F408499

General Info

Members Datasets Scaffolds Average Seq Length
326 192 652 86

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0589385|Ga0496102_0589385_101_421
Length 106
Sequence LEANPTGRPGERQPRDLDLSGRKLAWTEEGWDDYLYWQTQDRKTLKRINTLIEDILRDDPFEGIGKPEALKHALAGAWSRRIDEANRLVYIADDKYVTILQARYHY

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
65 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
69 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
70 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
71 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
187 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
188 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 3.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.67
Nodule 0
Rhizoplane 6.75
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0589385 3300048905 Bacteria 1035
2 JGI25406J46586_10039677 3300003203 Bacteria 1675
3 JGI25406J46586_10054886 3300003203 Bacteria 1315
4 JGI25406J46586_10139400 3300003203 Bacteria 710
5 Ga0070658_10043023 3300005327 Bacteria 3649
6 Ga0070658_10053384 3300005327 Bacteria 3280
7 Ga0070658_10324749 3300005327 Bacteria 1314
8 Ga0070666_10142906 3300005335 Bacteria 1667
9 Ga0068868_100840114 3300005338 Bacteria 831
10 Ga0070660_101793538 3300005339 Bacteria 523
11 Ga0070714_100202637 3300005435 Bacteria 1816
12 Ga0068855_100219121 3300005563 Bacteria 2135
13 Ga0068855_100467087 3300005563 Bacteria 1375
14 Ga0068863_100964318 3300005841 Bacteria 855
15 Ga0081539_10001737 3300005985 Bacteria 34812
16 Ga0081539_10001779 3300005985 Bacteria 34270
17 Ga0081539_10208946 3300005985 Bacteria 896
18 Ga0070717_10096107 3300006028 Bacteria 2509
19 Ga0075368_10023597 3300006042 Bacteria 2351
20 Ga0075363_100221275 3300006048 Bacteria 1085
21 Ga0075364_10234706 3300006051 Bacteria 1246
22 Ga0075364_10246803 3300006051 Bacteria 1213
23 Ga0075367_10022949 3300006178 Bacteria 3506
24 Ga0075367_10376975 3300006178 Unclassified 896
25 Ga0075369_10155434 3300006186 Bacteria 1047
26 Ga0075369_10290966 3300006186 Bacteria 762
27 Ga0075370_10262042 3300006353 Bacteria 1025
28 Ga0105247_10002257 3300009101 Bacteria 13249
29 Ga0105247_10098513 3300009101 Bacteria 1866
30 Ga0105248_10000731 3300009177 Bacteria 36959
31 Ga0105246_10595365 3300011119 Bacteria 954
32 Ga0157327_1006441 3300012512 Bacteria 989
33 Ga0157370_10060978 3300013104 Bacteria 3580
34 Ga0157374_10838404 3300013296 Bacteria 936
35 Ga0157378_12086389 3300013297 Bacteria 617
36 Ga0157372_10836596 3300013307 Bacteria 1069
37 Ga0163163_11421039 3300014325 Bacteria 755
38 Ga0157379_10005347 3300014968 Bacteria 11034
39 Ga0206349_1205852 3300020075 Bacteria 916
40 Ga0206355_1407327 3300020076 Bacteria 661
41 Ga0206355_1476726 3300020076 Bacteria 534
42 Ga0209437_107299 3300025233 Bacteria 1805
43 Ga0207680_10122136 3300025903 Bacteria 1705
44 Ga0207705_10544080 3300025909 Bacteria 902
45 Ga0207664_10142902 3300025929 Bacteria 2026
46 Ga0207661_10189996 3300025944 Bacteria 1800
47 Ga0207667_10135589 3300025949 Bacteria 2535
48 Ga0207667_11090135 3300025949 Unclassified 782
49 Ga0207703_10000013 3300026035 Bacteria 305126
50 Ga0209813_10144582 3300027866 Bacteria 847
51 Ga0307515_10093704 3300028794 Bacteria 3720
52 Ga0265324_10184908 3300029957 Bacteria 708
53 Ga0307408_102180815 3300031548 Bacteria 535
54 Ga0307508_10029506 3300031616 Bacteria 4958
55 Ga0307508_10039481 3300031616 Bacteria 4241
56 Ga0316576_10402281 3300031727 Bacteria 1014
57 Ga0316578_10229802 3300031728 Bacteria 1114
58 Ga0307516_10027049 3300031730 Bacteria 5821
59 Ga0307516_10591907 3300031730 Bacteria 763
60 Ga0307405_10671538 3300031731 Bacteria 855
61 Ga0316577_10511701 3300031733 Bacteria 682
62 Ga0307410_12098526 3300031852 Bacteria 505
63 Ga0326468_10000187 3300031889 Bacteria 6294
64 Ga0307406_12051881 3300031901 Unclassified 512
65 Ga0307409_101308118 3300031995 Bacteria 750
66 Ga0307416_100962213 3300032002 Bacteria 956
67 Ga0307414_10745618 3300032004 Bacteria 890
68 Ga0307411_10822598 3300032005 Bacteria 820
69 Ga0316588_1047259 3300033528 Bacteria 1039
70 Ga0316596_1090901 3300033541 Bacteria 823
71 Ga0373924_0019139 3300035410 Bacteria 2649
72 Ga0373937_2010901 3300036401 Unclassified 524
73 Ga0316582_0646870 3300036647 Unclassified 727
74 Ga0316582_0713666 3300036647 Unclassified 688
75 Ga0395899_0009986 3300037312 Bacteria 7281
76 Ga0395899_0089877 3300037312 Bacteria 2227
77 Ga0395899_0247653 3300037312 Bacteria 1224
78 Ga0395899_0248643 3300037312 Bacteria 1221
79 Ga0395900_0037483 3300037418 Bacteria 4998
80 Ga0395900_0199645 3300037418 Bacteria 2024
81 Ga0395900_0249548 3300037418 Bacteria 1776
82 Ga0395900_0438102 3300037418 Bacteria 1265
83 Ga0395900_0480225 3300037418 Bacteria 1195
84 Ga0395900_0708743 3300037418 Bacteria 939
85 Ga0395898_0010414 3300037466 Bacteria 9722
86 Ga0395898_0374703 3300037466 Bacteria 1357
87 Ga0395898_0635038 3300037466 Bacteria 1010
88 Ga0395905_0011770 3300037471 Bacteria 8445
89 Ga0395905_0029478 3300037471 Bacteria 5170
90 Ga0395901_0017533 3300038443 Bacteria 7309
91 Ga0395901_0024359 3300038443 Bacteria 6210
92 Ga0395901_0155193 3300038443 Bacteria 2404
93 Ga0395901_0348144 3300038443 Bacteria 1529
94 Ga0395901_0849628 3300038443 Bacteria 898
95 Ga0400483_043340 3300039062 Bacteria 2543
96 Ga0400483_188176 3300039062 Bacteria 2583
97 Ga0451787_149737 3300041441 Bacteria 787
98 Ga0451789_0970447 3300041443 Bacteria 1147
99 Ga0451791_0709085 3300041451 Bacteria 669
100 Ga0451793_0807282 3300041452 Bacteria 1465
101 Ga0451793_1767977 3300041452 Bacteria 787
102 Ga0451795_1309353 3300041456 Bacteria 1261
103 Ga0451833_0899603 3300041491 Bacteria 639
104 Ga0451833_1181116 3300041491 Bacteria 566
105 Ga0451841_0621121 3300041498 Bacteria 586
106 Ga0451843_1251659 3300041509 Bacteria 1443
107 Ga0450898_095951 3300042134 Bacteria 616
108 Ga0466972_0243043 3300044658 Bacteria 842
109 Ga0453683_0908971 3300044673 Bacteria 582
110 Ga0466965_0220151 3300044683 Bacteria 1011
111 Ga0466961_0441866 3300044693 Bacteria 787
112 Ga0466971_0163580 3300044719 Bacteria 1042
113 Ga0466970_0001788 3300044765 Bacteria 10359
114 Ga0466960_0318841 3300044901 Bacteria 880
115 Ga0451576_0005947 3300045051 Bacteria 15113
116 Ga0495617_258005 3300046452 Bacteria 536
117 Ga0495627_005200 3300046453 Bacteria 5290
118 Ga0495627_048239 3300046453 Bacteria 1289
119 Ga0495627_171928 3300046453 Bacteria 601
120 Ga0495603_0321211 3300046455 Bacteria 889
121 Ga0495590_0199189 3300046457 Bacteria 735
122 Ga0495638_0068012 3300046460 Bacteria 2186
123 Ga0495638_0137644 3300046460 Bacteria 1428
124 Ga0495653_0006879 3300046463 Bacteria 9346
125 Ga0495653_0068308 3300046463 Bacteria 2666
126 Ga0495650_0000181 3300046471 Bacteria 137791
127 Ga0495650_0006967 3300046471 Bacteria 6910
128 Ga0495580_0004528 3300046472 Bacteria 11673
129 Ga0495582_0058735 3300046473 Bacteria 2121
130 Ga0495582_0767197 3300046473 Bacteria 558
131 Ga0495605_0024934 3300046474 Bacteria 3122
132 Ga0495605_0035998 3300046474 Bacteria 2498
133 Ga0495605_0250941 3300046474 Bacteria 757
134 Ga0495639_0142960 3300046475 Bacteria 1151
135 Ga0495584_0000199 3300046491 Bacteria 42756
136 Ga0495584_0030459 3300046491 Bacteria 2733
137 Ga0495584_0041421 3300046491 Bacteria 2325
138 Ga0495584_0083581 3300046491 Bacteria 1607
139 Ga0495584_0154622 3300046491 Bacteria 1165
140 Ga0495584_0194858 3300046491 Bacteria 1030
141 Ga0495585_0000172 3300046492 Bacteria 69900
142 Ga0495585_0006670 3300046492 Bacteria 7131
143 Ga0495585_0008151 3300046492 Bacteria 6365
144 Ga0495585_0028801 3300046492 Bacteria 3164
145 Ga0495585_0264066 3300046492 Bacteria 855
146 Ga0495594_0370238 3300046499 Unclassified 815
147 Ga0495596_0001735 3300046500 Bacteria 12237
148 Ga0495596_0041353 3300046500 Bacteria 1817
149 Ga0495607_0127104 3300046501 Bacteria 1331
150 Ga0495607_0288995 3300046501 Bacteria 775
151 Ga0495583_0014504 3300046506 Bacteria 4345
152 Ga0495606_0005221 3300046507 Bacteria 12534
153 Ga0495606_0013971 3300046507 Bacteria 6296
154 Ga0495606_0020355 3300046507 Bacteria 4895
155 Ga0495606_0024344 3300046507 Bacteria 4365
156 Ga0495610_0000121 3300046512 Bacteria 88785
157 Ga0495616_0001563 3300046513 Bacteria 15771
158 Ga0495616_0006592 3300046513 Bacteria 7014
159 Ga0495616_0095061 3300046513 Bacteria 1405
160 Ga0495618_0743460 3300046514 Unclassified 574
161 Ga0495628_1057130 3300046516 Unclassified 556
162 Ga0495630_0017799 3300046517 Bacteria 5210
163 Ga0495631_0008057 3300046518 Bacteria 5325
164 Ga0495631_0014241 3300046518 Bacteria 3842
165 Ga0495631_0038360 3300046518 Bacteria 2130
166 Ga0495631_0217296 3300046518 Bacteria 816
167 Ga0495632_0002020 3300046519 Bacteria 15994
168 Ga0495632_0164951 3300046519 Bacteria 1019
169 Ga0495637_0018003 3300046520 Bacteria 3281
170 Ga0495643_0037691 3300046522 Bacteria 2650
171 Ga0495643_0427138 3300046522 Bacteria 580
172 Ga0495644_0007854 3300046523 Bacteria 4108
173 Ga0495644_0213347 3300046523 Bacteria 745
174 Ga0495648_0044062 3300046524 Bacteria 2788
175 Ga0495648_0056003 3300046524 Bacteria 2374
176 Ga0495663_0093087 3300046525 Bacteria 984
177 Ga0495642_0031438 3300046528 Bacteria 2128
178 Ga0495652_0002811 3300046529 Bacteria 17545
179 Ga0495665_0001187 3300046531 Bacteria 13877
180 Ga0495586_0034009 3300046535 Bacteria 2736
181 Ga0495609_0001447 3300046538 Bacteria 15768
182 Ga0495609_0001580 3300046538 Bacteria 14881
183 Ga0495609_0003833 3300046538 Bacteria 8460
184 Ga0495609_0004245 3300046538 Bacteria 7917
185 Ga0495609_0040844 3300046538 Unclassified 2086
186 Ga0495609_0272763 3300046538 Bacteria 693
187 Ga0495597_0001217 3300046542 Bacteria 19150
188 Ga0495597_0041486 3300046542 Bacteria 2055
189 Ga0495597_0194590 3300046542 Bacteria 814
190 Ga0495633_0006079 3300046558 Bacteria 7236
191 Ga0495633_0007365 3300046558 Bacteria 6339
192 Ga0495633_0052729 3300046558 Bacteria 1915
193 Ga0495633_0090554 3300046558 Bacteria 1422
194 Ga0495633_0159879 3300046558 Bacteria 1039
195 Ga0495668_0000337 3300046616 Bacteria 63494
196 Ga0495668_0030329 3300046616 Bacteria 3053
197 Ga0495668_0151882 3300046616 Bacteria 1268
198 Ga0495668_0220657 3300046616 Bacteria 1038
199 Ga0495668_0363874 3300046616 Unclassified 794
200 Ga0495634_0002899 3300046642 Bacteria 14074
201 Ga0495611_0091992 3300046648 Bacteria 1402
202 Ga0495611_0221505 3300046648 Bacteria 880
203 Ga0495625_0004812 3300046660 Bacteria 12623
204 Ga0495625_0020248 3300046660 Bacteria 5141
205 Ga0495625_0457845 3300046660 Bacteria 787
206 Ga0495659_0033896 3300046664 Bacteria 1794
207 Ga0495661_0007666 3300046665 Bacteria 7519
208 Ga0495661_0009701 3300046665 Bacteria 6594
209 Ga0495661_0011329 3300046665 Bacteria 6051
210 Ga0495661_0051769 3300046665 Bacteria 2477
211 Ga0495661_0073478 3300046665 Bacteria 1992
212 Ga0495661_0104245 3300046665 Bacteria 1590
213 Ga0495661_0142648 3300046665 Bacteria 1301
214 Ga0495661_0155139 3300046665 Bacteria 1233
215 Ga0495588_0000324 3300046674 Bacteria 31752
216 Ga0495588_0044063 3300046674 Bacteria 2284
217 Ga0495588_0081092 3300046674 Bacteria 1693
218 Ga0495588_0666565 3300046674 Bacteria 544
219 Ga0495623_0007460 3300046679 Bacteria 7101
220 Ga0495670_0001573 3300046691 Bacteria 11157
221 Ga0495670_0010184 3300046691 Bacteria 4624
222 Ga0495670_0011349 3300046691 Bacteria 4380
223 Ga0495670_0013188 3300046691 Bacteria 4064
224 Ga0495671_0125547 3300046692 Bacteria 1251
225 Ga0495649_0247484 3300046694 Bacteria 916
226 Ga0495589_0075139 3300046794 Bacteria 1648
227 Ga0495589_0106247 3300046794 Bacteria 1356
228 Ga0495589_0191755 3300046794 Bacteria 967
229 Ga0495600_0169648 3300046809 Bacteria 1409
230 Ga0495600_0217354 3300046809 Bacteria 1223
231 Ga0495660_0027193 3300046810 Bacteria 3237
232 Ga0495660_0135556 3300046810 Bacteria 1230
233 Ga0495660_0236513 3300046810 Bacteria 853
234 Ga0495604_0072322 3300047317 Bacteria 2606
235 Ga0495672_0193990 3300047320 Bacteria 1019
236 Ga0495683_0050168 3300047323 Bacteria 2089
237 Ga0495683_0111930 3300047323 Bacteria 1302
238 Ga0495687_000060 3300047443 Bacteria 179124
239 Ga0495687_001576 3300047443 Bacteria 20702
240 Ga0495687_020512 3300047443 Bacteria 3218
241 Ga0495675_0003418 3300047444 Bacteria 9562
242 Ga0495677_0005800 3300047445 Bacteria 4671
243 Ga0495677_0013030 3300047445 Bacteria 3027
244 Ga0495677_0027129 3300047445 Bacteria 2077
245 Ga0495677_0066727 3300047445 Bacteria 1338
246 Ga0495677_0163344 3300047445 Bacteria 860
247 Ga0495677_0173187 3300047445 Bacteria 835
248 Ga0495679_010939 3300047446 Bacteria 3532
249 Ga0495679_130887 3300047446 Bacteria 681
250 Ga0495673_0127979 3300047469 Unclassified 1000
251 Ga0495681_0002251 3300047470 Bacteria 13866
252 Ga0495681_0007558 3300047470 Bacteria 6918
253 Ga0495681_0018326 3300047470 Bacteria 3860
254 Ga0495681_0348167 3300047470 Bacteria 564
255 Ga0495686_0001668 3300047472 Bacteria 23080
256 Ga0495602_0047469 3300048088 Bacteria 3869
257 Ga0495626_0002280 3300048091 Bacteria 13650
258 Ga0495626_0014471 3300048091 Bacteria 4066
259 Ga0495626_0028199 3300048091 Bacteria 2724
260 Ga0495626_0190866 3300048091 Bacteria 845
261 Ga0496100_1271154 3300048903 Bacteria 581
262 Ga0496102_0050094 3300048905 Bacteria 3802
263 Ga0496102_0139521 3300048905 Bacteria 2272
264 Ga0496102_0204073 3300048905 Bacteria 1863
265 Ga0496102_0670623 3300048905 Bacteria 960
266 Ga0496102_1417385 3300048905 Unclassified 614
267 Ga0496103_0110986 3300048906 Bacteria 1742
268 Ga0496103_0897613 3300048906 Bacteria 555
269 Ga0496105_1165493 3300048908 Bacteria 569
270 Ga0496106_0008964 3300048909 Bacteria 7389
271 Ga0496107_0028809 3300048910 Bacteria 3948
272 Ga0496110_0222014 3300048913 Bacteria 1718
273 Ga0496110_1384965 3300048913 Bacteria 613
274 Ga0496111_0008685 3300048914 Bacteria 6741
275 Ga0496114_0074793 3300048917 Bacteria 2852
276 Ga0496116_0322024 3300048919 Bacteria 723
277 Ga0496117_0005227 3300048920 Bacteria 13784
278 Ga0496118_0332880 3300048921 Bacteria 818
279 Ga0496119_0183226 3300048922 Bacteria 1097
280 Ga0496120_0028184 3300048923 Bacteria 3444
281 Ga0496120_0520450 3300048923 Bacteria 508
282 Ga0496121_0004241 3300048924 Bacteria 19496
283 Ga0496121_0282592 3300048924 Bacteria 1134
284 Ga0496122_0042989 3300048925 Bacteria 3546
285 Ga0496123_0010031 3300048926 Bacteria 8434
286 Ga0496124_0006145 3300048927 Bacteria 13174
287 Ga0496124_0019777 3300048927 Bacteria 6250
288 Ga0495678_000175 3300049459 Bacteria 73523
289 Ga0495682_0020936 3300049460 Bacteria 2452
290 Ga0501031_0400593 3300049568 Bacteria 887
291 Ga0501032_0162659 3300049569 Bacteria 1465
292 Ga0501032_0182730 3300049569 Bacteria 1372
293 Ga0501032_0342402 3300049569 Bacteria 963
294 Ga0501032_0525193 3300049569 Bacteria 755
295 Ga0501032_0741639 3300049569 Bacteria 621
296 Ga0501033_0065586 3300049570 Bacteria 2671
297 Ga0501033_1160699 3300049570 Bacteria 512
298 Ga0501034_0128328 3300049571 Bacteria 2520
299 Ga0501036_0174451 3300049572 Bacteria 1810
300 Ga0501037_0699580 3300049573 Bacteria 674
301 Ga0501038_0009801 3300049574 Bacteria 8771
302 Ga0501042_0102700 3300049578 Bacteria 2056
303 Ga0501043_0893660 3300049579 Bacteria 637
304 Ga0501047_0076129 3300049581 Bacteria 3229
305 Ga0501070_0433569 3300049586 Unclassified 1061
306 Ga0501044_0167237 3300049823 Bacteria 2172
307 nmdc:mga03n38_463070_c1 3300050490 Bacteria 707
308 nmdc:mga00v17_209589_c1 3300050491 Bacteria 1261
309 nmdc:mga00v17_445027_c1 3300050491 Bacteria 841
310 nmdc:mga0yw44_276331_c1 3300050492 Bacteria 1122
311 nmdc:mga0yw44_62517_c1 3300050492 Bacteria 2287
312 nmdc:mga06z11_55871_c1 3300050494 Bacteria 2040
313 nmdc:mga04h51_96507_c1 3300050495 Bacteria 1071
314 nmdc:mga07m45_132576_c1 3300050496 Bacteria 1442
315 nmdc:mga0sz30_158639_c1 3300050516 Bacteria 1002
316 Ga0495619_1090993 3300053085 Unclassified 531
317 Ga0500562_214239 3300053108 Bacteria 521
318 Ga0500559_0494686 3300053136 Bacteria 562
319 Ga0500600_0432665 3300053149 Unclassified 511
320 Ga0500620_000348 3300053155 Bacteria 8624
321 Ga0500620_194779 3300053155 Bacteria 693
322 Ga0587086_080125 3300059507 Bacteria 574
323 Ga0587092_133624 3300059512 Bacteria 541
324 Ga0587106_134618 3300059605 Bacteria 536
325 Ga0587075_043901 3300059644 Bacteria 759
326 Ga0587079_035242 3300059647 Bacteria 983
327 Ga0496102_0589385
328 JGI25406J46586_10039677
329 JGI25406J46586_10054886
330 JGI25406J46586_10139400
331 Ga0070658_10043023
332 Ga0070658_10053384
333 Ga0070658_10324749
334 Ga0070666_10142906
335 Ga0068868_100840114
336 Ga0070660_101793538
337 Ga0070714_100202637
338 Ga0068855_100219121
339 Ga0068855_100467087
340 Ga0068863_100964318
341 Ga0081539_10001737
342 Ga0081539_10001779
343 Ga0081539_10208946
344 Ga0070717_10096107
345 Ga0075368_10023597
346 Ga0075363_100221275
347 Ga0075364_10234706
348 Ga0075364_10246803
349 Ga0075367_10022949
350 Ga0075367_10376975
351 Ga0075369_10155434
352 Ga0075369_10290966
353 Ga0075370_10262042
354 Ga0105247_10002257
355 Ga0105247_10098513
356 Ga0105248_10000731
357 Ga0105246_10595365
358 Ga0157327_1006441
359 Ga0157370_10060978
360 Ga0157374_10838404
361 Ga0157378_12086389
362 Ga0157372_10836596
363 Ga0163163_11421039
364 Ga0157379_10005347
365 Ga0206349_1205852
366 Ga0206355_1407327
367 Ga0206355_1476726
368 Ga0209437_107299
369 Ga0207680_10122136
370 Ga0207705_10544080
371 Ga0207664_10142902
372 Ga0207661_10189996
373 Ga0207667_10135589
374 Ga0207667_11090135
375 Ga0207703_10000013
376 Ga0209813_10144582
377 Ga0307515_10093704
378 Ga0265324_10184908
379 Ga0307408_102180815
380 Ga0307508_10029506
381 Ga0307508_10039481
382 Ga0316576_10402281
383 Ga0316578_10229802
384 Ga0307516_10027049
385 Ga0307516_10591907
386 Ga0307405_10671538
387 Ga0316577_10511701
388 Ga0307410_12098526
389 Ga0326468_10000187
390 Ga0307406_12051881
391 Ga0307409_101308118
392 Ga0307416_100962213
393 Ga0307414_10745618
394 Ga0307411_10822598
395 Ga0316588_1047259
396 Ga0316596_1090901
397 Ga0373924_0019139
398 Ga0373937_2010901
399 Ga0316582_0646870
400 Ga0316582_0713666
401 Ga0395899_0009986
402 Ga0395899_0089877
403 Ga0395899_0247653
404 Ga0395899_0248643
405 Ga0395900_0037483
406 Ga0395900_0199645
407 Ga0395900_0249548
408 Ga0395900_0438102
409 Ga0395900_0480225
410 Ga0395900_0708743
411 Ga0395898_0010414
412 Ga0395898_0374703
413 Ga0395898_0635038
414 Ga0395905_0011770
415 Ga0395905_0029478
416 Ga0395901_0017533
417 Ga0395901_0024359
418 Ga0395901_0155193
419 Ga0395901_0348144
420 Ga0395901_0849628
421 Ga0400483_043340
422 Ga0400483_188176
423 Ga0451787_149737
424 Ga0451789_0970447
425 Ga0451791_0709085
426 Ga0451793_0807282
427 Ga0451793_1767977
428 Ga0451795_1309353
429 Ga0451833_0899603
430 Ga0451833_1181116
431 Ga0451841_0621121
432 Ga0451843_1251659
433 Ga0450898_095951
434 Ga0466972_0243043
435 Ga0453683_0908971
436 Ga0466965_0220151
437 Ga0466961_0441866
438 Ga0466971_0163580
439 Ga0466970_0001788
440 Ga0466960_0318841
441 Ga0451576_0005947
442 Ga0495617_258005
443 Ga0495627_005200
444 Ga0495627_048239
445 Ga0495627_171928
446 Ga0495603_0321211
447 Ga0495590_0199189
448 Ga0495638_0068012
449 Ga0495638_0137644
450 Ga0495653_0006879
451 Ga0495653_0068308
452 Ga0495650_0000181
453 Ga0495650_0006967
454 Ga0495580_0004528
455 Ga0495582_0058735
456 Ga0495582_0767197
457 Ga0495605_0024934
458 Ga0495605_0035998
459 Ga0495605_0250941
460 Ga0495639_0142960
461 Ga0495584_0000199
462 Ga0495584_0030459
463 Ga0495584_0041421
464 Ga0495584_0083581
465 Ga0495584_0154622
466 Ga0495584_0194858
467 Ga0495585_0000172
468 Ga0495585_0006670
469 Ga0495585_0008151
470 Ga0495585_0028801
471 Ga0495585_0264066
472 Ga0495594_0370238
473 Ga0495596_0001735
474 Ga0495596_0041353
475 Ga0495607_0127104
476 Ga0495607_0288995
477 Ga0495583_0014504
478 Ga0495606_0005221
479 Ga0495606_0013971
480 Ga0495606_0020355
481 Ga0495606_0024344
482 Ga0495610_0000121
483 Ga0495616_0001563
484 Ga0495616_0006592
485 Ga0495616_0095061
486 Ga0495618_0743460
487 Ga0495628_1057130
488 Ga0495630_0017799
489 Ga0495631_0008057
490 Ga0495631_0014241
491 Ga0495631_0038360
492 Ga0495631_0217296
493 Ga0495632_0002020
494 Ga0495632_0164951
495 Ga0495637_0018003
496 Ga0495643_0037691
497 Ga0495643_0427138
498 Ga0495644_0007854
499 Ga0495644_0213347
500 Ga0495648_0044062
501 Ga0495648_0056003
502 Ga0495663_0093087
503 Ga0495642_0031438
504 Ga0495652_0002811
505 Ga0495665_0001187
506 Ga0495586_0034009
507 Ga0495609_0001447
508 Ga0495609_0001580
509 Ga0495609_0003833
510 Ga0495609_0004245
511 Ga0495609_0040844
512 Ga0495609_0272763
513 Ga0495597_0001217
514 Ga0495597_0041486
515 Ga0495597_0194590
516 Ga0495633_0006079
517 Ga0495633_0007365
518 Ga0495633_0052729
519 Ga0495633_0090554
520 Ga0495633_0159879
521 Ga0495668_0000337
522 Ga0495668_0030329
523 Ga0495668_0151882
524 Ga0495668_0220657
525 Ga0495668_0363874
526 Ga0495634_0002899
527 Ga0495611_0091992
528 Ga0495611_0221505
529 Ga0495625_0004812
530 Ga0495625_0020248
531 Ga0495625_0457845
532 Ga0495659_0033896
533 Ga0495661_0007666
534 Ga0495661_0009701
535 Ga0495661_0011329
536 Ga0495661_0051769
537 Ga0495661_0073478
538 Ga0495661_0104245
539 Ga0495661_0142648
540 Ga0495661_0155139
541 Ga0495588_0000324
542 Ga0495588_0044063
543 Ga0495588_0081092
544 Ga0495588_0666565
545 Ga0495623_0007460
546 Ga0495670_0001573
547 Ga0495670_0010184
548 Ga0495670_0011349
549 Ga0495670_0013188
550 Ga0495671_0125547
551 Ga0495649_0247484
552 Ga0495589_0075139
553 Ga0495589_0106247
554 Ga0495589_0191755
555 Ga0495600_0169648
556 Ga0495600_0217354
557 Ga0495660_0027193
558 Ga0495660_0135556
559 Ga0495660_0236513
560 Ga0495604_0072322
561 Ga0495672_0193990
562 Ga0495683_0050168
563 Ga0495683_0111930
564 Ga0495687_000060
565 Ga0495687_001576
566 Ga0495687_020512
567 Ga0495675_0003418
568 Ga0495677_0005800
569 Ga0495677_0013030
570 Ga0495677_0027129
571 Ga0495677_0066727
572 Ga0495677_0163344
573 Ga0495677_0173187
574 Ga0495679_010939
575 Ga0495679_130887
576 Ga0495673_0127979
577 Ga0495681_0002251
578 Ga0495681_0007558
579 Ga0495681_0018326
580 Ga0495681_0348167
581 Ga0495686_0001668
582 Ga0495602_0047469
583 Ga0495626_0002280
584 Ga0495626_0014471
585 Ga0495626_0028199
586 Ga0495626_0190866
587 Ga0496100_1271154
588 Ga0496102_0050094
589 Ga0496102_0139521
590 Ga0496102_0204073
591 Ga0496102_0670623
592 Ga0496102_1417385
593 Ga0496103_0110986
594 Ga0496103_0897613
595 Ga0496105_1165493
596 Ga0496106_0008964
597 Ga0496107_0028809
598 Ga0496110_0222014
599 Ga0496110_1384965
600 Ga0496111_0008685
601 Ga0496114_0074793
602 Ga0496116_0322024
603 Ga0496117_0005227
604 Ga0496118_0332880
605 Ga0496119_0183226
606 Ga0496120_0028184
607 Ga0496120_0520450
608 Ga0496121_0004241
609 Ga0496121_0282592
610 Ga0496122_0042989
611 Ga0496123_0010031
612 Ga0496124_0006145
613 Ga0496124_0019777
614 Ga0495678_000175
615 Ga0495682_0020936
616 Ga0501031_0400593
617 Ga0501032_0162659
618 Ga0501032_0182730
619 Ga0501032_0342402
620 Ga0501032_0525193
621 Ga0501032_0741639
622 Ga0501033_0065586
623 Ga0501033_1160699
624 Ga0501034_0128328
625 Ga0501036_0174451
626 Ga0501037_0699580
627 Ga0501038_0009801
628 Ga0501042_0102700
629 Ga0501043_0893660
630 Ga0501047_0076129
631 Ga0501070_0433569
632 Ga0501044_0167237
633 nmdc:mga03n38_463070_c1
634 nmdc:mga00v17_209589_c1
635 nmdc:mga00v17_445027_c1
636 nmdc:mga0yw44_276331_c1
637 nmdc:mga0yw44_62517_c1
638 nmdc:mga06z11_55871_c1
639 nmdc:mga04h51_96507_c1
640 nmdc:mga07m45_132576_c1
641 nmdc:mga0sz30_158639_c1
642 Ga0495619_1090993
643 Ga0500562_214239
644 Ga0500559_0494686
645 Ga0500600_0432665
646 Ga0500620_000348
647 Ga0500620_194779
648 Ga0587086_080125
649 Ga0587092_133624
650 Ga0587106_134618
651 Ga0587075_043901
652 Ga0587079_035242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

26

106

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8x-assembly2.cif.gz_CY structure of thermus thermophilus ribosome 0.9695 1 85
3oei-assembly4.cif.gz_O crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3) 0.9642 2 85
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.9629 1 85
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.9586 1 85
4v8x-assembly2.cif.gz_CY structure of thermus thermophilus ribosome 0.9584 1 85
ID Description Score Start End Superfamily
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9695 1 85 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.967 2 85 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9584 1 85 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9337 2 85 3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8899 1 85 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A363UKU4-F1-model_v4 Putative mRNA interferase YoeB 0.9959 2 85 GO:0004519
GO:0006401
AF-A0A1F6T804-F1-model_v4 Putative mRNA interferase YoeB 0.9912 1 82 GO:0004519
GO:0006401
GO:0045892
AF-A0A2N7UQ04-F1-model_v4 Putative mRNA interferase YoeB 0.9898 1 85 GO:0004519
GO:0006401
GO:0045892
AF-A0A6B2VPE5-F1-model_v4 Putative mRNA interferase YoeB 0.9882 1 85 GO:0004519
GO:0006401
GO:0045892
AF-A0A426QDU1-F1-model_v4 Putative mRNA interferase YoeB 0.9878 2 85 GO:0004519
GO:0006401

Map