F408354

General Info

Members Datasets Scaffolds Average Seq Length
326 121 326 146

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_11020076|Ga0207660_110200761
Length 165
Sequence MNNLTRWEPVRETMTLRDAMDRLFDDAFTRPFSLMRDGGANWSSPAIDMYQTDNEVVVKAAVPGFKADEVQINVTGDVLTIKGESKHEEEKKDRSWQIREHRWGAFERSITLPTGVISDRATADFENGILTITLPKSVTSCLAKSPETRTAPLVKLAAFRPAGGW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
80 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
81 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
82 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
83 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
106 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
107 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
108 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
109 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
110 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.81
Metatranscriptomes 13.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_196118 2162886007 Bacteria 7826
2 JGI25406J46586_10004248 3300003203 Bacteria 6694
3 Ga0006777J48905_1047913 3300003308 Unclassified 585
4 Ga0006777J48905_1085600 3300003308 Bacteria 595
5 Ga0007429J51699_1076846 3300003579 Bacteria 570
6 Ga0006780_1021538 3300003735 Bacteria 592
7 Ga0058859_10988753 3300004798 Unclassified 573
8 Ga0058859_11814404 3300004798 Unclassified 510
9 Ga0058861_11541771 3300004800 Unclassified 552
10 Ga0058860_11717052 3300004801 Unclassified 558
11 Ga0058862_12444202 3300004803 Unclassified 537
12 Ga0058862_12833461 3300004803 Unclassified 581
13 Ga0065704_10070349 3300005289 Bacteria 30812
14 Ga0065704_10107715 3300005289 Bacteria 2049
15 Ga0065704_10622185 3300005289 Unclassified 582
16 Ga0065704_10833262 3300005289 Bacteria 514
17 Ga0065715_10010093 3300005293 Bacteria 3246
18 Ga0065707_10034543 3300005295 Bacteria 1436
19 Ga0065707_10081976 3300005295 Bacteria 26469
20 Ga0065707_10096103 3300005295 Bacteria 3304
21 Ga0065707_10104314 3300005295 Unclassified 2702
22 Ga0065707_10164824 3300005295 Bacteria 1531
23 Ga0065707_10283125 3300005295 Bacteria 1010
24 Ga0065707_10462246 3300005295 Bacteria 790
25 Ga0065707_10684717 3300005295 Bacteria 647
26 Ga0068869_101966255 3300005334 Unclassified 524
27 Ga0070680_100737291 3300005336 Bacteria 848
28 Ga0070680_100753310 3300005336 Bacteria 839
29 Ga0070680_100950406 3300005336 Unclassified 742
30 Ga0070680_101979593 3300005336 Bacteria 505
31 Ga0070689_100240446 3300005340 Bacteria 1491
32 Ga0070689_100303711 3300005340 Bacteria 1329
33 Ga0070689_101371247 3300005340 Bacteria 638
34 Ga0070689_101800178 3300005340 Unclassified 558
35 Ga0070687_100072487 3300005343 Bacteria 1854
36 Ga0070692_10533477 3300005345 Bacteria 766
37 Ga0070669_101231325 3300005353 Unclassified 647
38 Ga0070703_10090579 3300005406 Bacteria 1059
39 Ga0070705_100049224 3300005440 Bacteria 2446
40 Ga0070705_101003096 3300005440 Unclassified 678
41 Ga0070700_100161816 3300005441 Bacteria 1541
42 Ga0070694_100236945 3300005444 Bacteria 1375
43 Ga0070694_100793572 3300005444 Bacteria 776
44 Ga0070694_101308985 3300005444 Bacteria 610
45 Ga0068867_101126983 3300005459 Unclassified 717
46 Ga0070706_100493733 3300005467 Bacteria 1139
47 Ga0070706_101474761 3300005467 Unclassified 622
48 Ga0070706_101838478 3300005467 Unclassified 550
49 Ga0070707_100061639 3300005468 Bacteria 3598
50 Ga0070707_100748015 3300005468 Unclassified 941
51 Ga0070698_100040513 3300005471 Bacteria 4786
52 Ga0070698_100066058 3300005471 Unclassified 3641
53 Ga0070698_100117408 3300005471 Bacteria 2623
54 Ga0070698_100491538 3300005471 Unclassified 1165
55 Ga0070698_100522453 3300005471 Bacteria 1125
56 Ga0070698_100610125 3300005471 Bacteria 1032
57 Ga0070698_100695699 3300005471 Bacteria 958
58 Ga0070698_100711583 3300005471 Bacteria 946
59 Ga0070699_100026959 3300005518 Bacteria 4955
60 Ga0070699_100032083 3300005518 Bacteria 4536
61 Ga0070699_100032689 3300005518 Bacteria 4493
62 Ga0070699_100635657 3300005518 Unclassified 974
63 Ga0070699_100805028 3300005518 Bacteria 860
64 Ga0070697_101757760 3300005536 Bacteria 555
65 Ga0070695_100409801 3300005545 Unclassified 1030
66 Ga0070695_100814705 3300005545 Bacteria 749
67 Ga0070696_101788241 3300005546 Bacteria 531
68 Ga0070704_100178159 3300005549 Bacteria 1698
69 Ga0070704_100246269 3300005549 Bacteria 1465
70 Ga0070704_100681755 3300005549 Bacteria 910
71 Ga0070704_100881312 3300005549 Bacteria 804
72 Ga0068857_100878073 3300005577 Unclassified 859
73 Ga0068859_100004691 3300005617 Bacteria 13910
74 Ga0068859_100032311 3300005617 Bacteria 5257
75 Ga0068859_100235152 3300005617 Bacteria 1921
76 Ga0068859_100482411 3300005617 Bacteria 1335
77 Ga0068864_100247721 3300005618 Bacteria 1653
78 Ga0068864_100331880 3300005618 Bacteria 1431
79 Ga0068864_100948379 3300005618 Unclassified 851
80 Ga0068861_100536541 3300005719 Bacteria 1064
81 Ga0068861_101115863 3300005719 Bacteria 759
82 Ga0068870_10086825 3300005840 Bacteria 1741
83 Ga0068870_10418004 3300005840 Bacteria 877
84 Ga0068858_100993208 3300005842 Bacteria 822
85 Ga0068858_101104918 3300005842 Bacteria 778
86 Ga0068862_100004708 3300005844 Bacteria 11492
87 Ga0068862_100212646 3300005844 Unclassified 1748
88 Ga0081539_10010909 3300005985 Bacteria 7293
89 Ga0081539_10016689 3300005985 Bacteria 5220
90 Ga0081539_10077729 3300005985 Bacteria 1754
91 Ga0081539_10384592 3300005985 Unclassified 585
92 Ga0075427_10005204 3300006194 Bacteria 1848
93 Ga0075427_10085637 3300006194 Unclassified 574
94 Ga0075428_100074335 3300006844 Unclassified 3712
95 Ga0075428_100281806 3300006844 Unclassified 1788
96 Ga0075428_100847063 3300006844 Bacteria 971
97 Ga0075428_101327027 3300006844 Unclassified 756
98 Ga0075428_101533566 3300006844 Bacteria 698
99 Ga0075428_101555967 3300006844 Bacteria 692
100 Ga0075428_102265770 3300006844 Bacteria 559
101 Ga0075430_100006341 3300006846 Bacteria 9976
102 Ga0075430_100043102 3300006846 Bacteria 3814
103 Ga0075430_100155945 3300006846 Bacteria 1901
104 Ga0075430_100226425 3300006846 Bacteria 1551
105 Ga0075430_100362877 3300006846 Bacteria 1196
106 Ga0075430_100412665 3300006846 Unclassified 1115
107 Ga0075430_100568596 3300006846 Bacteria 935
108 Ga0075431_100070830 3300006847 Bacteria 3597
109 Ga0075431_100131328 3300006847 Bacteria 2583
110 Ga0075431_100150280 3300006847 Unclassified 2399
111 Ga0075431_100170072 3300006847 Bacteria 2239
112 Ga0075431_100419203 3300006847 Bacteria 1338
113 Ga0075431_101540214 3300006847 Unclassified 623
114 Ga0075433_10494202 3300006852 Unclassified 1077
115 Ga0075433_11320520 3300006852 Unclassified 625
116 Ga0075429_100000137 3300006880 Bacteria 44168
117 Ga0075429_100012774 3300006880 Bacteria 7284
118 Ga0075429_100015293 3300006880 Bacteria 6650
119 Ga0075429_100102030 3300006880 Bacteria 2505
120 Ga0075429_100157527 3300006880 Unclassified 1988
121 Ga0075429_100189470 3300006880 Unclassified 1802
122 Ga0075429_100252250 3300006880 Unclassified 1545
123 Ga0075429_100291137 3300006880 Bacteria 1430
124 Ga0075429_100366202 3300006880 Unclassified 1262
125 Ga0075429_100623802 3300006880 Bacteria 945
126 Ga0075429_100741391 3300006880 Bacteria 860
127 Ga0068865_101162343 3300006881 Bacteria 682
128 Ga0097620_100004691 3300006931 Bacteria 13910
129 Ga0097620_100032310 3300006931 Bacteria 5257
130 Ga0097620_100235149 3300006931 Bacteria 1921
131 Ga0097620_100482402 3300006931 Bacteria 1335
132 Ga0111539_11913677 3300009094 Unclassified 688
133 Ga0111539_12092055 3300009094 Unclassified 657
134 Ga0114129_10002746 3300009147 Bacteria 24536
135 Ga0114129_10006416 3300009147 Bacteria 16677
136 Ga0114129_10013226 3300009147 Bacteria 11753
137 Ga0114129_10076862 3300009147 Bacteria 4646
138 Ga0114129_10092649 3300009147 Bacteria 4186
139 Ga0114129_10245951 3300009147 Bacteria 2403
140 Ga0114129_10329276 3300009147 Unclassified 2028
141 Ga0114129_10399922 3300009147 Unclassified 1810
142 Ga0114129_10530318 3300009147 Bacteria 1534
143 Ga0114129_10648806 3300009147 Bacteria 1363
144 Ga0114129_12620808 3300009147 Bacteria 601
145 Ga0105243_10245284 3300009148 Bacteria 1596
146 Ga0105243_10249567 3300009148 Bacteria 1584
147 Ga0105243_10251271 3300009148 Bacteria 1579
148 Ga0105243_10398477 3300009148 Bacteria 1278
149 Ga0105249_10040397 3300009553 Bacteria 4237
150 Ga0105249_10620377 3300009553 Unclassified 1137
151 Ga0105249_10661259 3300009553 Bacteria 1103
152 Ga0105246_10025443 3300011119 Bacteria 3858
153 Ga0197907_10369913 3300020069 Unclassified 505
154 Ga0206356_10306416 3300020070 Unclassified 541
155 Ga0206356_10621144 3300020070 Unclassified 573
156 Ga0206349_1353194 3300020075 Unclassified 589
157 Ga0206351_10130959 3300020077 Unclassified 511
158 Ga0206351_10272933 3300020077 Bacteria 502
159 Ga0206351_10284128 3300020077 Bacteria 607
160 Ga0206351_10543805 3300020077 Unclassified 578
161 Ga0206351_10975273 3300020077 Bacteria 571
162 Ga0206352_10553937 3300020078 Unclassified 500
163 Ga0206352_10600906 3300020078 Unclassified 591
164 Ga0206352_11051235 3300020078 Bacteria 566
165 Ga0206350_10002614 3300020080 Unclassified 569
166 Ga0206350_10020820 3300020080 Unclassified 558
167 Ga0206350_11211298 3300020080 Unclassified 512
168 Ga0206350_11413039 3300020080 Bacteria 615
169 Ga0206354_10117395 3300020081 Bacteria 560
170 Ga0206354_10120529 3300020081 Unclassified 600
171 Ga0206354_10445799 3300020081 Bacteria 579
172 Ga0206354_10488000 3300020081 Bacteria 683
173 Ga0206354_10612655 3300020081 Bacteria 620
174 Ga0206354_10813375 3300020081 Unclassified 553
175 Ga0206353_10283791 3300020082 Unclassified 513
176 Ga0206353_12054578 3300020082 Unclassified 549
177 Ga0154015_1251456 3300020610 Unclassified 573
178 Ga0207653_10018489 3300025885 Bacteria 2194
179 Ga0207643_10679925 3300025908 Bacteria 665
180 Ga0207684_10492679 3300025910 Bacteria 1051
181 Ga0207660_11020076 3300025917 Bacteria 675
182 Ga0207646_10138860 3300025922 Bacteria 2188
183 Ga0207681_11092770 3300025923 Unclassified 670
184 Ga0207709_10336046 3300025935 Unclassified 1135
185 Ga0207670_10084028 3300025936 Bacteria 2234
186 Ga0207670_10252967 3300025936 Bacteria 1362
187 Ga0207670_10328250 3300025936 Bacteria 1205
188 Ga0207712_11483092 3300025961 Bacteria 607
189 Ga0207658_11193531 3300025986 Bacteria 696
190 Ga0207703_10547416 3300026035 Bacteria 1091
191 Ga0207703_10913662 3300026035 Bacteria 841
192 Ga0207648_10507551 3300026089 Bacteria 1104
193 Ga0207676_10212500 3300026095 Bacteria 1717
194 Ga0207674_10047797 3300026116 Bacteria 4384
195 Ga0207674_10287254 3300026116 Bacteria 1593
196 Ga0207675_100004153 3300026118 Bacteria 14016
197 Ga0207675_100566746 3300026118 Bacteria 1136
198 Ga0207675_100748998 3300026118 Bacteria 988
199 Ga0209999_1047366 3300027543 Bacteria 809
200 Ga0268265_10020684 3300028380 Bacteria 4598
201 Ga0268265_10134301 3300028380 Unclassified 2062
202 Ga0311004_106649 3300029276 Unclassified 684
203 Ga0311001_1037031 3300029277 Bacteria 560
204 Ga0311001_1050343 3300029277 Unclassified 515
205 Ga0311011_110316 3300029280 Bacteria 604
206 Ga0311011_112782 3300029280 Unclassified 619
207 Ga0310982_133721 3300029283 Bacteria 500
208 Ga0310982_141326 3300029283 Unclassified 733
209 Ga0310981_1000047 3300029285 Unclassified 575
210 Ga0307405_10240408 3300031731 Bacteria 1341
211 Ga0307405_10519154 3300031731 Bacteria 958
212 Ga0307410_10281737 3300031852 Unclassified 1305
213 Ga0307410_10556955 3300031852 Unclassified 951
214 Ga0307406_10270933 3300031901 Unclassified 1290
215 Ga0307407_10300352 3300031903 Bacteria 1119
216 Ga0307409_100824412 3300031995 Bacteria 937
217 Ga0307416_100477795 3300032002 Bacteria 1305
218 Ga0307416_100543686 3300032002 Bacteria 1234
219 Ga0307416_100798173 3300032002 Bacteria 1039
220 Ga0307416_100901662 3300032002 Unclassified 984
221 Ga0307415_100237722 3300032126 Unclassified 1471
222 Ga0373949_0063862 3300035090 Unclassified 953
223 Ga0439433_0065971 3300041999 Bacteria 868
224 Ga0451577_0028464 3300042876 Bacteria 5054
225 Ga0451577_0111352 3300042876 Bacteria 2449
226 Ga0451577_0149335 3300042876 Unclassified 2102
227 Ga0451577_0412090 3300042876 Bacteria 1227
228 Ga0451577_0462010 3300042876 Bacteria 1153
229 Ga0451577_0760895 3300042876 Bacteria 876
230 Ga0451577_0783639 3300042876 Bacteria 862
231 Ga0453683_0048139 3300044673 Bacteria 2674
232 Ga0453683_0165884 3300044673 Unclassified 1398
233 Ga0453683_0259608 3300044673 Bacteria 1108
234 Ga0453683_0520112 3300044673 Unclassified 773
235 Ga0453684_0000003 3300044712 Bacteria 1481694
236 Ga0453684_0000447 3300044712 Bacteria 166799
237 Ga0453684_0001179 3300044712 Bacteria 81099
238 Ga0453684_0026190 3300044712 Bacteria 8436
239 Ga0453684_0027616 3300044712 Bacteria 8130
240 Ga0453684_0056843 3300044712 Bacteria 5071
241 Ga0453684_0063726 3300044712 Bacteria 4713
242 Ga0453684_0082336 3300044712 Bacteria 4009
243 Ga0453684_0176450 3300044712 Bacteria 2513
244 Ga0453684_0185260 3300044712 Bacteria 2440
245 Ga0453684_0412653 3300044712 Unclassified 1510
246 Ga0453684_0568883 3300044712 Bacteria 1246
247 Ga0453684_0632172 3300044712 Bacteria 1170
248 Ga0453684_0685607 3300044712 Unclassified 1115
249 Ga0453684_0903702 3300044712 Bacteria 945
250 Ga0453684_0968788 3300044712 Bacteria 907
251 Ga0453684_1155894 3300044712 Unclassified 815
252 Ga0453684_1450718 3300044712 Bacteria 710
253 Ga0453684_1500340 3300044712 Bacteria 695
254 Ga0453684_2088932 3300044712 Unclassified 568
255 Ga0453684_2182158 3300044712 Unclassified 553
256 Ga0451576_0009907 3300045051 Bacteria 11003
257 Ga0451576_0025161 3300045051 Bacteria 6417
258 Ga0451576_0063878 3300045051 Unclassified 3836
259 Ga0451576_0080642 3300045051 Bacteria 3385
260 Ga0451576_0292694 3300045051 Bacteria 1702
261 Ga0451576_1050872 3300045051 Bacteria 853
262 Ga0451576_1750289 3300045051 Unclassified 643
263 Ga0501299_007927 3300049522 Bacteria 1712
264 Ga0501036_0673057 3300049572 Unclassified 856
265 Ga0501036_1310957 3300049572 Unclassified 588
266 Ga0501039_0227035 3300049575 Bacteria 1468
267 Ga0501040_0330553 3300049576 Bacteria 1091
268 Ga0501048_1120475 3300049582 Unclassified 566
269 Ga0501048_1400842 3300049582 Unclassified 502
270 Ga0501072_0649075 3300049588 Bacteria 831
271 Ga0501072_0981841 3300049588 Bacteria 659
272 Ga0501075_0028189 3300049591 Bacteria 4144
273 Ga0501076_0027859 3300049592 Bacteria 4382
274 Ga0501076_0161229 3300049592 Unclassified 1827
275 Ga0501076_1045419 3300049592 Unclassified 673
276 Ga0501216_052410 3300049660 Bacteria 805
277 Ga0501222_025506 3300049662 Unclassified 801
278 Ga0501227_134515 3300049665 Unclassified 675
279 Ga0501243_101136 3300049675 Unclassified 582
280 Ga0501253_204723 3300049683 Unclassified 522
281 Ga0501257_054467 3300049686 Bacteria 1002
282 Ga0501079_0240079 3300049741 Bacteria 1416
283 Ga0501080_0716880 3300049742 Bacteria 881
284 Ga0501080_1724624 3300049742 Unclassified 528
285 Ga0501081_1386184 3300049743 Bacteria 533
286 Ga0501283_098304 3300049779 Unclassified 567
287 nmdc:mga05p37_11032_c1 3300050507 Bacteria 10735
288 nmdc:mga05p37_11061_c1 3300050507 Bacteria 10722
289 nmdc:mga05p37_213337_c1 3300050507 Bacteria 2333
290 nmdc:mga05p37_24508_c1 3300050507 Bacteria 7335
291 nmdc:mga05p37_3837_c1 3300050507 Bacteria 17586
292 nmdc:mga05p37_468117_c1 3300050507 Unclassified 1017
293 nmdc:mga05p37_745213_c1 3300050507 Bacteria 1081
294 nmdc:mga05p37_77045_c1 3300050507 Bacteria 4105
295 nmdc:mga09592_166568_c1 3300050508 Bacteria 1905
296 nmdc:mga09592_1684898_c1 3300050508 Bacteria 512
297 nmdc:mga09592_17182_c1 3300050508 Bacteria 5924
298 nmdc:mga09592_194_c1 3300050508 Bacteria 43708
299 nmdc:mga09592_208564_c1 3300050508 Unclassified 1693
300 nmdc:mga09592_254446_c1 3300050508 Bacteria 1522
301 nmdc:mga09592_326092_c1 3300050508 Unclassified 1330
302 nmdc:mga09592_344_c1 3300050508 Bacteria 11087
303 nmdc:mga09592_360329_c1 3300050508 Bacteria 1258
304 nmdc:mga09592_484658_c1 3300050508 Unclassified 1065
305 nmdc:mga09592_525340_c1 3300050508 Unclassified 1018
306 nmdc:mga09592_76058_c1 3300050508 Bacteria 2855
307 nmdc:mga09592_90678_c1 3300050508 Bacteria 2612
308 nmdc:mga0qj67_1049509_c1 3300050509 Bacteria 638
309 nmdc:mga0qj67_15626_c1 3300050509 Bacteria 5749
310 nmdc:mga0qj67_228445_c1 3300050509 Bacteria 1510
311 nmdc:mga0qj67_344826_c1 3300050509 Bacteria 1204
312 nmdc:mga0qj67_39931_c1 3300050509 Bacteria 3687
313 nmdc:mga0qj67_436534_c1 3300050509 Unclassified 1055
314 nmdc:mga0qj67_628546_c1 3300050509 Unclassified 858
315 nmdc:mga06r32_283276_c1 3300050510 Bacteria 1644
316 nmdc:mga06r32_438881_c1 3300050510 Unclassified 1286
317 nmdc:mga06r32_724857_c1 3300050510 Bacteria 959
318 nmdc:mga06r32_84688_c1 3300050510 Bacteria 3090
319 nmdc:mga06r32_872155_c1 3300050510 Bacteria 858
320 nmdc:mga0a205_1535519_c1 3300050515 Bacteria 514
321 nmdc:mga0a205_206876_c1 3300050515 Bacteria 1851
322 nmdc:mga0a205_384143_c1 3300050515 Bacteria 1269
323 nmdc:mga0a205_829571_c1 3300050515 Bacteria 772
324 Ga0501084_0275025 3300054114 Bacteria 1422
325 Ga0501084_1230536 3300054114 Bacteria 628
326 Ga0501082_0156051 3300060353 Bacteria 1983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100117408 Ga0070698_1001174082 125
2 3300044712 Ga0453684_1500340 Ga0453684_1500340_293_679 128
3 3300049522 Ga0501299_007927 Ga0501299_007927_381_779 130
4 3300045051 Ga0451576_1050872 Ga0451576_1050872_308_712 132
5 3300005471 Ga0070698_100522453 Ga0070698_1005224531 133
6 3300005518 Ga0070699_100026959 Ga0070699_1000269596 133
7 3300005518 Ga0070699_100032083 Ga0070699_1000320835 133
8 3300009553 Ga0105249_10040397 Ga0105249_100403971 133
9 3300035090 Ga0373949_0063862 Ga0373949_0063862_216_620 134
10 3300042876 Ga0451577_0028464 Ga0451577_0028464_4039_4449 134
11 3300042876 Ga0451577_0760895 Ga0451577_0760895_271_702 134
12 3300042876 Ga0451577_0783639 Ga0451577_0783639_408_812 134
13 3300044673 Ga0453683_0520112 Ga0453683_0520112_303_707 134
14 3300044712 Ga0453684_0056843 Ga0453684_0056843_146_556 134
15 3300044712 Ga0453684_0632172 Ga0453684_0632172_678_1088 134
16 3300044712 Ga0453684_1450718 Ga0453684_1450718_245_655 134
17 3300044712 Ga0453684_2088932 Ga0453684_2088932_16_420 134
18 3300044712 Ga0453684_2182158 Ga0453684_2182158_62_472 134
19 3300045051 Ga0451576_1750289 Ga0451576_1750289_208_621 134
20 3300049572 Ga0501036_1310957 Ga0501036_1310957_32_436 134
21 3300050507 nmdc:mga05p37_11061_c1 nmdc:mga05p37_11061_c1_1999_2403 134
22 3300050508 nmdc:mga09592_17182_c1 nmdc:mga09592_17182_c1_638_1042 134
23 3300050508 nmdc:mga09592_326092_c1 nmdc:mga09592_326092_c1_630_1034 134
24 3300050508 nmdc:mga09592_76058_c1 nmdc:mga09592_76058_c1_2093_2497 134
25 3300050509 nmdc:mga0qj67_15626_c1 nmdc:mga0qj67_15626_c1_575_979 134
26 3300050510 nmdc:mga06r32_283276_c1 nmdc:mga06r32_283276_c1_842_1246 134
27 3300009147 Ga0114129_10006416 Ga0114129_100064163 135
28 3300009147 Ga0114129_10092649 Ga0114129_100926492 135
29 3300009147 Ga0114129_10399922 Ga0114129_103999221 135
30 3300009147 Ga0114129_10530318 Ga0114129_105303182 135
31 3300009147 Ga0114129_10648806 Ga0114129_106488062 135
32 3300029276 Ga0311004_106649 Ga0311004_1066491 135
33 3300029283 Ga0310982_141326 Ga0310982_1413261 135
34 3300041999 Ga0439433_0065971 Ga0439433_0065971_19_426 135
35 3300042876 Ga0451577_0149335 Ga0451577_0149335_197_604 135
36 3300044712 Ga0453684_0000447 Ga0453684_0000447_13808_14215 135
37 3300044712 Ga0453684_0903702 Ga0453684_0903702_67_474 135
38 3300044712 Ga0453684_1155894 Ga0453684_1155894_376_783 135
39 3300045051 Ga0451576_0009907 Ga0451576_0009907_4800_5207 135
40 3300045051 Ga0451576_0063878 Ga0451576_0063878_288_695 135
41 3300045051 Ga0451576_0080642 Ga0451576_0080642_571_1005 135
42 3300049572 Ga0501036_0673057 Ga0501036_0673057_270_677 135
43 3300049575 Ga0501039_0227035 Ga0501039_0227035_352_759 135
44 3300049582 Ga0501048_1120475 Ga0501048_1120475_52_459 135
45 3300049582 Ga0501048_1400842 Ga0501048_1400842_21_428 135
46 3300049588 Ga0501072_0981841 Ga0501072_0981841_200_607 135
47 3300049592 Ga0501076_1045419 Ga0501076_1045419_227_634 135
48 3300049662 Ga0501222_025506 Ga0501222_025506_85_492 135
49 3300049683 Ga0501253_204723 Ga0501253_204723_37_444 135
50 3300049742 Ga0501080_1724624 Ga0501080_1724624_56_463 135
51 3300050507 nmdc:mga05p37_213337_c1 nmdc:mga05p37_213337_c1_993_1409 135
52 3300050507 nmdc:mga05p37_24508_c1 nmdc:mga05p37_24508_c1_3477_3884 135
53 3300050507 nmdc:mga05p37_3837_c1 nmdc:mga05p37_3837_c1_15704_16126 135
54 3300050507 nmdc:mga05p37_468117_c1 nmdc:mga05p37_468117_c1_525_941 135
55 3300050508 nmdc:mga09592_1684898_c1 nmdc:mga09592_1684898_c1_83_499 135
56 3300050508 nmdc:mga09592_194_c1 nmdc:mga09592_194_c1_319_726 135
57 3300050508 nmdc:mga09592_208564_c1 nmdc:mga09592_208564_c1_355_771 135
58 3300050508 nmdc:mga09592_254446_c1 nmdc:mga09592_254446_c1_690_1112 135
59 3300050508 nmdc:mga09592_344_c1 nmdc:mga09592_344_c1_7188_7610 135
60 3300050508 nmdc:mga09592_360329_c1 nmdc:mga09592_360329_c1_453_860 135
61 3300050508 nmdc:mga09592_525340_c1 nmdc:mga09592_525340_c1_462_878 135
62 3300050509 nmdc:mga0qj67_228445_c1 nmdc:mga0qj67_228445_c1_662_1069 135
63 3300050509 nmdc:mga0qj67_39931_c1 nmdc:mga0qj67_39931_c1_2762_3169 135
64 3300050509 nmdc:mga0qj67_436534_c1 nmdc:mga0qj67_436534_c1_584_1006 135
65 3300050509 nmdc:mga0qj67_628546_c1 nmdc:mga0qj67_628546_c1_310_726 135
66 3300050510 nmdc:mga06r32_438881_c1 nmdc:mga06r32_438881_c1_657_1073 135
67 3300050515 nmdc:mga0a205_1535519_c1 nmdc:mga0a205_1535519_c1_76_483 135
68 3300050515 nmdc:mga0a205_206876_c1 nmdc:mga0a205_206876_c1_294_710 135
69 3300050515 nmdc:mga0a205_384143_c1 nmdc:mga0a205_384143_c1_816_1223 135
70 3300050515 nmdc:mga0a205_829571_c1 nmdc:mga0a205_829571_c1_22_429 135
71 3300054114 Ga0501084_1230536 Ga0501084_1230536_110_517 135
72 3300049576 Ga0501040_0330553 Ga0501040_0330553_635_1051 138
73 3300049588 Ga0501072_0649075 Ga0501072_0649075_398_814 138
74 3300049591 Ga0501075_0028189 Ga0501075_0028189_841_1257 138
75 3300049592 Ga0501076_0027859 Ga0501076_0027859_1069_1485 138
76 3300049592 Ga0501076_0161229 Ga0501076_0161229_554_970 138
77 3300049741 Ga0501079_0240079 Ga0501079_0240079_473_889 138
78 3300049742 Ga0501080_0716880 Ga0501080_0716880_324_740 138
79 3300049743 Ga0501081_1386184 Ga0501081_1386184_94_510 138
80 3300054114 Ga0501084_0275025 Ga0501084_0275025_761_1177 138
81 3300060353 Ga0501082_0156051 Ga0501082_0156051_816_1232 138
82 3300042876 Ga0451577_0111352 Ga0451577_0111352_1863_2303 145
83 3300044712 Ga0453684_0000003 Ga0453684_0000003_155049_155489 145
84 3300044712 Ga0453684_0026190 Ga0453684_0026190_6523_6960 145
85 3300044712 Ga0453684_0412653 Ga0453684_0412653_1013_1450 145
86 3300003203 JGI25406J46586_10004248 JGI25406J46586_100042487 146
87 3300003308 Ga0006777J48905_1047913 Ga0006777J48905_10479131 146
88 3300003308 Ga0006777J48905_1085600 Ga0006777J48905_10856001 146
89 3300003579 Ga0007429J51699_1076846 Ga0007429J51699_10768461 146
90 3300003735 Ga0006780_1021538 Ga0006780_10215381 146
91 3300004798 Ga0058859_10988753 Ga0058859_109887531 146
92 3300004800 Ga0058861_11541771 Ga0058861_115417711 146
93 3300004801 Ga0058860_11717052 Ga0058860_117170521 146
94 3300004803 Ga0058862_12444202 Ga0058862_124442021 146
95 3300005289 Ga0065704_10107715 Ga0065704_101077152 146
96 3300005289 Ga0065704_10833262 Ga0065704_108332621 146
97 3300005295 Ga0065707_10096103 Ga0065707_100961035 146
98 3300005295 Ga0065707_10104314 Ga0065707_101043141 146
99 3300005295 Ga0065707_10283125 Ga0065707_102831251 146
100 3300005295 Ga0065707_10462246 Ga0065707_104622462 146
101 3300005336 Ga0070680_100950406 Ga0070680_1009504061 146
102 3300005336 Ga0070680_101979593 Ga0070680_1019795931 146
103 3300005340 Ga0070689_100240446 Ga0070689_1002404462 146
104 3300005340 Ga0070689_101371247 Ga0070689_1013712471 146
105 3300005345 Ga0070692_10533477 Ga0070692_105334772 146
106 3300005440 Ga0070705_101003096 Ga0070705_1010030961 146
107 3300005444 Ga0070694_100236945 Ga0070694_1002369453 146
108 3300005459 Ga0068867_101126983 Ga0068867_1011269831 146
109 3300005467 Ga0070706_101838478 Ga0070706_1018384781 146
110 3300005468 Ga0070707_100061639 Ga0070707_1000616391 146
111 3300005471 Ga0070698_100610125 Ga0070698_1006101252 146
112 3300005518 Ga0070699_100805028 Ga0070699_1008050281 146
113 3300005546 Ga0070696_101788241 Ga0070696_1017882411 146
114 3300005549 Ga0070704_100881312 Ga0070704_1008813121 146
115 3300005617 Ga0068859_100235152 Ga0068859_1002351521 146
116 3300005617 Ga0068859_100482411 Ga0068859_1004824112 146
117 3300005618 Ga0068864_100948379 Ga0068864_1009483792 146
118 3300005719 Ga0068861_100536541 Ga0068861_1005365411 146
119 3300005985 Ga0081539_10010909 Ga0081539_100109092 146
120 3300005985 Ga0081539_10384592 Ga0081539_103845921 146
121 3300006194 Ga0075427_10005204 Ga0075427_100052042 146
122 3300006844 Ga0075428_101327027 Ga0075428_1013270271 146
123 3300006844 Ga0075428_102265770 Ga0075428_1022657701 146
124 3300006846 Ga0075430_100006341 Ga0075430_1000063414 146
125 3300006846 Ga0075430_100226425 Ga0075430_1002264252 146
126 3300006847 Ga0075431_100150280 Ga0075431_1001502801 146
127 3300006847 Ga0075431_100170072 Ga0075431_1001700721 146
128 3300006880 Ga0075429_100012774 Ga0075429_1000127743 146
129 3300006880 Ga0075429_100366202 Ga0075429_1003662021 146
130 3300006880 Ga0075429_100741391 Ga0075429_1007413912 146
131 3300006931 Ga0097620_100235149 Ga0097620_1002351491 146
132 3300006931 Ga0097620_100482402 Ga0097620_1004824021 146
133 3300009094 Ga0111539_11913677 Ga0111539_119136771 146
134 3300009147 Ga0114129_10013226 Ga0114129_100132269 146
135 3300009147 Ga0114129_10076862 Ga0114129_100768624 146
136 3300009148 Ga0105243_10251271 Ga0105243_102512711 146
137 3300009553 Ga0105249_10620377 Ga0105249_106203772 146
138 3300020069 Ga0197907_10369913 Ga0197907_103699131 146
139 3300020070 Ga0206356_10306416 Ga0206356_103064161 146
140 3300020075 Ga0206349_1353194 Ga0206349_13531941 146
141 3300020077 Ga0206351_10130959 Ga0206351_101309591 146
142 3300020077 Ga0206351_10543805 Ga0206351_105438051 146
143 3300020077 Ga0206351_10975273 Ga0206351_109752731 146
144 3300020078 Ga0206352_10600906 Ga0206352_106009061 146
145 3300020078 Ga0206352_11051235 Ga0206352_110512351 146
146 3300020080 Ga0206350_10002614 Ga0206350_100026141 146
147 3300020080 Ga0206350_10020820 Ga0206350_100208201 146
148 3300020080 Ga0206350_11211298 Ga0206350_112112981 146
149 3300020080 Ga0206350_11413039 Ga0206350_114130391 146
150 3300020081 Ga0206354_10117395 Ga0206354_101173951 146
151 3300020081 Ga0206354_10120529 Ga0206354_101205291 146
152 3300020081 Ga0206354_10488000 Ga0206354_104880002 146
153 3300020081 Ga0206354_10813375 Ga0206354_108133751 146
154 3300020082 Ga0206353_10283791 Ga0206353_102837911 146
155 3300020082 Ga0206353_12054578 Ga0206353_120545781 146
156 3300020610 Ga0154015_1251456 Ga0154015_12514561 146
157 3300025922 Ga0207646_10138860 Ga0207646_101388603 146
158 3300025936 Ga0207670_10328250 Ga0207670_103282502 146
159 3300026089 Ga0207648_10507551 Ga0207648_105075512 146
160 3300026118 Ga0207675_100004153 Ga0207675_10000415312 146
161 3300026118 Ga0207675_100566746 Ga0207675_1005667462 146
162 3300027543 Ga0209999_1047366 Ga0209999_10473661 146
163 3300028380 Ga0268265_10020684 Ga0268265_100206843 146
164 3300029280 Ga0311011_112782 Ga0311011_1127821 146
165 3300031731 Ga0307405_10240408 Ga0307405_102404082 146
166 3300032002 Ga0307416_100543686 Ga0307416_1005436861 146
167 3300032002 Ga0307416_100798173 Ga0307416_1007981732 146
168 3300042876 Ga0451577_0412090 Ga0451577_0412090_374_814 146
169 3300042876 Ga0451577_0462010 Ga0451577_0462010_492_932 146
170 3300044712 Ga0453684_0001179 Ga0453684_0001179_798_1238 146
171 3300044712 Ga0453684_0027616 Ga0453684_0027616_7157_7603 146
172 3300044712 Ga0453684_0063726 Ga0453684_0063726_2181_2621 146
173 3300044712 Ga0453684_0176450 Ga0453684_0176450_125_565 146
174 3300044712 Ga0453684_0185260 Ga0453684_0185260_1354_1794 146
175 3300044712 Ga0453684_0568883 Ga0453684_0568883_796_1236 146
176 3300045051 Ga0451576_0025161 Ga0451576_0025161_5587_6033 146
177 3300050507 nmdc:mga05p37_11032_c1 nmdc:mga05p37_11032_c1_6514_6954 146
178 3300050507 nmdc:mga05p37_745213_c1 nmdc:mga05p37_745213_c1_566_1006 146
179 3300050508 nmdc:mga09592_90678_c1 nmdc:mga09592_90678_c1_558_998 146
180 3300050509 nmdc:mga0qj67_1049509_c1 nmdc:mga0qj67_1049509_c1_149_589 146
181 3300050510 nmdc:mga06r32_724857_c1 nmdc:mga06r32_724857_c1_419_862 146
182 3300050510 nmdc:mga06r32_872155_c1 nmdc:mga06r32_872155_c1_321_761 146
183 2162886007 SwRhRL2b_contig_196118 SwRhRL2b_0896.00001260 147
184 3300004798 Ga0058859_11814404 Ga0058859_118144041 147
185 3300004803 Ga0058862_12833461 Ga0058862_128334611 147
186 3300005289 Ga0065704_10070349 Ga0065704_1007034924 147
187 3300005289 Ga0065704_10622185 Ga0065704_106221851 147
188 3300005293 Ga0065715_10010093 Ga0065715_100100933 147
189 3300005295 Ga0065707_10034543 Ga0065707_100345431 147
190 3300005295 Ga0065707_10081976 Ga0065707_1008197618 147
191 3300005295 Ga0065707_10164824 Ga0065707_101648241 147
192 3300005295 Ga0065707_10684717 Ga0065707_106847171 147
193 3300005334 Ga0068869_101966255 Ga0068869_1019662551 147
194 3300005336 Ga0070680_100737291 Ga0070680_1007372911 147
195 3300005336 Ga0070680_100753310 Ga0070680_1007533101 147
196 3300005340 Ga0070689_100303711 Ga0070689_1003037111 147
197 3300005340 Ga0070689_101800178 Ga0070689_1018001781 147
198 3300005343 Ga0070687_100072487 Ga0070687_1000724871 147
199 3300005353 Ga0070669_101231325 Ga0070669_1012313251 147
200 3300005406 Ga0070703_10090579 Ga0070703_100905792 147
201 3300005440 Ga0070705_100049224 Ga0070705_1000492242 147
202 3300005441 Ga0070700_100161816 Ga0070700_1001618162 147
203 3300005444 Ga0070694_100793572 Ga0070694_1007935721 147
204 3300005444 Ga0070694_101308985 Ga0070694_1013089851 147
205 3300005467 Ga0070706_100493733 Ga0070706_1004937332 147
206 3300005467 Ga0070706_101474761 Ga0070706_1014747611 147
207 3300005468 Ga0070707_100748015 Ga0070707_1007480152 147
208 3300005471 Ga0070698_100040513 Ga0070698_1000405135 147
209 3300005471 Ga0070698_100066058 Ga0070698_1000660583 147
210 3300005471 Ga0070698_100491538 Ga0070698_1004915382 147
211 3300005471 Ga0070698_100695699 Ga0070698_1006956991 147
212 3300005471 Ga0070698_100711583 Ga0070698_1007115831 147
213 3300005518 Ga0070699_100032689 Ga0070699_1000326893 147
214 3300005518 Ga0070699_100635657 Ga0070699_1006356571 147
215 3300005536 Ga0070697_101757760 Ga0070697_1017577601 147
216 3300005545 Ga0070695_100409801 Ga0070695_1004098012 147
217 3300005545 Ga0070695_100814705 Ga0070695_1008147052 147
218 3300005549 Ga0070704_100178159 Ga0070704_1001781592 147
219 3300005549 Ga0070704_100246269 Ga0070704_1002462692 147
220 3300005549 Ga0070704_100681755 Ga0070704_1006817552 147
221 3300005577 Ga0068857_100878073 Ga0068857_1008780732 147
222 3300005617 Ga0068859_100004691 Ga0068859_1000046913 147
223 3300005617 Ga0068859_100032311 Ga0068859_1000323112 147
224 3300005618 Ga0068864_100247721 Ga0068864_1002477212 147
225 3300005618 Ga0068864_100331880 Ga0068864_1003318802 147
226 3300005719 Ga0068861_101115863 Ga0068861_1011158632 147
227 3300005840 Ga0068870_10086825 Ga0068870_100868253 147
228 3300005840 Ga0068870_10418004 Ga0068870_104180042 147
229 3300005842 Ga0068858_100993208 Ga0068858_1009932081 147
230 3300005842 Ga0068858_101104918 Ga0068858_1011049181 147
231 3300005844 Ga0068862_100004708 Ga0068862_1000047084 147
232 3300005844 Ga0068862_100212646 Ga0068862_1002126463 147
233 3300005985 Ga0081539_10016689 Ga0081539_100166896 147
234 3300005985 Ga0081539_10077729 Ga0081539_100777293 147
235 3300006194 Ga0075427_10085637 Ga0075427_100856371 147
236 3300006844 Ga0075428_100074335 Ga0075428_1000743352 147
237 3300006844 Ga0075428_100281806 Ga0075428_1002818061 147
238 3300006844 Ga0075428_100847063 Ga0075428_1008470631 147
239 3300006844 Ga0075428_101533566 Ga0075428_1015335661 147
240 3300006844 Ga0075428_101555967 Ga0075428_1015559671 147
241 3300006846 Ga0075430_100043102 Ga0075430_1000431025 147
242 3300006846 Ga0075430_100155945 Ga0075430_1001559452 147
243 3300006846 Ga0075430_100362877 Ga0075430_1003628771 147
244 3300006846 Ga0075430_100412665 Ga0075430_1004126651 147
245 3300006846 Ga0075430_100568596 Ga0075430_1005685962 147
246 3300006847 Ga0075431_100070830 Ga0075431_1000708302 147
247 3300006847 Ga0075431_100131328 Ga0075431_1001313282 147
248 3300006847 Ga0075431_100419203 Ga0075431_1004192032 147
249 3300006847 Ga0075431_101540214 Ga0075431_1015402141 147
250 3300006852 Ga0075433_10494202 Ga0075433_104942022 147
251 3300006852 Ga0075433_11320520 Ga0075433_113205201 147
252 3300006880 Ga0075429_100000137 Ga0075429_1000001376 147
253 3300006880 Ga0075429_100015293 Ga0075429_1000152936 147
254 3300006880 Ga0075429_100102030 Ga0075429_1001020302 147
255 3300006880 Ga0075429_100157527 Ga0075429_1001575273 147
256 3300006880 Ga0075429_100189470 Ga0075429_1001894703 147
257 3300006880 Ga0075429_100252250 Ga0075429_1002522502 147
258 3300006880 Ga0075429_100291137 Ga0075429_1002911372 147
259 3300006880 Ga0075429_100623802 Ga0075429_1006238022 147
260 3300006881 Ga0068865_101162343 Ga0068865_1011623431 147
261 3300006931 Ga0097620_100004691 Ga0097620_1000046913 147
262 3300006931 Ga0097620_100032310 Ga0097620_1000323107 147
263 3300009094 Ga0111539_12092055 Ga0111539_120920551 147
264 3300009147 Ga0114129_10002746 Ga0114129_100027466 147
265 3300009147 Ga0114129_10245951 Ga0114129_102459513 147
266 3300009147 Ga0114129_10329276 Ga0114129_103292763 147
267 3300009147 Ga0114129_12620808 Ga0114129_126208081 147
268 3300009148 Ga0105243_10245284 Ga0105243_102452842 147
269 3300009148 Ga0105243_10249567 Ga0105243_102495672 147
270 3300009148 Ga0105243_10398477 Ga0105243_103984772 147
271 3300009553 Ga0105249_10661259 Ga0105249_106612591 147
272 3300011119 Ga0105246_10025443 Ga0105246_100254435 147
273 3300020070 Ga0206356_10621144 Ga0206356_106211441 147
274 3300020077 Ga0206351_10272933 Ga0206351_102729331 147
275 3300020077 Ga0206351_10284128 Ga0206351_102841281 147
276 3300020078 Ga0206352_10553937 Ga0206352_105539371 147
277 3300020081 Ga0206354_10445799 Ga0206354_104457991 147
278 3300020081 Ga0206354_10612655 Ga0206354_106126551 147
279 3300025885 Ga0207653_10018489 Ga0207653_100184893 147
280 3300025908 Ga0207643_10679925 Ga0207643_106799251 147
281 3300025910 Ga0207684_10492679 Ga0207684_104926792 147
282 3300025917 Ga0207660_11020076 Ga0207660_110200761 147
283 3300025923 Ga0207681_11092770 Ga0207681_110927701 147
284 3300025935 Ga0207709_10336046 Ga0207709_103360461 147
285 3300025936 Ga0207670_10084028 Ga0207670_100840282 147
286 3300025936 Ga0207670_10252967 Ga0207670_102529672 147
287 3300025961 Ga0207712_11483092 Ga0207712_114830921 147
288 3300025986 Ga0207658_11193531 Ga0207658_111935311 147
289 3300026035 Ga0207703_10547416 Ga0207703_105474162 147
290 3300026035 Ga0207703_10913662 Ga0207703_109136621 147
291 3300026095 Ga0207676_10212500 Ga0207676_102125002 147
292 3300026116 Ga0207674_10047797 Ga0207674_100477975 147
293 3300026116 Ga0207674_10287254 Ga0207674_102872542 147
294 3300026118 Ga0207675_100748998 Ga0207675_1007489982 147
295 3300028380 Ga0268265_10134301 Ga0268265_101343012 147
296 3300029277 Ga0311001_1037031 Ga0311001_10370311 147
297 3300029277 Ga0311001_1050343 Ga0311001_10503431 147
298 3300029280 Ga0311011_110316 Ga0311011_1103161 147
299 3300029283 Ga0310982_133721 Ga0310982_1337211 147
300 3300029285 Ga0310981_1000047 Ga0310981_10000471 147
301 3300031731 Ga0307405_10519154 Ga0307405_105191542 147
302 3300031852 Ga0307410_10281737 Ga0307410_102817371 147
303 3300031852 Ga0307410_10556955 Ga0307410_105569552 147
304 3300031901 Ga0307406_10270933 Ga0307406_102709332 147
305 3300031903 Ga0307407_10300352 Ga0307407_103003522 147
306 3300031995 Ga0307409_100824412 Ga0307409_1008244122 147
307 3300032002 Ga0307416_100477795 Ga0307416_1004777952 147
308 3300032002 Ga0307416_100901662 Ga0307416_1009016622 147
309 3300032126 Ga0307415_100237722 Ga0307415_1002377222 147
310 3300044673 Ga0453683_0048139 Ga0453683_0048139_1272_1715 147
311 3300044673 Ga0453683_0165884 Ga0453683_0165884_606_1070 147
312 3300044673 Ga0453683_0259608 Ga0453683_0259608_420_872 147
313 3300044712 Ga0453684_0082336 Ga0453684_0082336_240_683 147
314 3300044712 Ga0453684_0685607 Ga0453684_0685607_415_858 147
315 3300044712 Ga0453684_0968788 Ga0453684_0968788_392_844 147
316 3300045051 Ga0451576_0292694 Ga0451576_0292694_1103_1555 147
317 3300049660 Ga0501216_052410 Ga0501216_052410_288_770 147
318 3300049665 Ga0501227_134515 Ga0501227_134515_165_647 147
319 3300049675 Ga0501243_101136 Ga0501243_101136_50_532 147
320 3300049686 Ga0501257_054467 Ga0501257_054467_299_781 147
321 3300049779 Ga0501283_098304 Ga0501283_098304_87_530 147
322 3300050507 nmdc:mga05p37_77045_c1 nmdc:mga05p37_77045_c1_2416_2871 147
323 3300050508 nmdc:mga09592_166568_c1 nmdc:mga09592_166568_c1_167_622 147
324 3300050508 nmdc:mga09592_484658_c1 nmdc:mga09592_484658_c1_523_978 147
325 3300050509 nmdc:mga0qj67_344826_c1 nmdc:mga0qj67_344826_c1_465_917 147
326 3300050510 nmdc:mga06r32_84688_c1 nmdc:mga06r32_84688_c1_1613_2068 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

53

134

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

48

148

0.94

PF04969

CS

CS domain

45

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8777 41 134
4mjh-assembly3.cif.gz_C human hsp27 core domain in complex with c-terminal peptide 0.8389 54 132
4m5t-assembly3.cif.gz_C disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8328 45 135
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8295 45 135
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8291 45 135
ID Description Score Start End Superfamily
af_C0PJF1_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8833 42 135 2.60.40.790
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8777 41 134 2.60.40.790
2bolB03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8739 52 134 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8665 42 133 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8649 42 133 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2E5F636-F1-model_v4 SHSP domain-containing protein 0.8668 40 146
AF-A0A1V5CCW2-F1-model_v4 Spore protein SP21 0.8446 41 147
AF-A0A011P689-F1-model_v4 Spore protein SP21 0.8405 41 145
AF-A0A1V5CCW2-F1-model_v4 Spore protein SP21 0.8361 41 147
AF-A0A7T9KQJ3-F1-model_v4 deleted 0.8172 40 147

Feature Viewer

pLDDT pTM Quality
72.04 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map