F408386

General Info

Members Datasets Scaffolds Average Seq Length
326 227 652 163

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10221571|Ga0265340_102215712
Length 171
Sequence MSDNIIIRPATEQDVALIQRFIRDLARYEHLEHEMVATEEGLRKSLFGERRYAEVVFACVGDDPASADPVGFALFFHNYSTFLGKPGIYLEDLFVRPEARGRGIGKRLLAWLAQTAVARDCGRLEWAVLDWNEPSIGFYRSLGAVLKSEWQIFRLTGDPLKALADTPQGRL

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
218 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
223 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 0
Rhizoplane 4.6
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10221571 3300031247 Bacteria 847
2 Ga0065715_10508457 3300005293 Bacteria 771
3 Ga0070676_10047788 3300005328 Unclassified 2500
4 Ga0070690_100007718 3300005330 Bacteria 6168
5 Ga0070666_10000825 3300005335 Bacteria 18805
6 Ga0068868_100001561 3300005338 Bacteria 15635
7 Ga0068868_100126062 3300005338 Bacteria 2092
8 Ga0070689_100349967 3300005340 Bacteria 1239
9 Ga0070687_100431611 3300005343 Unclassified 872
10 Ga0070674_100100710 3300005356 Bacteria 2104
11 Ga0070673_100032975 3300005364 Bacteria 3905
12 Ga0070667_100009226 3300005367 Bacteria 8170
13 Ga0070709_10050459 3300005434 Bacteria 2607
14 Ga0070714_100063399 3300005435 Bacteria 3179
15 Ga0070713_100003775 3300005436 Bacteria 10029
16 Ga0070711_100000263 3300005439 Bacteria 26963
17 Ga0070705_100085011 3300005440 Bacteria 1954
18 Ga0070708_100423251 3300005445 Bacteria 1256
19 Ga0070678_100000129 3300005456 Bacteria 30238
20 Ga0068867_100175481 3300005459 Bacteria 1700
21 Ga0070707_100019437 3300005468 Bacteria 6400
22 Ga0070699_100059561 3300005518 Bacteria 3307
23 Ga0070679_100378544 3300005530 Bacteria 1362
24 Ga0068853_100472236 3300005539 Bacteria 1182
25 Ga0070686_100720420 3300005544 Bacteria 797
26 Ga0070665_100035039 3300005548 Bacteria 5048
27 Ga0070665_100042946 3300005548 Bacteria 4545
28 Ga0070704_100080401 3300005549 Bacteria 2397
29 Ga0068855_100001037 3300005563 Bacteria 34574
30 Ga0068856_100162642 3300005614 Bacteria 2243
31 Ga0068852_100767321 3300005616 Bacteria 977
32 Ga0068859_100054356 3300005617 Bacteria 4027
33 Ga0068859_101873598 3300005617 Bacteria 662
34 Ga0068864_100030057 3300005618 Bacteria 4605
35 Ga0068864_100444939 3300005618 Bacteria 1238
36 Ga0068866_10001569 3300005718 Bacteria 9713
37 Ga0068863_100142671 3300005841 Bacteria 2290
38 Ga0068858_100004518 3300005842 Bacteria 13641
39 Ga0068858_100159931 3300005842 Bacteria 2121
40 Ga0068860_100000100 3300005843 Bacteria 144580
41 Ga0068860_100006186 3300005843 Bacteria 12043
42 Ga0068860_101759482 3300005843 Bacteria 642
43 Ga0070715_10001731 3300006163 Bacteria 6484
44 Ga0070716_100157593 3300006173 Bacteria 1467
45 Ga0070712_100016715 3300006175 Bacteria 4742
46 Ga0097621_100012611 3300006237 Bacteria 6271
47 Ga0068871_100016383 3300006358 Bacteria 5581
48 Ga0075428_100007575 3300006844 Bacteria 12030
49 Ga0075428_100563413 3300006844 Bacteria 1218
50 Ga0075430_100002965 3300006846 Bacteria 14212
51 Ga0075434_100005643 3300006871 Bacteria 11415
52 Ga0075429_100025040 3300006880 Bacteria 5180
53 Ga0075429_101319387 3300006880 Unclassified 629
54 Ga0068865_100163359 3300006881 Bacteria 1701
55 Ga0075436_100035459 3300006914 Bacteria 3441
56 Ga0097620_100054355 3300006931 Bacteria 4027
57 Ga0097620_101873125 3300006931 Bacteria 662
58 Ga0075435_100010536 3300007076 Bacteria 6765
59 Ga0105240_10000423 3300009093 Bacteria 78296
60 Ga0111539_10924052 3300009094 Bacteria 1015
61 Ga0105245_10011723 3300009098 Bacteria 7628
62 Ga0105245_10177237 3300009098 Bacteria 2034
63 Ga0114129_10087948 3300009147 Bacteria 4308
64 Ga0114129_10514025 3300009147 Bacteria 1562
65 Ga0105242_10001505 3300009176 Bacteria 18312
66 Ga0105248_10010045 3300009177 Bacteria 10424
67 Ga0105248_11032815 3300009177 Bacteria 929
68 Ga0105237_10022049 3300009545 Bacteria 6537
69 Ga0105237_10362807 3300009545 Bacteria 1453
70 Ga0105238_10027762 3300009551 Bacteria 5769
71 Ga0105249_10173193 3300009553 Bacteria 2094
72 Ga0105239_10019609 3300010375 Bacteria 7464
73 Ga0157373_10056421 3300013100 Unclassified 2789
74 Ga0157374_10001326 3300013296 Bacteria 21038
75 Ga0157378_10004724 3300013297 Bacteria 11942
76 Ga0163162_10034192 3300013306 Bacteria 5056
77 Ga0163162_10187365 3300013306 Bacteria 2196
78 Ga0157372_10289930 3300013307 Bacteria 1903
79 Ga0157375_10021432 3300013308 Bacteria 5925
80 Ga0157380_11050945 3300014326 Bacteria 851
81 Ga0157379_10034571 3300014968 Bacteria 4507
82 Ga0207642_10320696 3300025899 Bacteria 905
83 Ga0207680_10094560 3300025903 Bacteria 1908
84 Ga0207685_10002919 3300025905 Bacteria 4040
85 Ga0207699_10009199 3300025906 Bacteria 4908
86 Ga0207645_10074003 3300025907 Unclassified 2181
87 Ga0207684_10075859 3300025910 Bacteria 2857
88 Ga0207695_10012966 3300025913 Bacteria 9962
89 Ga0207671_10587881 3300025914 Bacteria 887
90 Ga0207693_10000060 3300025915 Bacteria 93715
91 Ga0207663_10063682 3300025916 Bacteria 2349
92 Ga0207662_10439872 3300025918 Unclassified 890
93 Ga0207646_10078759 3300025922 Bacteria 2946
94 Ga0207694_10647193 3300025924 Unclassified 890
95 Ga0207687_10132471 3300025927 Bacteria 1881
96 Ga0207700_10004851 3300025928 Bacteria 7985
97 Ga0207664_10039349 3300025929 Bacteria 3672
98 Ga0207644_10167352 3300025931 Bacteria 1713
99 Ga0207686_10087966 3300025934 Bacteria 2044
100 Ga0207704_10010187 3300025938 Bacteria 4571
101 Ga0207704_10707770 3300025938 Bacteria 834
102 Ga0207665_10013127 3300025939 Bacteria 5446
103 Ga0207711_10387174 3300025941 Bacteria 1298
104 Ga0207667_10001116 3300025949 Bacteria 33844
105 Ga0207651_10040131 3300025960 Bacteria 3094
106 Ga0207658_10014029 3300025986 Bacteria 5484
107 Ga0207677_10162350 3300026023 Bacteria 1737
108 Ga0207677_10282731 3300026023 Bacteria 1363
109 Ga0207703_10131679 3300026035 Bacteria 2160
110 Ga0207703_10165676 3300026035 Bacteria 1939
111 Ga0207708_10500822 3300026075 Bacteria 1018
112 Ga0207702_10178408 3300026078 Bacteria 1954
113 Ga0207641_10230254 3300026088 Bacteria 1722
114 Ga0207676_10021266 3300026095 Bacteria 4760
115 Ga0207675_100230538 3300026118 Bacteria 1787
116 Ga0207675_100241782 3300026118 Bacteria 1745
117 Ga0207683_10000725 3300026121 Bacteria 29989
118 Ga0209998_10033114 3300027717 Unclassified 1151
119 Ga0209813_10098063 3300027866 Bacteria 993
120 Ga0268266_10052731 3300028379 Bacteria 3493
121 Ga0268266_10382768 3300028379 Bacteria 1327
122 Ga0268264_10000002 3300028381 Bacteria 1153045
123 Ga0268264_10307134 3300028381 Bacteria 1495
124 Ga0265327_10017962 3300031251 Bacteria 4407
125 Ga0307408_100195740 3300031548 Bacteria 1632
126 Ga0307508_10419484 3300031616 Bacteria 930
127 Ga0307405_10552623 3300031731 Bacteria 932
128 Ga0316577_10389342 3300031733 Bacteria 792
129 Ga0307410_11138561 3300031852 Bacteria 678
130 Ga0307406_10239538 3300031901 Bacteria 1360
131 Ga0307406_10427300 3300031901 Unclassified 1057
132 Ga0307412_10298963 3300031911 Unclassified 1271
133 Ga0307416_100131998 3300032002 Bacteria 2250
134 Ga0307416_101334326 3300032002 Bacteria 823
135 Ga0307414_11061334 3300032004 Bacteria 747
136 Ga0307414_11577196 3300032004 Bacteria 612
137 Ga0316585_10182738 3300032137 Bacteria 693
138 Ga0373944_0415601 3300035089 Bacteria 520
139 Ga0373923_0239415 3300035111 Bacteria 847
140 Ga0373945_0184126 3300035116 Bacteria 861
141 Ga0373953_0068258 3300035117 Bacteria 1463
142 Ga0373943_0125319 3300035170 Bacteria 1369
143 Ga0373924_0053919 3300035410 Bacteria 1671
144 Ga0373924_0226142 3300035410 Bacteria 827
145 Ga0373935_1195514 3300035692 Bacteria 567
146 Ga0373927_0048140 3300035695 Bacteria 2757
147 Ga0373933_0252458 3300035724 Bacteria 1136
148 Ga0373933_0278341 3300035724 Bacteria 1081
149 Ga0373947_0025543 3300035725 Bacteria 3446
150 Ga0373937_0077341 3300036401 Bacteria 3075
151 Ga0373937_0524763 3300036401 Bacteria 1125
152 Ga0316584_0040575 3300036712 Bacteria 3468
153 Ga0436365_1488257 3300039437 Bacteria 758
154 Ga0436360_1238331 3300039438 Bacteria 829
155 Ga0439436_0009038 3300041404 Bacteria 3055
156 Ga0439465_0005441 3300041413 Bacteria 4064
157 Ga0439445_0008389 3300042004 Bacteria 2416
158 Ga0439444_0016462 3300042437 Unclassified 1260
159 Ga0466969_0000425 3300044656 Bacteria 23054
160 Ga0466969_0001362 3300044656 Bacteria 13168
161 Ga0466966_0000285 3300044684 Bacteria 33126
162 Ga0466966_0119997 3300044684 Bacteria 1616
163 Ga0466961_0063124 3300044693 Unclassified 2353
164 Ga0466964_0008477 3300044706 Bacteria 3864
165 Ga0453684_0083884 3300044712 Bacteria 3965
166 Ga0466971_0006649 3300044719 Bacteria 5028
167 Ga0466970_0005912 3300044765 Bacteria 6096
168 Ga0466959_0004362 3300045049 Bacteria 9464
169 Ga0466959_0212101 3300045049 Bacteria 1345
170 Ga0495629_0711099 3300046459 Bacteria 667
171 Ga0495580_0053147 3300046472 Bacteria 2859
172 Ga0495580_0277303 3300046472 Archaea 1144
173 Ga0495618_0077808 3300046514 Bacteria 2114
174 Ga0495628_0300568 3300046516 Bacteria 1188
175 Ga0495630_1033998 3300046517 Bacteria 624
176 Ga0495630_1199750 3300046517 Bacteria 574
177 Ga0495652_0677035 3300046529 Bacteria 696
178 Ga0495665_0072535 3300046531 Bacteria 1813
179 Ga0495640_0537696 3300046533 Bacteria 709
180 Ga0495587_0169881 3300046536 Bacteria 1239
181 Ga0495587_0176399 3300046536 Bacteria 1213
182 Ga0495645_0062732 3300046543 Bacteria 2691
183 Ga0495645_0177391 3300046543 Bacteria 1462
184 Ga0495634_0607941 3300046642 Bacteria 634
185 Ga0495635_0235633 3300046663 Bacteria 1236
186 Ga0495657_0848966 3300046675 Bacteria 520
187 Ga0495599_0276787 3300046678 Bacteria 1017
188 Ga0495599_0311882 3300046678 Bacteria 948
189 Ga0495658_0041539 3300046683 Bacteria 2563
190 Ga0495604_0326750 3300047317 Bacteria 1024
191 Ga0495674_1023035 3300047319 Bacteria 632
192 Ga0495684_0466639 3300047471 Bacteria 874
193 Ga0496100_0036269 3300048903 Bacteria 3108
194 Ga0496102_0239875 3300048905 Bacteria 1709
195 Ga0496102_0356211 3300048905 Bacteria 1377
196 Ga0496104_0068830 3300048907 Bacteria 3363
197 Ga0496105_0011414 3300048908 Bacteria 7017
198 Ga0496106_0029524 3300048909 Bacteria 4086
199 Ga0496107_0006651 3300048910 Bacteria 7958
200 Ga0496108_0006755 3300048911 Bacteria 9287
201 Ga0496109_0001391 3300048912 Bacteria 20067
202 Ga0496110_0005095 3300048913 Bacteria 10264
203 Ga0496111_0040307 3300048914 Bacteria 3350
204 Ga0496112_0275445 3300048915 Bacteria 1630
205 Ga0496113_0014370 3300048916 Bacteria 5400
206 Ga0496114_0003264 3300048917 Bacteria 12455
207 Ga0496115_0053240 3300048918 Bacteria 3247
208 Ga0496117_0080406 3300048920 Bacteria 2144
209 Ga0496118_0061429 3300048921 Bacteria 2783
210 Ga0501298_008031 3300049521 Unclassified 1764
211 Ga0501031_0103179 3300049568 Unclassified 1861
212 Ga0501031_0212315 3300049568 Bacteria 1261
213 Ga0501032_0006962 3300049569 Bacteria 8289
214 Ga0501032_0089813 3300049569 Bacteria 2039
215 Ga0501032_0210541 3300049569 Bacteria 1267
216 Ga0501033_0066606 3300049570 Bacteria 2648
217 Ga0501033_0277236 3300049570 Bacteria 1184
218 Ga0501033_0649005 3300049570 Bacteria 721
219 Ga0501034_0003280 3300049571 Bacteria 18473
220 Ga0501034_0039800 3300049571 Bacteria 4760
221 Ga0501034_0087412 3300049571 Bacteria 3116
222 Ga0501034_0237067 3300049571 Bacteria 1771
223 Ga0501034_1444137 3300049571 Bacteria 562
224 Ga0501036_0169857 3300049572 Bacteria 1837
225 Ga0501036_0178812 3300049572 Bacteria 1786
226 Ga0501036_0583965 3300049572 Bacteria 927
227 Ga0501036_1168182 3300049572 Bacteria 628
228 Ga0501037_0149995 3300049573 Bacteria 1666
229 Ga0501037_0304886 3300049573 Bacteria 1105
230 Ga0501038_0117148 3300049574 Bacteria 2200
231 Ga0501038_0416352 3300049574 Bacteria 1037
232 Ga0501039_0058949 3300049575 Bacteria 2974
233 Ga0501039_0248016 3300049575 Bacteria 1400
234 Ga0501040_0026941 3300049576 Bacteria 3867
235 Ga0501041_0164470 3300049577 Bacteria 1387
236 Ga0501041_0581106 3300049577 Bacteria 715
237 Ga0501042_0053182 3300049578 Bacteria 2889
238 Ga0501042_0095663 3300049578 Bacteria 2134
239 Ga0501043_0000450 3300049579 Bacteria 36897
240 Ga0501043_0057550 3300049579 Bacteria 3052
241 Ga0501043_0061206 3300049579 Unclassified 2956
242 Ga0501043_0331194 3300049579 Bacteria 1159
243 Ga0501043_0335686 3300049579 Bacteria 1150
244 Ga0501043_0639053 3300049579 Bacteria 782
245 Ga0501046_0001281 3300049580 Bacteria 24347
246 Ga0501046_0041361 3300049580 Bacteria 3678
247 Ga0501046_0134152 3300049580 Bacteria 1876
248 Ga0501046_0402521 3300049580 Bacteria 988
249 Ga0501046_0732032 3300049580 Bacteria 695
250 Ga0501047_0000920 3300049581 Bacteria 30124
251 Ga0501047_0054100 3300049581 Bacteria 3882
252 Ga0501047_0142074 3300049581 Bacteria 2278
253 Ga0501047_0410500 3300049581 Bacteria 1186
254 Ga0501048_0015937 3300049582 Bacteria 5545
255 Ga0501048_0181392 3300049582 Unclassified 1492
256 Ga0501048_0258729 3300049582 Bacteria 1236
257 Ga0501067_0189835 3300049583 Bacteria 1144
258 Ga0501067_0191121 3300049583 Bacteria 1140
259 Ga0501067_0620727 3300049583 Bacteria 606
260 Ga0501068_0006175 3300049584 Bacteria 6591
261 Ga0501068_0172717 3300049584 Bacteria 1364
262 Ga0501069_0138830 3300049585 Bacteria 1394
263 Ga0501070_0120896 3300049586 Bacteria 2165
264 Ga0501070_0497628 3300049586 Bacteria 979
265 Ga0501070_1020194 3300049586 Unclassified 641
266 Ga0501072_0027049 3300049588 Bacteria 4476
267 Ga0501072_0082267 3300049588 Bacteria 2552
268 Ga0501072_0299500 3300049588 Bacteria 1278
269 Ga0501073_0015214 3300049589 Bacteria 5581
270 Ga0501073_0032888 3300049589 Bacteria 3695
271 Ga0501073_0074324 3300049589 Bacteria 2366
272 Ga0501073_0147491 3300049589 Bacteria 1630
273 Ga0501073_0213751 3300049589 Bacteria 1332
274 Ga0501074_0770256 3300049590 Bacteria 678
275 Ga0501074_1043500 3300049590 Bacteria 574
276 Ga0501075_0052356 3300049591 Bacteria 3070
277 Ga0501075_0465941 3300049591 Bacteria 964
278 Ga0501075_0842157 3300049591 Bacteria 698
279 Ga0501076_0034227 3300049592 Bacteria 3970
280 Ga0501077_0410331 3300049593 Bacteria 866
281 Ga0501253_115013 3300049683 Unclassified 646
282 Ga0501079_0306920 3300049741 Bacteria 1242
283 Ga0501079_0621364 3300049741 Unclassified 850
284 Ga0501080_0064289 3300049742 Bacteria 3413
285 Ga0501080_0219661 3300049742 Bacteria 1739
286 Ga0501080_0711193 3300049742 Bacteria 885
287 Ga0501081_0145019 3300049743 Unclassified 1703
288 Ga0501083_0004499 3300049744 Bacteria 9845
289 Ga0501083_0110966 3300049744 Bacteria 1803
290 Ga0501083_0198299 3300049744 Bacteria 1309
291 Ga0501283_004835 3300049779 Unclassified 1833
292 Ga0501035_0124159 3300049822 Bacteria 2254
293 Ga0501035_0159861 3300049822 Unclassified 1951
294 Ga0501035_0359290 3300049822 Bacteria 1217
295 Ga0501035_0483934 3300049822 Bacteria 1020
296 Ga0501044_0072976 3300049823 Bacteria 3488
297 Ga0501044_0081942 3300049823 Bacteria 3265
298 Ga0501044_0519501 3300049823 Bacteria 1090
299 Ga0501044_0834311 3300049823 Bacteria 799
300 Ga0501045_0047161 3300049824 Unclassified 3138
301 nmdc:mga05p37_447042_c1 3300050507 Bacteria 1497
302 nmdc:mga09592_1217734_c1 3300050508 Unclassified 622
303 nmdc:mga0qj67_6035_c1 3300050509 Bacteria 8874
304 nmdc:mga06r32_45974_c1 3300050510 Bacteria 4164
305 nmdc:mga0n895_28797_c1 3300050512 Bacteria 5289
306 nmdc:mga0n895_398191_c1 3300050512 Bacteria 1392
307 nmdc:mga0rr50_248482_c1 3300050513 Bacteria 1476
308 nmdc:mga0rr50_31187_c1 3300050513 Bacteria 3783
309 nmdc:mga08x19_27603_c1 3300050514 Bacteria 3551
310 nmdc:mga0a205_78443_c1 3300050515 Bacteria 3191
311 Ga0500647_0322341 3300053091 Bacteria 653
312 Ga0500583_0173634 3300053092 Bacteria 1073
313 Ga0500572_029376 3300053111 Unclassified 1521
314 Ga0500568_0174398 3300053139 Bacteria 791
315 Ga0500577_0353776 3300053142 Bacteria 642
316 Ga0500588_0001737 3300053146 Bacteria 4233
317 Ga0500611_110574 3300053727 Bacteria 722
318 Ga0501084_0034365 3300054114 Bacteria 4240
319 Ga0501084_0133977 3300054114 Bacteria 2085
320 Ga0501084_0452077 3300054114 Bacteria 1086
321 Ga0501084_0545941 3300054114 Bacteria 979
322 Ga0501082_0044801 3300060353 Bacteria 3815
323 Ga0501082_0241039 3300060353 Bacteria 1573
324 Ga0466962_0000191 3300061719 Bacteria 25547
325 Ga0530510_0000360 3300061734 Bacteria 29492
326 Ga0530510_0296744 3300061734 Bacteria 1209
327 Ga0265340_10221571
328 Ga0065715_10508457
329 Ga0070676_10047788
330 Ga0070690_100007718
331 Ga0070666_10000825
332 Ga0068868_100001561
333 Ga0068868_100126062
334 Ga0070689_100349967
335 Ga0070687_100431611
336 Ga0070674_100100710
337 Ga0070673_100032975
338 Ga0070667_100009226
339 Ga0070709_10050459
340 Ga0070714_100063399
341 Ga0070713_100003775
342 Ga0070711_100000263
343 Ga0070705_100085011
344 Ga0070708_100423251
345 Ga0070678_100000129
346 Ga0068867_100175481
347 Ga0070707_100019437
348 Ga0070699_100059561
349 Ga0070679_100378544
350 Ga0068853_100472236
351 Ga0070686_100720420
352 Ga0070665_100035039
353 Ga0070665_100042946
354 Ga0070704_100080401
355 Ga0068855_100001037
356 Ga0068856_100162642
357 Ga0068852_100767321
358 Ga0068859_100054356
359 Ga0068859_101873598
360 Ga0068864_100030057
361 Ga0068864_100444939
362 Ga0068866_10001569
363 Ga0068863_100142671
364 Ga0068858_100004518
365 Ga0068858_100159931
366 Ga0068860_100000100
367 Ga0068860_100006186
368 Ga0068860_101759482
369 Ga0070715_10001731
370 Ga0070716_100157593
371 Ga0070712_100016715
372 Ga0097621_100012611
373 Ga0068871_100016383
374 Ga0075428_100007575
375 Ga0075428_100563413
376 Ga0075430_100002965
377 Ga0075434_100005643
378 Ga0075429_100025040
379 Ga0075429_101319387
380 Ga0068865_100163359
381 Ga0075436_100035459
382 Ga0097620_100054355
383 Ga0097620_101873125
384 Ga0075435_100010536
385 Ga0105240_10000423
386 Ga0111539_10924052
387 Ga0105245_10011723
388 Ga0105245_10177237
389 Ga0114129_10087948
390 Ga0114129_10514025
391 Ga0105242_10001505
392 Ga0105248_10010045
393 Ga0105248_11032815
394 Ga0105237_10022049
395 Ga0105237_10362807
396 Ga0105238_10027762
397 Ga0105249_10173193
398 Ga0105239_10019609
399 Ga0157373_10056421
400 Ga0157374_10001326
401 Ga0157378_10004724
402 Ga0163162_10034192
403 Ga0163162_10187365
404 Ga0157372_10289930
405 Ga0157375_10021432
406 Ga0157380_11050945
407 Ga0157379_10034571
408 Ga0207642_10320696
409 Ga0207680_10094560
410 Ga0207685_10002919
411 Ga0207699_10009199
412 Ga0207645_10074003
413 Ga0207684_10075859
414 Ga0207695_10012966
415 Ga0207671_10587881
416 Ga0207693_10000060
417 Ga0207663_10063682
418 Ga0207662_10439872
419 Ga0207646_10078759
420 Ga0207694_10647193
421 Ga0207687_10132471
422 Ga0207700_10004851
423 Ga0207664_10039349
424 Ga0207644_10167352
425 Ga0207686_10087966
426 Ga0207704_10010187
427 Ga0207704_10707770
428 Ga0207665_10013127
429 Ga0207711_10387174
430 Ga0207667_10001116
431 Ga0207651_10040131
432 Ga0207658_10014029
433 Ga0207677_10162350
434 Ga0207677_10282731
435 Ga0207703_10131679
436 Ga0207703_10165676
437 Ga0207708_10500822
438 Ga0207702_10178408
439 Ga0207641_10230254
440 Ga0207676_10021266
441 Ga0207675_100230538
442 Ga0207675_100241782
443 Ga0207683_10000725
444 Ga0209998_10033114
445 Ga0209813_10098063
446 Ga0268266_10052731
447 Ga0268266_10382768
448 Ga0268264_10000002
449 Ga0268264_10307134
450 Ga0265327_10017962
451 Ga0307408_100195740
452 Ga0307508_10419484
453 Ga0307405_10552623
454 Ga0316577_10389342
455 Ga0307410_11138561
456 Ga0307406_10239538
457 Ga0307406_10427300
458 Ga0307412_10298963
459 Ga0307416_100131998
460 Ga0307416_101334326
461 Ga0307414_11061334
462 Ga0307414_11577196
463 Ga0316585_10182738
464 Ga0373944_0415601
465 Ga0373923_0239415
466 Ga0373945_0184126
467 Ga0373953_0068258
468 Ga0373943_0125319
469 Ga0373924_0053919
470 Ga0373924_0226142
471 Ga0373935_1195514
472 Ga0373927_0048140
473 Ga0373933_0252458
474 Ga0373933_0278341
475 Ga0373947_0025543
476 Ga0373937_0077341
477 Ga0373937_0524763
478 Ga0316584_0040575
479 Ga0436365_1488257
480 Ga0436360_1238331
481 Ga0439436_0009038
482 Ga0439465_0005441
483 Ga0439445_0008389
484 Ga0439444_0016462
485 Ga0466969_0000425
486 Ga0466969_0001362
487 Ga0466966_0000285
488 Ga0466966_0119997
489 Ga0466961_0063124
490 Ga0466964_0008477
491 Ga0453684_0083884
492 Ga0466971_0006649
493 Ga0466970_0005912
494 Ga0466959_0004362
495 Ga0466959_0212101
496 Ga0495629_0711099
497 Ga0495580_0053147
498 Ga0495580_0277303
499 Ga0495618_0077808
500 Ga0495628_0300568
501 Ga0495630_1033998
502 Ga0495630_1199750
503 Ga0495652_0677035
504 Ga0495665_0072535
505 Ga0495640_0537696
506 Ga0495587_0169881
507 Ga0495587_0176399
508 Ga0495645_0062732
509 Ga0495645_0177391
510 Ga0495634_0607941
511 Ga0495635_0235633
512 Ga0495657_0848966
513 Ga0495599_0276787
514 Ga0495599_0311882
515 Ga0495658_0041539
516 Ga0495604_0326750
517 Ga0495674_1023035
518 Ga0495684_0466639
519 Ga0496100_0036269
520 Ga0496102_0239875
521 Ga0496102_0356211
522 Ga0496104_0068830
523 Ga0496105_0011414
524 Ga0496106_0029524
525 Ga0496107_0006651
526 Ga0496108_0006755
527 Ga0496109_0001391
528 Ga0496110_0005095
529 Ga0496111_0040307
530 Ga0496112_0275445
531 Ga0496113_0014370
532 Ga0496114_0003264
533 Ga0496115_0053240
534 Ga0496117_0080406
535 Ga0496118_0061429
536 Ga0501298_008031
537 Ga0501031_0103179
538 Ga0501031_0212315
539 Ga0501032_0006962
540 Ga0501032_0089813
541 Ga0501032_0210541
542 Ga0501033_0066606
543 Ga0501033_0277236
544 Ga0501033_0649005
545 Ga0501034_0003280
546 Ga0501034_0039800
547 Ga0501034_0087412
548 Ga0501034_0237067
549 Ga0501034_1444137
550 Ga0501036_0169857
551 Ga0501036_0178812
552 Ga0501036_0583965
553 Ga0501036_1168182
554 Ga0501037_0149995
555 Ga0501037_0304886
556 Ga0501038_0117148
557 Ga0501038_0416352
558 Ga0501039_0058949
559 Ga0501039_0248016
560 Ga0501040_0026941
561 Ga0501041_0164470
562 Ga0501041_0581106
563 Ga0501042_0053182
564 Ga0501042_0095663
565 Ga0501043_0000450
566 Ga0501043_0057550
567 Ga0501043_0061206
568 Ga0501043_0331194
569 Ga0501043_0335686
570 Ga0501043_0639053
571 Ga0501046_0001281
572 Ga0501046_0041361
573 Ga0501046_0134152
574 Ga0501046_0402521
575 Ga0501046_0732032
576 Ga0501047_0000920
577 Ga0501047_0054100
578 Ga0501047_0142074
579 Ga0501047_0410500
580 Ga0501048_0015937
581 Ga0501048_0181392
582 Ga0501048_0258729
583 Ga0501067_0189835
584 Ga0501067_0191121
585 Ga0501067_0620727
586 Ga0501068_0006175
587 Ga0501068_0172717
588 Ga0501069_0138830
589 Ga0501070_0120896
590 Ga0501070_0497628
591 Ga0501070_1020194
592 Ga0501072_0027049
593 Ga0501072_0082267
594 Ga0501072_0299500
595 Ga0501073_0015214
596 Ga0501073_0032888
597 Ga0501073_0074324
598 Ga0501073_0147491
599 Ga0501073_0213751
600 Ga0501074_0770256
601 Ga0501074_1043500
602 Ga0501075_0052356
603 Ga0501075_0465941
604 Ga0501075_0842157
605 Ga0501076_0034227
606 Ga0501077_0410331
607 Ga0501253_115013
608 Ga0501079_0306920
609 Ga0501079_0621364
610 Ga0501080_0064289
611 Ga0501080_0219661
612 Ga0501080_0711193
613 Ga0501081_0145019
614 Ga0501083_0004499
615 Ga0501083_0110966
616 Ga0501083_0198299
617 Ga0501283_004835
618 Ga0501035_0124159
619 Ga0501035_0159861
620 Ga0501035_0359290
621 Ga0501035_0483934
622 Ga0501044_0072976
623 Ga0501044_0081942
624 Ga0501044_0519501
625 Ga0501044_0834311
626 Ga0501045_0047161
627 nmdc:mga05p37_447042_c1
628 nmdc:mga09592_1217734_c1
629 nmdc:mga0qj67_6035_c1
630 nmdc:mga06r32_45974_c1
631 nmdc:mga0n895_28797_c1
632 nmdc:mga0n895_398191_c1
633 nmdc:mga0rr50_248482_c1
634 nmdc:mga0rr50_31187_c1
635 nmdc:mga08x19_27603_c1
636 nmdc:mga0a205_78443_c1
637 Ga0500647_0322341
638 Ga0500583_0173634
639 Ga0500572_029376
640 Ga0500568_0174398
641 Ga0500577_0353776
642 Ga0500588_0001737
643 Ga0500611_110574
644 Ga0501084_0034365
645 Ga0501084_0133977
646 Ga0501084_0452077
647 Ga0501084_0545941
648 Ga0501082_0044801
649 Ga0501082_0241039
650 Ga0466962_0000191
651 Ga0530510_0000360
652 Ga0530510_0296744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

75

152

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

9

151

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

18

144

0.76

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

53

143

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9793 7 160
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.973 6 160
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9606 7 160
7ovv-assembly1.cif.gz_A crystal structure of the arabidopsis thaliana thialysine acetyltransferase atnata2 0.9327 8 152
7zkt-assembly3.cif.gz_F moss spermine/spermidine acetyl transferase (ppssat) in complex with coa and lysine 0.9313 6 157
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9823 6 162 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9793 7 160 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9653 4 162 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9606 7 160 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9409 6 162 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A315ZVP0-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9876 5 161 GO:0008080
AF-A0A7X8CKI2-F1-model_v4 GNAT family N-acetyltransferase 0.9874 6 147 GO:0008080
AF-A0A849K8H0-F1-model_v4 GNAT family N-acetyltransferase 0.9853 7 161 GO:0008080
AF-A0A838Y577-F1-model_v4 GNAT family N-acetyltransferase 0.9848 5 160 GO:0008080
AF-A0A7K2ZEV4-F1-model_v4 GNAT family N-acetyltransferase 0.9843 7 143 GO:0008080

Map