ga0209026_100092512 410
248 3300025263 Ga0209565_1000332 Ga0209565_100033229 410
249 3300025273 Ga0209673_1000523 Ga0209673_100052310 410
250 3300025292 Ga0209676_1000327 Ga0209676_100032735 410
251 3300025295 Ga0209564_1020702 Ga0209564_10207022 410
252 3300025297 Ga0209758_1007327 Ga0209758_10073276 410
253 3300025297 Ga0209758_1012854 Ga0209758_10128544 410
254 3300025298 Ga0209050_1000101 Ga0209050_1000101172 410
255 3300025298 Ga0209050_1001254 Ga0209050_10012542 410
256 3300025299 Ga0209256_1019981 Ga0209256_10199812 410
257 3300025304 Ga0209257_1000220 Ga0209257_100022024 410
258 3300025304 Ga0209257_1001334 Ga0209257_100133427 410
259 3300025903 Ga0207680_10078737 Ga0207680_100787372 410
260 3300025903 Ga0207680_10124927 Ga0207680_101249272 410
261 3300025913 Ga0207695_10036359 Ga0207695_100363593 410
262 3300025917 Ga0207660_10014801 Ga0207660_100148015 410
263 3300025919 Ga0207657_10001137 Ga0207657_1000113715 410
264 3300025919 Ga0207657_10069638 Ga0207657_100696382 410
265 3300025923 Ga0207681_10050897 Ga0207681_100508972 410
266 3300025925 Ga0207650_10046935 Ga0207650_100469352 410
267 3300025931 Ga0207644_10005911 Ga0207644_100059115 410
268 3300025932 Ga0207690_10000053 Ga0207690_1000005398 410
269 3300025932 Ga0207690_10030130 Ga0207690_100301302 410
270 3300025933 Ga0207706_10100532 Ga0207706_101005323 410
271 3300025941 Ga0207711_10004232 Ga0207711_100042329 410
272 3300025945 Ga0207679_10083003 Ga0207679_100830032 410
273 3300025949 Ga0207667_10191117 Ga0207667_101911172 410
274 3300025972 Ga0207668_10006139 Ga0207668_100061395 410
275 3300025986 Ga0207658_10004629 Ga0207658_100046292 410
276 3300026035 Ga0207703_10005735 Ga0207703_1000573510 410
277 3300026088 Ga0207641_10005569 Ga0207641_1000556911 410
278 3300028379 Ga0268266_10000064 Ga0268266_10000064217 410
279 3300028786 Ga0307517_10006007 Ga0307517_100060075 410
280 3300028794 Ga0307515_10074813 Ga0307515_100748134 410
281 3300030521 Ga0307511_10091735 Ga0307511_100917352 410
282 3300031251 Ga0265327_10003424 Ga0265327_100034248 410
283 3300031456 Ga0307513_10000261 Ga0307513_100002616 410
284 3300031456 Ga0307513_10025085 Ga0307513_100250853 410
285 3300031730 Ga0307516_10000352 Ga0307516_1000035257 410
286 3300035695 Ga0373927_0000526 Ga0373927_0000526_7893_9188 410
287 3300037068 Ga0373925_0000061 Ga0373925_0000061_48006_49301 410
288 3300037418 Ga0395900_0075282 Ga0395900_0075282_745_2055 410
289 3300037471 Ga0395905_0067606 Ga0395905_0067606_1015_2325 410
290 3300046457 Ga0495590_0000792 Ga0495590_0000792_8808_10088 410
291 3300046460 Ga0495638_0001417 Ga0495638_0001417_12761_14041 410
292 3300046460 Ga0495638_0008423 Ga0495638_0008423_3655_4929 410
293 3300046460 Ga0495638_0048791 Ga0495638_0048791_16_1296 410
294 3300046471 Ga0495650_0021143 Ga0495650_0021143_964_2244 410
295 3300046512 Ga0495610_0000908 Ga0495610_0000908_16793_18067 410
296 3300046512 Ga0495610_0003965 Ga0495610_0003965_2648_3928 410
297 3300046520 Ga0495637_0013320 Ga0495637_0013320_1710_2990 410
298 3300046524 Ga0495648_0000948 Ga0495648_0000948_18802_20082 410
299 3300046616 Ga0495668_0027740 Ga0495668_0027740_844_2124 410
300 3300046660 Ga0495625_0005019 Ga0495625_0005019_10111_11385 410
301 3300046660 Ga0495625_0031712 Ga0495625_0031712_548_1828 410
302 3300047320 Ga0495672_0003460 Ga0495672_0003460_2949_4223 410
303 3300047469 Ga0495673_0000401 Ga0495673_0000401_13450_14730 410
304 3300047472 Ga0495686_0003214 Ga0495686_0003214_9762_11042 410
305 3300047472 Ga0495686_0022496 Ga0495686_0022496_123_1403 410
306 3300048918 Ga0496115_0021393 Ga0496115_0021393_2926_4200 410
307 3300048918 Ga0496115_0029865 Ga0496115_0029865_927_2252 410
308 3300048927 Ga0496124_0006812 Ga0496124_0006812_8539_9819 410
309 3300048928 Ga0496125_0050636 Ga0496125_0050636_984_2285 410
310 3300048929 Ga0496126_0001877 Ga0496126_0001877_29172_30452 410
311 3300049459 Ga0495678_001720 Ga0495678_001720_9754_11034 410
312 3300050493 nmdc:mga0k408_21766_c1 nmdc:mga0k408_21766_c1_514_1794 410
313 3300053086 Ga0500578_0000420 Ga0500578_0000420_22577_23857 410
314 3300053088 Ga0500644_0000274 Ga0500644_0000274_17981_19261 410
315 3300053104 Ga0500556_0000587 Ga0500556_0000587_13891_15165 410
316 3300053104 Ga0500556_0002730 Ga0500556_0002730_686_1993 410
317 3300053108 Ga0500562_010322 Ga0500562_010322_507_1802 410
318 3300053118 Ga0500594_0000135 Ga0500594_0000135_6767_8047 410
319 3300053122 Ga0500608_000080 Ga0500608_000080_29959_31239 410
320 3300053136 Ga0500559_0023754 Ga0500559_0023754_576_1856 410
321 3300053138 Ga0500564_000021 Ga0500564_000021_36183_37463 410
322 3300053156 Ga0500622_0000526 Ga0500622_0000526_23944_25224 410
323 3300053156 Ga0500622_0005215 Ga0500622_0005215_1168_2448 410
324 3300053730 Ga0500645_004105 Ga0500645_004105_170_1465 410
325 3300053730 Ga0500645_010976 Ga0500645_010976_13_1287 410
326 iso_pu_bacteria 2643221598 2644000270 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

300

434

0.95

PF12704

MacB_PCD

MacB-like periplasmic core domain

50

271

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8764 45 250
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8606 45 251
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8567 45 251
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8454 45 251
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8443 264 407
ID Description Score Start End Superfamily
af_Q0J314_1_71_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7376 56 86 3.30.70.100
af_P9WJP9_660_771_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5538 139 210 2.40.40.20
1cz5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5156 135 224 2.40.40.20
af_A0A1D6JR45_49_209_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5103 279 408 1.10.1760.20
af_A0A144A3W0_47_229_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5051 155 189 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C5KER4-F1-model_v4 FtsX-like permease family protein 0.9507 262 410 GO:0044874
GO:0098797
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.9492 237 410 GO:0044874
GO:0098797
AF-A0A2D5LV36-F1-model_v4 Transporter 0.9477 270 410 GO:0044874
GO:0098797
AF-A0A1V5L664-F1-model_v4 Lipoprotein-releasing system transmembrane protein LolE 0.947 90 410 GO:0044874
GO:0098797
AF-A0A3E0QA95-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.9459 221 410 GO:0044874
GO:0098797

Feature Viewer

pLDDT pTM Quality
67.22 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map