F408508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 196 | 306 | 417 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0029865|Ga0496115_0029865_927_2252 |
| Length | 441 |
| Sequence | MNQAPAGLVQAGAEQAGVGGRAPPFGLWERMLAGRYLRAKRSQGGVALISIISFFGIMVAVAVLIVVMSVMNGFREELLGKILGFNGHIFVSGGVLDGAARDPAVQRILKAPGVTQATPVIEAQVIAMGPNQTTGAIVRGLSPKDLKATSIVANNLTKGDLRGYGQGEYGGDVIVMGDRLAEQLGVRAGDSIALVSPSGGATAFGSAPVQKSYIVGATFTAGMSQYDQAYIFMPFEQAQLFFGREGTADVIEVRVTNPDKAATLKAAVARAAGPTAMVADWTQRDASYWGALKVERNVMRLILMLIVAIAALNIISGLTMLVKNKGRDIAILRTIGGGQGAILRIFFMAGATIGVLGTAAGLALGALVSVYIDPIQAFVEWATGQAVFSSDVYFLNRLPAKVDWMEVAIIVAFSMVMSMICTLPPAWRASRLDPVEALRYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 11 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 15 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 16 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 17 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 18 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 19 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 20 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 118 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 119 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 120 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 159 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 175 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 176 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 177 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 179 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 180 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 181 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 182 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 183 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 184 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 187 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 190 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 191 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 193 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 194 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 195 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 196 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.87 |
| Metatranscriptomes | 0 |
| Isolates | 6.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.54 |
| Nodule | 0 |
| Rhizoplane | 2.45 |
| Rhizosphere | 63.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055537_1003960 | 3300003773 | Bacteria | 4387 |
| 2 | Ga0055524_1005354 | 3300003775 | Bacteria | 5748 |
| 3 | Ga0055536_1002051 | 3300003781 | Bacteria | 11513 |
| 4 | Ga0055536_1002072 | 3300003781 | Bacteria | 11453 |
| 5 | Ga0055528_1007921 | 3300003790 | Bacteria | 4632 |
| 6 | Ga0055530_10000647 | 3300003791 | Bacteria | 29932 |
| 7 | Ga0055530_10001148 | 3300003791 | Bacteria | 20593 |
| 8 | Ga0055530_10002587 | 3300003791 | Bacteria | 11453 |
| 9 | Ga0055531_10001482 | 3300003794 | Bacteria | 17267 |
| 10 | Ga0055531_10002532 | 3300003794 | Bacteria | 12150 |
| 11 | Ga0055543_1007538 | 3300004625 | Bacteria | 2501 |
| 12 | Ga0065165_1000552 | 3300005262 | Bacteria | 56291 |
| 13 | Ga0065165_1000845 | 3300005262 | Bacteria | 40173 |
| 14 | Ga0065165_1010534 | 3300005262 | Bacteria | 3977 |
| 15 | Ga0070658_10046806 | 3300005327 | Bacteria | 3500 |
| 16 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 17 | Ga0070670_100052858 | 3300005331 | Bacteria | 3489 |
| 18 | Ga0070666_10004507 | 3300005335 | Bacteria | 8488 |
| 19 | Ga0070666_10046554 | 3300005335 | Bacteria | 2910 |
| 20 | Ga0070680_100018622 | 3300005336 | Bacteria | 5490 |
| 21 | Ga0070660_100009396 | 3300005339 | Bacteria | 6874 |
| 22 | Ga0070660_100024858 | 3300005339 | Bacteria | 4448 |
| 23 | Ga0070691_10003066 | 3300005341 | Bacteria | 7485 |
| 24 | Ga0070668_100001202 | 3300005347 | Bacteria | 18371 |
| 25 | Ga0070668_100009664 | 3300005347 | Bacteria | 7153 |
| 26 | Ga0070668_100014227 | 3300005347 | Bacteria | 5945 |
| 27 | Ga0070668_100062447 | 3300005347 | Bacteria | 2886 |
| 28 | Ga0070668_100082846 | 3300005347 | Bacteria | 2517 |
| 29 | Ga0070669_100008486 | 3300005353 | Bacteria | 7334 |
| 30 | Ga0070671_100047065 | 3300005355 | Bacteria | 3587 |
| 31 | Ga0070671_100131714 | 3300005355 | Bacteria | 2106 |
| 32 | Ga0070659_100000882 | 3300005366 | Bacteria | 21920 |
| 33 | Ga0070659_100002791 | 3300005366 | Bacteria | 12431 |
| 34 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 35 | Ga0070667_100002986 | 3300005367 | Bacteria | 14534 |
| 36 | Ga0070667_100025765 | 3300005367 | Bacteria | 4891 |
| 37 | Ga0070667_100079011 | 3300005367 | Bacteria | 2811 |
| 38 | Ga0070662_100118917 | 3300005457 | Bacteria | 2023 |
| 39 | Ga0070681_10034711 | 3300005458 | Bacteria | 5065 |
| 40 | Ga0070681_10035504 | 3300005458 | Bacteria | 5009 |
| 41 | Ga0070681_10072427 | 3300005458 | Bacteria | 3408 |
| 42 | Ga0070679_100005360 | 3300005530 | Bacteria | 11867 |
| 43 | Ga0070679_100014519 | 3300005530 | Bacteria | 7567 |
| 44 | Ga0068853_100073801 | 3300005539 | Bacteria | 2975 |
| 45 | Ga0068853_100155274 | 3300005539 | Bacteria | 2062 |
| 46 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 47 | Ga0070665_100000883 | 3300005548 | Bacteria | 38439 |
| 48 | Ga0070665_100001867 | 3300005548 | Bacteria | 23910 |
| 49 | Ga0070665_100055981 | 3300005548 | Bacteria | 3955 |
| 50 | Ga0068855_100042748 | 3300005563 | Bacteria | 5369 |
| 51 | Ga0068855_100045832 | 3300005563 | Bacteria | 5170 |
| 52 | Ga0070664_100101027 | 3300005564 | Bacteria | 2508 |
| 53 | Ga0068852_100016843 | 3300005616 | Bacteria | 5714 |
| 54 | Ga0068859_100001659 | 3300005617 | Bacteria | 22653 |
| 55 | Ga0068859_100141049 | 3300005617 | Bacteria | 2483 |
| 56 | Ga0068859_100158098 | 3300005617 | Bacteria | 2345 |
| 57 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 58 | Ga0068864_100000363 | 3300005618 | Bacteria | 39706 |
| 59 | Ga0068861_100027997 | 3300005719 | Bacteria | 4110 |
| 60 | Ga0068861_100141472 | 3300005719 | Bacteria | 1964 |
| 61 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 62 | Ga0068863_100000512 | 3300005841 | Bacteria | 39481 |
| 63 | Ga0068863_100002761 | 3300005841 | Bacteria | 17386 |
| 64 | Ga0068858_100000853 | 3300005842 | Bacteria | 31569 |
| 65 | Ga0068858_100003765 | 3300005842 | Bacteria | 14999 |
| 66 | Ga0068858_100012285 | 3300005842 | Bacteria | 8078 |
| 67 | Ga0068860_100000348 | 3300005843 | Bacteria | 62147 |
| 68 | Ga0068860_100001231 | 3300005843 | Bacteria | 27931 |
| 69 | Ga0068860_100026449 | 3300005843 | Bacteria | 5593 |
| 70 | Ga0068860_100210822 | 3300005843 | Bacteria | 1885 |
| 71 | Ga0068862_100000235 | 3300005844 | Bacteria | 61301 |
| 72 | Ga0068862_100004650 | 3300005844 | Bacteria | 11565 |
| 73 | Ga0068862_100039459 | 3300005844 | Bacteria | 4010 |
| 74 | Ga0075368_10000828 | 3300006042 | Bacteria | 9530 |
| 75 | Ga0075363_100100307 | 3300006048 | Bacteria | 1602 |
| 76 | Ga0075367_10004477 | 3300006178 | Bacteria | 6829 |
| 77 | Ga0075369_10041872 | 3300006186 | Bacteria | 1961 |
| 78 | Ga0075366_10004488 | 3300006195 | Bacteria | 7486 |
| 79 | Ga0075366_10055451 | 3300006195 | Bacteria | 2354 |
| 80 | Ga0068865_100004105 | 3300006881 | Bacteria | 8752 |
| 81 | Ga0097620_100001659 | 3300006931 | Bacteria | 22653 |
| 82 | Ga0097620_100141043 | 3300006931 | Bacteria | 2483 |
| 83 | Ga0097620_100158103 | 3300006931 | Bacteria | 2345 |
| 84 | Ga0105240_10004218 | 3300009093 | Bacteria | 21976 |
| 85 | Ga0105240_10035333 | 3300009093 | Bacteria | 6442 |
| 86 | Ga0105247_10034840 | 3300009101 | Bacteria | 3066 |
| 87 | Ga0105241_10043386 | 3300009174 | Bacteria | 3406 |
| 88 | Ga0105248_10000438 | 3300009177 | Bacteria | 47263 |
| 89 | Ga0105248_10015678 | 3300009177 | Bacteria | 8352 |
| 90 | Ga0105238_10023041 | 3300009551 | Bacteria | 6350 |
| 91 | Ga0105238_10025279 | 3300009551 | Bacteria | 6052 |
| 92 | Ga0105249_10042807 | 3300009553 | Bacteria | 4120 |
| 93 | Ga0105249_10460478 | 3300009553 | Bacteria | 1312 |
| 94 | Ga0105239_10417455 | 3300010375 | Bacteria | 1520 |
| 95 | Ga0163162_10052599 | 3300013306 | Bacteria | 4091 |
| 96 | Ga0157372_10247133 | 3300013307 | Bacteria | 2071 |
| 97 | Ga0163163_10033553 | 3300014325 | Bacteria | 4967 |
| 98 | Ga0157379_10005938 | 3300014968 | Bacteria | 10514 |
| 99 | Ga0157379_10063600 | 3300014968 | Bacteria | 3298 |
| 100 | Ga0209026_1000925 | 3300025250 | Bacteria | 15013 |
| 101 | Ga0209565_1000332 | 3300025263 | Bacteria | 42136 |
| 102 | Ga0209673_1000523 | 3300025273 | Bacteria | 62816 |
| 103 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 104 | Ga0209676_1000409 | 3300025292 | Bacteria | 77127 |
| 105 | Ga0209564_1003150 | 3300025295 | Bacteria | 11615 |
| 106 | Ga0209564_1020702 | 3300025295 | Bacteria | 2398 |
| 107 | Ga0209758_1007327 | 3300025297 | Bacteria | 7557 |
| 108 | Ga0209758_1012854 | 3300025297 | Bacteria | 4636 |
| 109 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 110 | Ga0209050_1001254 | 3300025298 | Bacteria | 29280 |
| 111 | Ga0209050_1003251 | 3300025298 | Bacteria | 12240 |
| 112 | Ga0209050_1021363 | 3300025298 | Bacteria | 2363 |
| 113 | Ga0209256_1003700 | 3300025299 | Bacteria | 10386 |
| 114 | Ga0209256_1019981 | 3300025299 | Bacteria | 2110 |
| 115 | Ga0209051_1000338 | 3300025303 | Bacteria | 70301 |
| 116 | Ga0209257_1000220 | 3300025304 | Bacteria | 135116 |
| 117 | Ga0209257_1000386 | 3300025304 | Bacteria | 88085 |
| 118 | Ga0209257_1001334 | 3300025304 | Bacteria | 29951 |
| 119 | Ga0209257_1004143 | 3300025304 | Bacteria | 11538 |
| 120 | Ga0209257_1004190 | 3300025304 | Bacteria | 11433 |
| 121 | Ga0207680_10078737 | 3300025903 | Bacteria | 2065 |
| 122 | Ga0207680_10124927 | 3300025903 | Bacteria | 1688 |
| 123 | Ga0207705_10165315 | 3300025909 | Bacteria | 1664 |
| 124 | Ga0207707_10050393 | 3300025912 | Bacteria | 3627 |
| 125 | Ga0207707_10124172 | 3300025912 | Bacteria | 2257 |
| 126 | Ga0207695_10001229 | 3300025913 | Bacteria | 43850 |
| 127 | Ga0207695_10013177 | 3300025913 | Bacteria | 9866 |
| 128 | Ga0207695_10036359 | 3300025913 | Bacteria | 5325 |
| 129 | Ga0207660_10014801 | 3300025917 | Bacteria | 5141 |
| 130 | Ga0207657_10001137 | 3300025919 | Bacteria | 28234 |
| 131 | Ga0207657_10069638 | 3300025919 | Bacteria | 2984 |
| 132 | Ga0207681_10050897 | 3300025923 | Bacteria | 2804 |
| 133 | Ga0207694_10109394 | 3300025924 | Bacteria | 2197 |
| 134 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 135 | Ga0207650_10046935 | 3300025925 | Bacteria | 3182 |
| 136 | Ga0207644_10005911 | 3300025931 | Bacteria | 7979 |
| 137 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 138 | Ga0207690_10030130 | 3300025932 | Bacteria | 3457 |
| 139 | Ga0207706_10100532 | 3300025933 | Bacteria | 2544 |
| 140 | Ga0207711_10000962 | 3300025941 | Bacteria | 27597 |
| 141 | Ga0207711_10004232 | 3300025941 | Bacteria | 12282 |
| 142 | Ga0207711_10019042 | 3300025941 | Bacteria | 5712 |
| 143 | Ga0207679_10083003 | 3300025945 | Bacteria | 2454 |
| 144 | Ga0207667_10161660 | 3300025949 | Bacteria | 2303 |
| 145 | Ga0207667_10191117 | 3300025949 | Bacteria | 2101 |
| 146 | Ga0207712_10020958 | 3300025961 | Bacteria | 4287 |
| 147 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 148 | Ga0207668_10000130 | 3300025972 | Bacteria | 53528 |
| 149 | Ga0207668_10006139 | 3300025972 | Bacteria | 7088 |
| 150 | Ga0207658_10000218 | 3300025986 | Bacteria | 60270 |
| 151 | Ga0207658_10002378 | 3300025986 | Bacteria | 13790 |
| 152 | Ga0207658_10004629 | 3300025986 | Bacteria | 9536 |
| 153 | Ga0207658_10057742 | 3300025986 | Bacteria | 2885 |
| 154 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 155 | Ga0207703_10001849 | 3300026035 | Bacteria | 18837 |
| 156 | Ga0207703_10005735 | 3300026035 | Bacteria | 9952 |
| 157 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 158 | Ga0207641_10005569 | 3300026088 | Bacteria | 10733 |
| 159 | Ga0207641_10009593 | 3300026088 | Bacteria | 7976 |
| 160 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 161 | Ga0207675_100038104 | 3300026118 | Bacteria | 4486 |
| 162 | Ga0207683_10276874 | 3300026121 | Bacteria | 1533 |
| 163 | Ga0207698_10256320 | 3300026142 | Bacteria | 1604 |
| 164 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 165 | Ga0268266_10003430 | 3300028379 | Bacteria | 15845 |
| 166 | Ga0268266_10021826 | 3300028379 | Bacteria | 5454 |
| 167 | Ga0268265_10000600 | 3300028380 | Bacteria | 36213 |
| 168 | Ga0268265_10003284 | 3300028380 | Bacteria | 11727 |
| 169 | Ga0268265_10026073 | 3300028380 | Bacteria | 4155 |
| 170 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 171 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 172 | Ga0307517_10006007 | 3300028786 | Bacteria | 18094 |
| 173 | Ga0307517_10027435 | 3300028786 | Bacteria | 6840 |
| 174 | Ga0307515_10074813 | 3300028794 | Bacteria | 4523 |
| 175 | Ga0265338_10016622 | 3300028800 | Bacteria | 7985 |
| 176 | Ga0307511_10091735 | 3300030521 | Bacteria | 2054 |
| 177 | Ga0265327_10003424 | 3300031251 | Bacteria | 15169 |
| 178 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 179 | Ga0307513_10004825 | 3300031456 | Bacteria | 17901 |
| 180 | Ga0307513_10025085 | 3300031456 | Bacteria | 6918 |
| 181 | Ga0265314_10129450 | 3300031711 | Bacteria | 1577 |
| 182 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 183 | Ga0307510_10057077 | 3300033180 | Bacteria | 4057 |
| 184 | Ga0373936_0040705 | 3300035113 | Bacteria | 1862 |
| 185 | Ga0373927_0000526 | 3300035695 | Bacteria | 29046 |
| 186 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 187 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 188 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 189 | Ga0395900_0075282 | 3300037418 | Bacteria | 3470 |
| 190 | Ga0395900_0102045 | 3300037418 | Bacteria | 2947 |
| 191 | Ga0395905_0025918 | 3300037471 | Bacteria | 5526 |
| 192 | Ga0395905_0067606 | 3300037471 | Bacteria | 3347 |
| 193 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 194 | Ga0395901_0249413 | 3300038443 | Bacteria | 1850 |
| 195 | Ga0436365_0707086 | 3300039437 | Bacteria | 6061 |
| 196 | Ga0436365_0742244 | 3300039437 | Bacteria | 2064 |
| 197 | Ga0436361_1160523 | 3300039447 | Bacteria | 18060 |
| 198 | Ga0495627_001337 | 3300046453 | Bacteria | 14939 |
| 199 | Ga0495590_0000792 | 3300046457 | Bacteria | 14394 |
| 200 | Ga0495629_0025567 | 3300046459 | Bacteria | 4195 |
| 201 | Ga0495638_0001417 | 3300046460 | Bacteria | 21767 |
| 202 | Ga0495638_0001694 | 3300046460 | Bacteria | 19434 |
| 203 | Ga0495638_0008423 | 3300046460 | Bacteria | 7315 |
| 204 | Ga0495638_0035473 | 3300046460 | Bacteria | 3179 |
| 205 | Ga0495638_0048791 | 3300046460 | Bacteria | 2649 |
| 206 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 207 | Ga0495650_0021143 | 3300046471 | Bacteria | 3154 |
| 208 | Ga0495594_0009555 | 3300046499 | Bacteria | 5014 |
| 209 | Ga0495607_0034406 | 3300046501 | Bacteria | 3074 |
| 210 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 211 | Ga0495606_0034886 | 3300046507 | Bacteria | 3446 |
| 212 | Ga0495610_0000908 | 3300046512 | Bacteria | 27545 |
| 213 | Ga0495610_0003965 | 3300046512 | Bacteria | 11200 |
| 214 | Ga0495610_0046297 | 3300046512 | Bacteria | 2147 |
| 215 | Ga0495616_0001591 | 3300046513 | Bacteria | 15584 |
| 216 | Ga0495637_0013320 | 3300046520 | Bacteria | 3904 |
| 217 | Ga0495648_0000948 | 3300046524 | Bacteria | 30025 |
| 218 | Ga0495648_0044027 | 3300046524 | Bacteria | 2790 |
| 219 | Ga0495648_0046587 | 3300046524 | Bacteria | 2686 |
| 220 | Ga0495654_0000216 | 3300046530 | Bacteria | 54273 |
| 221 | Ga0495654_0080498 | 3300046530 | Bacteria | 1528 |
| 222 | Ga0495609_0009915 | 3300046538 | Bacteria | 4591 |
| 223 | Ga0495597_0000930 | 3300046542 | Bacteria | 22738 |
| 224 | Ga0495622_0001609 | 3300046557 | Bacteria | 11147 |
| 225 | Ga0495668_0004319 | 3300046616 | Bacteria | 10158 |
| 226 | Ga0495668_0006335 | 3300046616 | Bacteria | 7768 |
| 227 | Ga0495668_0027740 | 3300046616 | Bacteria | 3208 |
| 228 | Ga0495625_0002350 | 3300046660 | Bacteria | 20629 |
| 229 | Ga0495625_0005019 | 3300046660 | Bacteria | 12277 |
| 230 | Ga0495625_0031712 | 3300046660 | Bacteria | 3928 |
| 231 | Ga0495625_0244872 | 3300046660 | Bacteria | 1166 |
| 232 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 233 | Ga0495669_0000234 | 3300046684 | Bacteria | 32800 |
| 234 | Ga0495660_0027967 | 3300046810 | Bacteria | 3188 |
| 235 | Ga0495672_0003460 | 3300047320 | Bacteria | 13502 |
| 236 | Ga0495672_0055358 | 3300047320 | Bacteria | 2315 |
| 237 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 238 | Ga0495673_0000401 | 3300047469 | Bacteria | 50743 |
| 239 | Ga0495673_0005884 | 3300047469 | Bacteria | 7323 |
| 240 | Ga0495686_0003214 | 3300047472 | Bacteria | 14390 |
| 241 | Ga0495686_0022496 | 3300047472 | Bacteria | 4172 |
| 242 | Ga0495686_0059714 | 3300047472 | Bacteria | 2372 |
| 243 | Ga0495593_0048502 | 3300047673 | Bacteria | 2257 |
| 244 | Ga0496102_0119343 | 3300048905 | Bacteria | 2462 |
| 245 | Ga0496107_0001524 | 3300048910 | Bacteria | 14388 |
| 246 | Ga0496109_0034156 | 3300048912 | Bacteria | 4578 |
| 247 | Ga0496112_0033630 | 3300048915 | Bacteria | 4985 |
| 248 | Ga0496112_0039818 | 3300048915 | Bacteria | 4593 |
| 249 | Ga0496115_0000794 | 3300048918 | Bacteria | 23158 |
| 250 | Ga0496115_0021393 | 3300048918 | Bacteria | 4997 |
| 251 | Ga0496115_0029865 | 3300048918 | Bacteria | 4285 |
| 252 | Ga0496118_0010326 | 3300048921 | Bacteria | 9260 |
| 253 | Ga0496119_0018966 | 3300048922 | Bacteria | 5093 |
| 254 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 255 | Ga0496121_0001613 | 3300048924 | Bacteria | 37440 |
| 256 | Ga0496124_0006812 | 3300048927 | Bacteria | 12334 |
| 257 | Ga0496125_0050636 | 3300048928 | Bacteria | 3437 |
| 258 | Ga0496126_0001877 | 3300048929 | Bacteria | 30562 |
| 259 | Ga0495678_001720 | 3300049459 | Bacteria | 16374 |
| 260 | Ga0501033_0002053 | 3300049570 | Bacteria | 17511 |
| 261 | Ga0501034_0049237 | 3300049571 | Bacteria | 4252 |
| 262 | Ga0501037_0038854 | 3300049573 | Bacteria | 3505 |
| 263 | Ga0501047_0020852 | 3300049581 | Bacteria | 6295 |
| 264 | Ga0501044_0010562 | 3300049823 | Bacteria | 10014 |
| 265 | Ga0501044_0032519 | 3300049823 | Bacteria | 5483 |
| 266 | Ga0501044_0298055 | 3300049823 | Bacteria | 1542 |
| 267 | nmdc:mga00v17_6375_c1 | 3300050491 | Bacteria | 6258 |
| 268 | nmdc:mga0k408_21766_c1 | 3300050493 | Bacteria | 3605 |
| 269 | nmdc:mga0k408_29158_c1 | 3300050493 | Bacteria | 3140 |
| 270 | nmdc:mga0k408_84344_c1 | 3300050493 | Bacteria | 1864 |
| 271 | nmdc:mga06z11_22383_c1 | 3300050494 | Bacteria | 2951 |
| 272 | nmdc:mga07m45_187_c1 | 3300050496 | Bacteria | 14451 |
| 273 | Ga0500635_0000775 | 3300053080 | Bacteria | 7950 |
| 274 | Ga0500578_0000420 | 3300053086 | Bacteria | 51926 |
| 275 | Ga0500643_015299 | 3300053087 | Bacteria | 2635 |
| 276 | Ga0500644_0000274 | 3300053088 | Bacteria | 28730 |
| 277 | Ga0500641_0000432 | 3300053096 | Bacteria | 15273 |
| 278 | Ga0500641_0008067 | 3300053096 | Bacteria | 3752 |
| 279 | Ga0500555_004969 | 3300053103 | Bacteria | 3773 |
| 280 | Ga0500556_0000587 | 3300053104 | Bacteria | 23997 |
| 281 | Ga0500556_0002730 | 3300053104 | Bacteria | 5451 |
| 282 | Ga0500562_000145 | 3300053108 | Bacteria | 20904 |
| 283 | Ga0500562_002063 | 3300053108 | Bacteria | 5019 |
| 284 | Ga0500562_010322 | 3300053108 | Bacteria | 2366 |
| 285 | Ga0500594_0000135 | 3300053118 | Bacteria | 20576 |
| 286 | Ga0500595_002803 | 3300053119 | Bacteria | 8386 |
| 287 | Ga0500608_000080 | 3300053122 | Bacteria | 40873 |
| 288 | Ga0500608_048249 | 3300053122 | Bacteria | 2045 |
| 289 | Ga0500618_000112 | 3300053125 | Bacteria | 65643 |
| 290 | Ga0500559_0000111 | 3300053136 | Bacteria | 64064 |
| 291 | Ga0500559_0006497 | 3300053136 | Bacteria | 5276 |
| 292 | Ga0500559_0023754 | 3300053136 | Bacteria | 2603 |
| 293 | Ga0500564_000021 | 3300053138 | Bacteria | 47765 |
| 294 | Ga0500577_0001570 | 3300053142 | Bacteria | 5843 |
| 295 | Ga0500590_009133 | 3300053148 | Bacteria | 4978 |
| 296 | Ga0500604_0020699 | 3300053151 | Bacteria | 1854 |
| 297 | Ga0500619_004914 | 3300053154 | Bacteria | 2925 |
| 298 | Ga0500622_0000526 | 3300053156 | Bacteria | 35500 |
| 299 | Ga0500622_0005215 | 3300053156 | Bacteria | 7862 |
| 300 | Ga0500622_0006535 | 3300053156 | Bacteria | 6739 |
| 301 | Ga0500639_054137 | 3300053163 | Bacteria | 2086 |
| 302 | Ga0500637_0013338 | 3300053178 | Bacteria | 4307 |
| 303 | Ga0500645_001393 | 3300053730 | Bacteria | 12327 |
| 304 | Ga0500645_004105 | 3300053730 | Bacteria | 5692 |
| 305 | Ga0500645_010976 | 3300053730 | Bacteria | 2975 |
| 306 | Ga0500596_000346 | 3300053735 | Bacteria | 8329 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053108 | Ga0500562_000145 | Ga0500562_000145_12299_13534 | 352 |
| 2 | 3300005341 | Ga0070691_10003066 | Ga0070691_100030665 | 360 |
| 3 | 3300005458 | Ga0070681_10035504 | Ga0070681_100355043 | 360 |
| 4 | 3300005530 | Ga0070679_100005360 | Ga0070679_10000536010 | 360 |
| 5 | 3300005539 | Ga0068853_100155274 | Ga0068853_1001552742 | 360 |
| 6 | 3300005563 | Ga0068855_100045832 | Ga0068855_1000458323 | 360 |
| 7 | 3300025912 | Ga0207707_10124172 | Ga0207707_101241722 | 360 |
| 8 | 3300025913 | Ga0207695_10001229 | Ga0207695_100012294 | 360 |
| 9 | 3300025924 | Ga0207694_10109394 | Ga0207694_101093942 | 360 |
| 10 | 3300025949 | Ga0207667_10161660 | Ga0207667_101616602 | 360 |
| 11 | 3300053151 | Ga0500604_0020699 | Ga0500604_0020699_734_1816 | 360 |
| 12 | 3300046616 | Ga0495668_0004319 | Ga0495668_0004319_19_1173 | 370 |
| 13 | 3300046660 | Ga0495625_0244872 | Ga0495625_0244872_18_1142 | 370 |
| 14 | 3300053154 | Ga0500619_004914 | Ga0500619_004914_10_1134 | 372 |
| 15 | 3300050491 | nmdc:mga00v17_6375_c1 | nmdc:mga00v17_6375_c1_2600_3850 | 378 |
| 16 | 3300035113 | Ga0373936_0040705 | Ga0373936_0040705_590_1825 | 380 |
| 17 | 3300005548 | Ga0070665_100055981 | Ga0070665_1000559812 | 384 |
| 18 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_66588_67877 | 386 |
| 19 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_338501_339790 | 386 |
| 20 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_289706_290995 | 386 |
| 21 | 3300005347 | Ga0070668_100009664 | Ga0070668_1000096647 | 387 |
| 22 | 3300005367 | Ga0070667_100079011 | Ga0070667_1000790112 | 387 |
| 23 | 3300005617 | Ga0068859_100158098 | Ga0068859_1001580982 | 387 |
| 24 | 3300005843 | Ga0068860_100001231 | Ga0068860_10000123113 | 387 |
| 25 | 3300005844 | Ga0068862_100004650 | Ga0068862_10000465010 | 387 |
| 26 | 3300006931 | Ga0097620_100158103 | Ga0097620_1001581032 | 387 |
| 27 | 3300028380 | Ga0268265_10003284 | Ga0268265_1000328411 | 387 |
| 28 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046180 | 387 |
| 29 | 3300048915 | Ga0496112_0039818 | Ga0496112_0039818_2515_3810 | 387 |
| 30 | 3300005719 | Ga0068861_100141472 | Ga0068861_1001414722 | 389 |
| 31 | 3300009093 | Ga0105240_10004218 | Ga0105240_1000421813 | 389 |
| 32 | 3300025913 | Ga0207695_10013177 | Ga0207695_1001317710 | 389 |
| 33 | 3300028786 | Ga0307517_10027435 | Ga0307517_100274352 | 389 |
| 34 | 3300031456 | Ga0307513_10004825 | Ga0307513_100048253 | 389 |
| 35 | 3300047320 | Ga0495672_0055358 | Ga0495672_0055358_375_1610 | 389 |
| 36 | 3300047472 | Ga0495686_0059714 | Ga0495686_0059714_178_1473 | 389 |
| 37 | 3300046512 | Ga0495610_0046297 | Ga0495610_0046297_313_1590 | 391 |
| 38 | 3300005618 | Ga0068864_100000363 | Ga0068864_10000036323 | 392 |
| 39 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007211 | 392 |
| 40 | 3300005842 | Ga0068858_100000853 | Ga0068858_1000008532 | 392 |
| 41 | 3300014968 | Ga0157379_10063600 | Ga0157379_100636003 | 392 |
| 42 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003837 | 392 |
| 43 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001298 | 392 |
| 44 | 3300026095 | Ga0207676_10000179 | Ga0207676_1000017919 | 392 |
| 45 | 3300006042 | Ga0075368_10000828 | Ga0075368_100008289 | 393 |
| 46 | 3300006178 | Ga0075367_10004477 | Ga0075367_100044774 | 393 |
| 47 | 3300006195 | Ga0075366_10055451 | Ga0075366_100554512 | 393 |
| 48 | 3300033180 | Ga0307510_10057077 | Ga0307510_100570772 | 393 |
| 49 | 3300050493 | nmdc:mga0k408_84344_c1 | nmdc:mga0k408_84344_c1_245_1540 | 393 |
| 50 | 3300050494 | nmdc:mga06z11_22383_c1 | nmdc:mga06z11_22383_c1_654_1949 | 393 |
| 51 | 3300050496 | nmdc:mga07m45_187_c1 | nmdc:mga07m45_187_c1_13102_14397 | 393 |
| 52 | 3300005347 | Ga0070668_100062447 | Ga0070668_1000624473 | 394 |
| 53 | 3300005367 | Ga0070667_100002986 | Ga0070667_1000029869 | 394 |
| 54 | 3300005548 | Ga0070665_100000883 | Ga0070665_10000088318 | 394 |
| 55 | 3300005844 | Ga0068862_100039459 | Ga0068862_1000394592 | 394 |
| 56 | 3300025972 | Ga0207668_10000028 | Ga0207668_10000028124 | 394 |
| 57 | 3300025986 | Ga0207658_10002378 | Ga0207658_100023789 | 394 |
| 58 | 3300028379 | Ga0268266_10003430 | Ga0268266_100034301 | 394 |
| 59 | 3300039437 | Ga0436365_0707086 | Ga0436365_0707086_2225_3511 | 394 |
| 60 | 3300046507 | Ga0495606_0034886 | Ga0495606_0034886_746_2020 | 394 |
| 61 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003718 | 395 |
| 62 | 3300005335 | Ga0070666_10004507 | Ga0070666_100045079 | 395 |
| 63 | 3300005347 | Ga0070668_100001202 | Ga0070668_10000120216 | 395 |
| 64 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008318 | 395 |
| 65 | 3300005548 | Ga0070665_100001867 | Ga0070665_10000186719 | 395 |
| 66 | 3300005618 | Ga0068864_100000116 | Ga0068864_10000011648 | 395 |
| 67 | 3300005841 | Ga0068863_100000512 | Ga0068863_1000005129 | 395 |
| 68 | 3300005842 | Ga0068858_100012285 | Ga0068858_10001228510 | 395 |
| 69 | 3300005843 | Ga0068860_100000348 | Ga0068860_10000034842 | 395 |
| 70 | 3300005844 | Ga0068862_100000235 | Ga0068862_10000023547 | 395 |
| 71 | 3300009101 | Ga0105247_10034840 | Ga0105247_100348403 | 395 |
| 72 | 3300009177 | Ga0105248_10015678 | Ga0105248_100156785 | 395 |
| 73 | 3300009553 | Ga0105249_10042807 | Ga0105249_100428071 | 395 |
| 74 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006271 | 395 |
| 75 | 3300025941 | Ga0207711_10019042 | Ga0207711_100190423 | 395 |
| 76 | 3300025961 | Ga0207712_10020958 | Ga0207712_100209585 | 395 |
| 77 | 3300025972 | Ga0207668_10000130 | Ga0207668_100001306 | 395 |
| 78 | 3300025986 | Ga0207658_10000218 | Ga0207658_1000021834 | 395 |
| 79 | 3300026035 | Ga0207703_10001849 | Ga0207703_100018492 | 395 |
| 80 | 3300026088 | Ga0207641_10009593 | Ga0207641_100095932 | 395 |
| 81 | 3300028379 | Ga0268266_10021826 | Ga0268266_100218263 | 395 |
| 82 | 3300028380 | Ga0268265_10000600 | Ga0268265_1000060023 | 395 |
| 83 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059290 | 395 |
| 84 | 3300049823 | Ga0501044_0298055 | Ga0501044_0298055_115_1425 | 395 |
| 85 | 3300009177 | Ga0105248_10000438 | Ga0105248_1000043817 | 396 |
| 86 | 3300025941 | Ga0207711_10000962 | Ga0207711_100009622 | 396 |
| 87 | 3300009551 | Ga0105238_10023041 | Ga0105238_100230412 | 397 |
| 88 | 3300009553 | Ga0105249_10460478 | Ga0105249_104604781 | 397 |
| 89 | 3300010375 | Ga0105239_10417455 | Ga0105239_104174551 | 397 |
| 90 | 3300013306 | Ga0163162_10052599 | Ga0163162_100525994 | 397 |
| 91 | 3300013307 | Ga0157372_10247133 | Ga0157372_102471332 | 397 |
| 92 | 3300014325 | Ga0163163_10033553 | Ga0163163_100335535 | 397 |
| 93 | 3300014968 | Ga0157379_10005938 | Ga0157379_1000593810 | 397 |
| 94 | 3300039447 | Ga0436361_1160523 | Ga0436361_1160523_418_1683 | 397 |
| 95 | 3300046499 | Ga0495594_0009555 | Ga0495594_0009555_2443_3678 | 397 |
| 96 | 3300048912 | Ga0496109_0034156 | Ga0496109_0034156_828_2063 | 397 |
| 97 | 3300048915 | Ga0496112_0033630 | Ga0496112_0033630_516_1751 | 397 |
| 98 | 3300049581 | Ga0501047_0020852 | Ga0501047_0020852_2655_3890 | 397 |
| 99 | 3300053096 | Ga0500641_0008067 | Ga0500641_0008067_1589_2824 | 397 |
| 100 | 3300005262 | Ga0065165_1000845 | Ga0065165_100084511 | 398 |
| 101 | 3300025295 | Ga0209564_1003150 | Ga0209564_100315010 | 398 |
| 102 | 3300037418 | Ga0395900_0102045 | Ga0395900_0102045_102_1391 | 398 |
| 103 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_242866_244149 | 398 |
| 104 | 3300050493 | nmdc:mga0k408_29158_c1 | nmdc:mga0k408_29158_c1_1061_2335 | 398 |
| 105 | 3300046810 | Ga0495660_0027967 | Ga0495660_0027967_1460_2734 | 399 |
| 106 | 3300053087 | Ga0500643_015299 | Ga0500643_015299_67_1341 | 399 |
| 107 | 3300003781 | Ga0055536_1002051 | Ga0055536_10020512 | 400 |
| 108 | 3300003791 | Ga0055530_10001148 | Ga0055530_100011489 | 400 |
| 109 | 3300025292 | Ga0209676_1000409 | Ga0209676_100040918 | 400 |
| 110 | 3300025298 | Ga0209050_1003251 | Ga0209050_10032512 | 400 |
| 111 | 3300025303 | Ga0209051_1000338 | Ga0209051_100033857 | 400 |
| 112 | 3300025304 | Ga0209257_1004143 | Ga0209257_10041432 | 400 |
| 113 | 3300046660 | Ga0495625_0002350 | Ga0495625_0002350_1114_2388 | 400 |
| 114 | 3300038443 | Ga0395901_0249413 | Ga0395901_0249413_79_1386 | 401 |
| 115 | 3300039437 | Ga0436365_0742244 | Ga0436365_0742244_478_1773 | 401 |
| 116 | 3300046453 | Ga0495627_001337 | Ga0495627_001337_1621_2898 | 401 |
| 117 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_130999_132273 | 401 |
| 118 | 3300046506 | Ga0495583_0000020 | Ga0495583_0000020_133147_134421 | 401 |
| 119 | 3300046524 | Ga0495648_0046587 | Ga0495648_0046587_24_1298 | 401 |
| 120 | 3300046530 | Ga0495654_0000216 | Ga0495654_0000216_3688_4962 | 401 |
| 121 | 3300046616 | Ga0495668_0006335 | Ga0495668_0006335_4252_5526 | 401 |
| 122 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_189502_190779 | 401 |
| 123 | 3300053125 | Ga0500618_000112 | Ga0500618_000112_20250_21524 | 401 |
| 124 | 3300053136 | Ga0500559_0000111 | Ga0500559_0000111_36037_37311 | 401 |
| 125 | 3300053142 | Ga0500577_0001570 | Ga0500577_0001570_3994_5271 | 401 |
| 126 | 3300006881 | Ga0068865_100004105 | Ga0068865_1000041055 | 402 |
| 127 | 3300025298 | Ga0209050_1021363 | Ga0209050_10213632 | 402 |
| 128 | 3300025299 | Ga0209256_1003700 | Ga0209256_10037002 | 402 |
| 129 | 3300046459 | Ga0495629_0025567 | Ga0495629_0025567_741_2051 | 402 |
| 130 | 3300046460 | Ga0495638_0001694 | Ga0495638_0001694_7955_9229 | 402 |
| 131 | 3300046460 | Ga0495638_0035473 | Ga0495638_0035473_146_1420 | 402 |
| 132 | 3300046501 | Ga0495607_0034406 | Ga0495607_0034406_535_1809 | 402 |
| 133 | 3300046513 | Ga0495616_0001591 | Ga0495616_0001591_10898_12172 | 402 |
| 134 | 3300046524 | Ga0495648_0044027 | Ga0495648_0044027_952_2226 | 402 |
| 135 | 3300046530 | Ga0495654_0080498 | Ga0495654_0080498_47_1321 | 402 |
| 136 | 3300046538 | Ga0495609_0009915 | Ga0495609_0009915_1123_2433 | 402 |
| 137 | 3300046542 | Ga0495597_0000930 | Ga0495597_0000930_13399_14709 | 402 |
| 138 | 3300046557 | Ga0495622_0001609 | Ga0495622_0001609_2976_4286 | 402 |
| 139 | 3300047469 | Ga0495673_0005884 | Ga0495673_0005884_4126_5400 | 402 |
| 140 | 3300047673 | Ga0495593_0048502 | Ga0495593_0048502_800_2110 | 402 |
| 141 | 3300048905 | Ga0496102_0119343 | Ga0496102_0119343_911_2221 | 402 |
| 142 | 3300048910 | Ga0496107_0001524 | Ga0496107_0001524_6581_7855 | 402 |
| 143 | 3300048921 | Ga0496118_0010326 | Ga0496118_0010326_7514_8824 | 402 |
| 144 | 3300048922 | Ga0496119_0018966 | Ga0496119_0018966_2118_3428 | 402 |
| 145 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_688912_690222 | 402 |
| 146 | 3300048924 | Ga0496121_0001613 | Ga0496121_0001613_3988_5262 | 402 |
| 147 | 3300053080 | Ga0500635_0000775 | Ga0500635_0000775_2892_4202 | 402 |
| 148 | 3300053119 | Ga0500595_002803 | Ga0500595_002803_6304_7614 | 402 |
| 149 | 3300053122 | Ga0500608_048249 | Ga0500608_048249_458_1768 | 402 |
| 150 | 3300053136 | Ga0500559_0006497 | Ga0500559_0006497_1138_2448 | 402 |
| 151 | 3300053148 | Ga0500590_009133 | Ga0500590_009133_2246_3556 | 402 |
| 152 | 3300053163 | Ga0500639_054137 | Ga0500639_054137_29_1339 | 402 |
| 153 | 3300053178 | Ga0500637_0013338 | Ga0500637_0013338_1121_2431 | 402 |
| 154 | 3300053735 | Ga0500596_000346 | Ga0500596_000346_5600_6910 | 402 |
| 155 | 3300003794 | Ga0055531_10001482 | Ga0055531_100014828 | 403 |
| 156 | 3300025304 | Ga0209257_1000386 | Ga0209257_100038623 | 403 |
| 157 | 3300026121 | Ga0207683_10276874 | Ga0207683_102768741 | 403 |
| 158 | 3300048918 | Ga0496115_0000794 | Ga0496115_0000794_15763_17049 | 403 |
| 159 | 3300053103 | Ga0500555_004969 | Ga0500555_004969_1902_3212 | 403 |
| 160 | 3300005458 | Ga0070681_10034711 | Ga0070681_100347113 | 405 |
| 161 | 3300005616 | Ga0068852_100016843 | Ga0068852_1000168432 | 405 |
| 162 | 3300025909 | Ga0207705_10165315 | Ga0207705_101653152 | 405 |
| 163 | 3300025912 | Ga0207707_10050393 | Ga0207707_100503932 | 405 |
| 164 | 3300026142 | Ga0207698_10256320 | Ga0207698_102563202 | 405 |
| 165 | 3300037471 | Ga0395905_0025918 | Ga0395905_0025918_1765_3081 | 405 |
| 166 | iso_pu_bacteria | 2582581280 | 2585153108 | 406 |
| 167 | iso_pu_bacteria | 2582581293 | 2585196670 | 406 |
| 168 | iso_pu_bacteria | 2643221545 | 2643751426 | 406 |
| 169 | iso_pu_bacteria | 2643221552 | 2643778216 | 406 |
| 170 | iso_pu_bacteria | 2643221584 | 2643928405 | 406 |
| 171 | iso_pu_bacteria | 2643221691 | 2644510521 | 406 |
| 172 | iso_pu_bacteria | 2818991435 | 2819536591 | 406 |
| 173 | iso_pu_bacteria | 2818991454 | 2819645752 | 406 |
| 174 | 3300009174 | Ga0105241_10043386 | Ga0105241_100433864 | 407 |
| 175 | 3300031711 | Ga0265314_10129450 | Ga0265314_101294502 | 407 |
| 176 | 3300053096 | Ga0500641_0000432 | Ga0500641_0000432_13259_14527 | 407 |
| 177 | 3300053108 | Ga0500562_002063 | Ga0500562_002063_3562_4830 | 407 |
| 178 | 3300053156 | Ga0500622_0006535 | Ga0500622_0006535_964_2232 | 407 |
| 179 | 3300053730 | Ga0500645_001393 | Ga0500645_001393_1541_2809 | 407 |
| 180 | iso_pu_bacteria | 2510917020 | 2511125399 | 407 |
| 181 | iso_pu_bacteria | 2582581279 | 2585148518 | 407 |
| 182 | iso_pu_bacteria | 2585428106 | 2587916713 | 407 |
| 183 | iso_pu_bacteria | 2643221583 | 2643923498 | 407 |
| 184 | iso_pu_bacteria | 2643221614 | 2644084966 | 407 |
| 185 | iso_pu_bacteria | 2643221640 | 2644225755 | 407 |
| 186 | iso_pu_bacteria | 2643221642 | 2644235244 | 407 |
| 187 | iso_pu_bacteria | 2643221661 | 2644342518 | 407 |
| 188 | iso_pu_bacteria | 2643221666 | 2644365818 | 407 |
| 189 | iso_pu_bacteria | 2857504554 | 2857506356 | 407 |
| 190 | iso_pu_bacteria | 2928531327 | 2928535379 | 407 |
| 191 | 3300028800 | Ga0265338_10016622 | Ga0265338_100166222 | 408 |
| 192 | 3300005347 | Ga0070668_100082846 | Ga0070668_1000828462 | 409 |
| 193 | 3300005617 | Ga0068859_100141049 | Ga0068859_1001410492 | 409 |
| 194 | 3300005719 | Ga0068861_100027997 | Ga0068861_1000279972 | 409 |
| 195 | 3300005843 | Ga0068860_100210822 | Ga0068860_1002108222 | 409 |
| 196 | 3300006931 | Ga0097620_100141043 | Ga0097620_1001410432 | 409 |
| 197 | 3300025304 | Ga0209257_1004190 | Ga0209257_10041905 | 409 |
| 198 | 3300025986 | Ga0207658_10057742 | Ga0207658_100577423 | 409 |
| 199 | 3300026118 | Ga0207675_100038104 | Ga0207675_1000381046 | 409 |
| 200 | 3300028380 | Ga0268265_10026073 | Ga0268265_100260736 | 409 |
| 201 | 3300046684 | Ga0495669_0000234 | Ga0495669_0000234_16955_18238 | 409 |
| 202 | 3300049570 | Ga0501033_0002053 | Ga0501033_0002053_8185_9462 | 409 |
| 203 | 3300049571 | Ga0501034_0049237 | Ga0501034_0049237_1813_3090 | 409 |
| 204 | 3300049573 | Ga0501037_0038854 | Ga0501037_0038854_1775_3052 | 409 |
| 205 | 3300049823 | Ga0501044_0010562 | Ga0501044_0010562_7558_8835 | 409 |
| 206 | 3300049823 | Ga0501044_0032519 | Ga0501044_0032519_2596_3885 | 409 |
| 207 | 3300003773 | Ga0055537_1003960 | Ga0055537_10039604 | 410 |
| 208 | 3300003775 | Ga0055524_1005354 | Ga0055524_10053542 | 410 |
| 209 | 3300003781 | Ga0055536_1002072 | Ga0055536_10020722 | 410 |
| 210 | 3300003790 | Ga0055528_1007921 | Ga0055528_10079212 | 410 |
| 211 | 3300003791 | Ga0055530_10000647 | Ga0055530_1000064711 | 410 |
| 212 | 3300003791 | Ga0055530_10002587 | Ga0055530_100025879 | 410 |
| 213 | 3300003794 | Ga0055531_10002532 | Ga0055531_100025322 | 410 |
| 214 | 3300004625 | Ga0055543_1007538 | Ga0055543_10075382 | 410 |
| 215 | 3300005262 | Ga0065165_1000552 | Ga0065165_100055246 | 410 |
| 216 | 3300005262 | Ga0065165_1010534 | Ga0065165_10105343 | 410 |
| 217 | 3300005327 | Ga0070658_10046806 | Ga0070658_100468062 | 410 |
| 218 | 3300005331 | Ga0070670_100052858 | Ga0070670_1000528583 | 410 |
| 219 | 3300005335 | Ga0070666_10046554 | Ga0070666_100465544 | 410 |
| 220 | 3300005336 | Ga0070680_100018622 | Ga0070680_1000186224 | 410 |
| 221 | 3300005339 | Ga0070660_100009396 | Ga0070660_1000093965 | 410 |
| 222 | 3300005339 | Ga0070660_100024858 | Ga0070660_1000248581 | 410 |
| 223 | 3300005347 | Ga0070668_100014227 | Ga0070668_1000142274 | 410 |
| 224 | 3300005353 | Ga0070669_100008486 | Ga0070669_1000084868 | 410 |
| 225 | 3300005355 | Ga0070671_100047065 | Ga0070671_1000470651 | 410 |
| 226 | 3300005355 | Ga0070671_100131714 | Ga0070671_1001317142 | 410 |
| 227 | 3300005366 | Ga0070659_100000882 | Ga0070659_10000088210 | 410 |
| 228 | 3300005366 | Ga0070659_100002791 | Ga0070659_1000027913 | 410 |
| 229 | 3300005367 | Ga0070667_100025765 | Ga0070667_1000257652 | 410 |
| 230 | 3300005457 | Ga0070662_100118917 | Ga0070662_1001189172 | 410 |
| 231 | 3300005458 | Ga0070681_10072427 | Ga0070681_100724273 | 410 |
| 232 | 3300005530 | Ga0070679_100014519 | Ga0070679_1000145195 | 410 |
| 233 | 3300005539 | Ga0068853_100073801 | Ga0068853_1000738012 | 410 |
| 234 | 3300005548 | Ga0070665_100000116 | Ga0070665_100000116111 | 410 |
| 235 | 3300005563 | Ga0068855_100042748 | Ga0068855_1000427483 | 410 |
| 236 | 3300005564 | Ga0070664_100101027 | Ga0070664_1001010272 | 410 |
| 237 | 3300005617 | Ga0068859_100001659 | Ga0068859_10000165911 | 410 |
| 238 | 3300005841 | Ga0068863_100002761 | Ga0068863_10000276115 | 410 |
| 239 | 3300005842 | Ga0068858_100003765 | Ga0068858_10000376514 | 410 |
| 240 | 3300005843 | Ga0068860_100026449 | Ga0068860_1000264494 | 410 |
| 241 | 3300006048 | Ga0075363_100100307 | Ga0075363_1001003072 | 410 |
| 242 | 3300006186 | Ga0075369_10041872 | Ga0075369_100418721 | 410 |
| 243 | 3300006195 | Ga0075366_10004488 | Ga0075366_100044886 | 410 |
| 244 | 3300006931 | Ga0097620_100001659 | Ga0097620_10000165913 | 410 |
| 245 | 3300009093 | Ga0105240_10035333 | Ga0105240_100353333 | 410 |
| 246 | 3300009551 | Ga0105238_10025279 | Ga0105238_100252794 | 410 |
| 247 | 3300025250 | Ga0209026_1000925 | Ga0209026_100092512 | 410 |
| 248 | 3300025263 | Ga0209565_1000332 | Ga0209565_100033229 | 410 |
| 249 | 3300025273 | Ga0209673_1000523 | Ga0209673_100052310 | 410 |
| 250 | 3300025292 | Ga0209676_1000327 | Ga0209676_100032735 | 410 |
| 251 | 3300025295 | Ga0209564_1020702 | Ga0209564_10207022 | 410 |
| 252 | 3300025297 | Ga0209758_1007327 | Ga0209758_10073276 | 410 |
| 253 | 3300025297 | Ga0209758_1012854 | Ga0209758_10128544 | 410 |
| 254 | 3300025298 | Ga0209050_1000101 | Ga0209050_1000101172 | 410 |
| 255 | 3300025298 | Ga0209050_1001254 | Ga0209050_10012542 | 410 |
| 256 | 3300025299 | Ga0209256_1019981 | Ga0209256_10199812 | 410 |
| 257 | 3300025304 | Ga0209257_1000220 | Ga0209257_100022024 | 410 |
| 258 | 3300025304 | Ga0209257_1001334 | Ga0209257_100133427 | 410 |
| 259 | 3300025903 | Ga0207680_10078737 | Ga0207680_100787372 | 410 |
| 260 | 3300025903 | Ga0207680_10124927 | Ga0207680_101249272 | 410 |
| 261 | 3300025913 | Ga0207695_10036359 | Ga0207695_100363593 | 410 |
| 262 | 3300025917 | Ga0207660_10014801 | Ga0207660_100148015 | 410 |
| 263 | 3300025919 | Ga0207657_10001137 | Ga0207657_1000113715 | 410 |
| 264 | 3300025919 | Ga0207657_10069638 | Ga0207657_100696382 | 410 |
| 265 | 3300025923 | Ga0207681_10050897 | Ga0207681_100508972 | 410 |
| 266 | 3300025925 | Ga0207650_10046935 | Ga0207650_100469352 | 410 |
| 267 | 3300025931 | Ga0207644_10005911 | Ga0207644_100059115 | 410 |
| 268 | 3300025932 | Ga0207690_10000053 | Ga0207690_1000005398 | 410 |
| 269 | 3300025932 | Ga0207690_10030130 | Ga0207690_100301302 | 410 |
| 270 | 3300025933 | Ga0207706_10100532 | Ga0207706_101005323 | 410 |
| 271 | 3300025941 | Ga0207711_10004232 | Ga0207711_100042329 | 410 |
| 272 | 3300025945 | Ga0207679_10083003 | Ga0207679_100830032 | 410 |
| 273 | 3300025949 | Ga0207667_10191117 | Ga0207667_101911172 | 410 |
| 274 | 3300025972 | Ga0207668_10006139 | Ga0207668_100061395 | 410 |
| 275 | 3300025986 | Ga0207658_10004629 | Ga0207658_100046292 | 410 |
| 276 | 3300026035 | Ga0207703_10005735 | Ga0207703_1000573510 | 410 |
| 277 | 3300026088 | Ga0207641_10005569 | Ga0207641_1000556911 | 410 |
| 278 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064217 | 410 |
| 279 | 3300028786 | Ga0307517_10006007 | Ga0307517_100060075 | 410 |
| 280 | 3300028794 | Ga0307515_10074813 | Ga0307515_100748134 | 410 |
| 281 | 3300030521 | Ga0307511_10091735 | Ga0307511_100917352 | 410 |
| 282 | 3300031251 | Ga0265327_10003424 | Ga0265327_100034248 | 410 |
| 283 | 3300031456 | Ga0307513_10000261 | Ga0307513_100002616 | 410 |
| 284 | 3300031456 | Ga0307513_10025085 | Ga0307513_100250853 | 410 |
| 285 | 3300031730 | Ga0307516_10000352 | Ga0307516_1000035257 | 410 |
| 286 | 3300035695 | Ga0373927_0000526 | Ga0373927_0000526_7893_9188 | 410 |
| 287 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_48006_49301 | 410 |
| 288 | 3300037418 | Ga0395900_0075282 | Ga0395900_0075282_745_2055 | 410 |
| 289 | 3300037471 | Ga0395905_0067606 | Ga0395905_0067606_1015_2325 | 410 |
| 290 | 3300046457 | Ga0495590_0000792 | Ga0495590_0000792_8808_10088 | 410 |
| 291 | 3300046460 | Ga0495638_0001417 | Ga0495638_0001417_12761_14041 | 410 |
| 292 | 3300046460 | Ga0495638_0008423 | Ga0495638_0008423_3655_4929 | 410 |
| 293 | 3300046460 | Ga0495638_0048791 | Ga0495638_0048791_16_1296 | 410 |
| 294 | 3300046471 | Ga0495650_0021143 | Ga0495650_0021143_964_2244 | 410 |
| 295 | 3300046512 | Ga0495610_0000908 | Ga0495610_0000908_16793_18067 | 410 |
| 296 | 3300046512 | Ga0495610_0003965 | Ga0495610_0003965_2648_3928 | 410 |
| 297 | 3300046520 | Ga0495637_0013320 | Ga0495637_0013320_1710_2990 | 410 |
| 298 | 3300046524 | Ga0495648_0000948 | Ga0495648_0000948_18802_20082 | 410 |
| 299 | 3300046616 | Ga0495668_0027740 | Ga0495668_0027740_844_2124 | 410 |
| 300 | 3300046660 | Ga0495625_0005019 | Ga0495625_0005019_10111_11385 | 410 |
| 301 | 3300046660 | Ga0495625_0031712 | Ga0495625_0031712_548_1828 | 410 |
| 302 | 3300047320 | Ga0495672_0003460 | Ga0495672_0003460_2949_4223 | 410 |
| 303 | 3300047469 | Ga0495673_0000401 | Ga0495673_0000401_13450_14730 | 410 |
| 304 | 3300047472 | Ga0495686_0003214 | Ga0495686_0003214_9762_11042 | 410 |
| 305 | 3300047472 | Ga0495686_0022496 | Ga0495686_0022496_123_1403 | 410 |
| 306 | 3300048918 | Ga0496115_0021393 | Ga0496115_0021393_2926_4200 | 410 |
| 307 | 3300048918 | Ga0496115_0029865 | Ga0496115_0029865_927_2252 | 410 |
| 308 | 3300048927 | Ga0496124_0006812 | Ga0496124_0006812_8539_9819 | 410 |
| 309 | 3300048928 | Ga0496125_0050636 | Ga0496125_0050636_984_2285 | 410 |
| 310 | 3300048929 | Ga0496126_0001877 | Ga0496126_0001877_29172_30452 | 410 |
| 311 | 3300049459 | Ga0495678_001720 | Ga0495678_001720_9754_11034 | 410 |
| 312 | 3300050493 | nmdc:mga0k408_21766_c1 | nmdc:mga0k408_21766_c1_514_1794 | 410 |
| 313 | 3300053086 | Ga0500578_0000420 | Ga0500578_0000420_22577_23857 | 410 |
| 314 | 3300053088 | Ga0500644_0000274 | Ga0500644_0000274_17981_19261 | 410 |
| 315 | 3300053104 | Ga0500556_0000587 | Ga0500556_0000587_13891_15165 | 410 |
| 316 | 3300053104 | Ga0500556_0002730 | Ga0500556_0002730_686_1993 | 410 |
| 317 | 3300053108 | Ga0500562_010322 | Ga0500562_010322_507_1802 | 410 |
| 318 | 3300053118 | Ga0500594_0000135 | Ga0500594_0000135_6767_8047 | 410 |
| 319 | 3300053122 | Ga0500608_000080 | Ga0500608_000080_29959_31239 | 410 |
| 320 | 3300053136 | Ga0500559_0023754 | Ga0500559_0023754_576_1856 | 410 |
| 321 | 3300053138 | Ga0500564_000021 | Ga0500564_000021_36183_37463 | 410 |
| 322 | 3300053156 | Ga0500622_0000526 | Ga0500622_0000526_23944_25224 | 410 |
| 323 | 3300053156 | Ga0500622_0005215 | Ga0500622_0005215_1168_2448 | 410 |
| 324 | 3300053730 | Ga0500645_004105 | Ga0500645_004105_170_1465 | 410 |
| 325 | 3300053730 | Ga0500645_010976 | Ga0500645_010976_13_1287 | 410 |
| 326 | iso_pu_bacteria | 2643221598 | 2644000270 | 410 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8764 | 45 | 250 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8606 | 45 | 251 |
| 5udf-assembly1.cif.gz_C | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8567 | 45 | 251 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8454 | 45 | 251 |
| 7w7c-assembly1.cif.gz_B-2 | heme exporter in the unliganded form | 0.8443 | 264 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0J314_1_71_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7376 | 56 | 86 | 3.30.70.100 |
| af_P9WJP9_660_771_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5538 | 139 | 210 | 2.40.40.20 |
| 1cz5A01 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5156 | 135 | 224 | 2.40.40.20 |
| af_A0A1D6JR45_49_209_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5103 | 279 | 408 | 1.10.1760.20 |
| af_A0A144A3W0_47_229_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.5051 | 155 | 189 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5KER4-F1-model_v4 | FtsX-like permease family protein | 0.9507 | 262 | 410 |
GO:0044874
GO:0098797 |
| AF-A0A7V7FKS1-F1-model_v4 | FtsX-like permease family protein | 0.9492 | 237 | 410 |
GO:0044874
GO:0098797 |
| AF-A0A2D5LV36-F1-model_v4 | Transporter | 0.9477 | 270 | 410 |
GO:0044874
GO:0098797 |
| AF-A0A1V5L664-F1-model_v4 | Lipoprotein-releasing system transmembrane protein LolE | 0.947 | 90 | 410 |
GO:0044874
GO:0098797 |
| AF-A0A3E0QA95-F1-model_v4 | Lipoprotein-releasing system transmembrane subunit LolC | 0.9459 | 221 | 410 |
GO:0044874
GO:0098797 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar