F408268

General Info

Members Datasets Scaffolds Average Seq Length
326 172 652 239

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10004106|Ga0111539_100041068
Length 279
Sequence VAIARAFLHFEFCILHFMKPASTTRRIIDTLAEQHPNADTELHYRNAFELLVATILSAQSTDQRVNMVTPALFRRYPDARSLATAVSSELEKQILSTGFFRQKAKALIGMAQKLVAEHGGEVPAEMEKLTTLPGVGRKTANVVLGHALGVPGLPVDRHVLRVSNRIGIAEGENPEVVEEQLCDRLPADMWTLASDVQILHGRRVCRPKPLCDECSVRDDCDYYRNVVARERPVKGTTLTIKDAKAGTKNAKSTKIAKADHAGRPAGLQRRRPGTRRPRR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.92
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10004106 3300009094 Bacteria 19101
2 MBSR1b_contig_6755799 2162886012 Bacteria 964
3 JGI24746J21847_1005201 3300001977 Bacteria 2036
4 JGI24750J21931_1013275 3300002070 Bacteria 1100
5 Ga0065712_10111296 3300005290 Bacteria 1803
6 Ga0065707_10008302 3300005295 Bacteria 3329
7 Ga0070676_10042610 3300005328 Bacteria 2636
8 Ga0070683_100237038 3300005329 Bacteria 1735
9 Ga0070690_100042300 3300005330 Bacteria 2885
10 Ga0070690_100247603 3300005330 Unclassified 1259
11 Ga0070670_100028437 3300005331 Bacteria 4811
12 Ga0070670_100048051 3300005331 Bacteria 3673
13 Ga0070670_100532282 3300005331 Bacteria 1047
14 Ga0070677_10011216 3300005333 Bacteria 3084
15 Ga0070677_10073092 3300005333 Bacteria 1448
16 Ga0068869_100062791 3300005334 Bacteria 2727
17 Ga0070666_10048111 3300005335 Bacteria 2864
18 Ga0068868_100077238 3300005338 Bacteria 2664
19 Ga0070660_100371617 3300005339 Unclassified 1180
20 Ga0070689_100039634 3300005340 Bacteria 3608
21 Ga0070689_100049610 3300005340 Bacteria 3241
22 Ga0070689_100128503 3300005340 Bacteria 2030
23 Ga0070689_100168468 3300005340 Bacteria 1774
24 Ga0070687_100026702 3300005343 Bacteria 2782
25 Ga0070668_100062658 3300005347 Bacteria 2882
26 Ga0070668_100497062 3300005347 Bacteria 1055
27 Ga0070668_100510132 3300005347 Bacteria 1042
28 Ga0070669_100000909 3300005353 Bacteria 21525
29 Ga0070669_100004543 3300005353 Bacteria 10018
30 Ga0070675_100000948 3300005354 Bacteria 20682
31 Ga0070675_100001075 3300005354 Bacteria 19711
32 Ga0070675_100208893 3300005354 Bacteria 1696
33 Ga0070671_100026264 3300005355 Bacteria 4785
34 Ga0070674_100014675 3300005356 Bacteria 4874
35 Ga0070674_100056993 3300005356 Bacteria 2711
36 Ga0070673_100701227 3300005364 Bacteria 929
37 Ga0070688_100020842 3300005365 Bacteria 3819
38 Ga0070688_100160990 3300005365 Bacteria 1542
39 Ga0070659_100249000 3300005366 Bacteria 1472
40 Ga0070667_100007410 3300005367 Bacteria 9114
41 Ga0070701_10070039 3300005438 Bacteria 1873
42 Ga0070701_10115753 3300005438 Bacteria 1504
43 Ga0070701_10335559 3300005438 Bacteria 940
44 Ga0070701_10383796 3300005438 Bacteria 886
45 Ga0070694_100037409 3300005444 Bacteria 3219
46 Ga0070663_100019438 3300005455 Bacteria 4477
47 Ga0070663_100233360 3300005455 Unclassified 1450
48 Ga0070678_100086285 3300005456 Bacteria 2394
49 Ga0070678_100142177 3300005456 Bacteria 1922
50 Ga0070678_100574566 3300005456 Bacteria 1003
51 Ga0070662_100079008 3300005457 Bacteria 2445
52 Ga0070662_100087414 3300005457 Bacteria 2333
53 Ga0070681_10116786 3300005458 Bacteria 2605
54 Ga0068867_100002728 3300005459 Bacteria 12449
55 Ga0068867_100098099 3300005459 Bacteria 2234
56 Ga0068867_100106733 3300005459 Bacteria 2146
57 Ga0070685_10056365 3300005466 Bacteria 2284
58 Ga0070685_10359626 3300005466 Bacteria 997
59 Ga0070698_100006302 3300005471 Bacteria 12886
60 Ga0070698_100662968 3300005471 Bacteria 985
61 Ga0070699_100354432 3300005518 Bacteria 1322
62 Ga0068853_100409813 3300005539 Bacteria 1270
63 Ga0070672_100013126 3300005543 Bacteria 5839
64 Ga0070686_100008953 3300005544 Bacteria 5608
65 Ga0070695_100034731 3300005545 Bacteria 3163
66 Ga0070665_100031816 3300005548 Bacteria 5310
67 Ga0070665_100207866 3300005548 Bacteria 1958
68 Ga0070704_100001450 3300005549 Bacteria 12703
69 Ga0070704_100002223 3300005549 Bacteria 10813
70 Ga0070704_100290050 3300005549 Bacteria 1359
71 Ga0070664_100012923 3300005564 Bacteria 6792
72 Ga0070664_100013716 3300005564 Bacteria 6604
73 Ga0068857_100070512 3300005577 Unclassified 3114
74 Ga0070702_100048257 3300005615 Bacteria 2423
75 Ga0070702_100176614 3300005615 Bacteria 1394
76 Ga0068852_100193865 3300005616 Bacteria 1919
77 Ga0068859_100004915 3300005617 Bacteria 13603
78 Ga0068859_100016193 3300005617 Bacteria 7489
79 Ga0068859_100027412 3300005617 Bacteria 5714
80 Ga0068859_100092623 3300005617 Bacteria 3074
81 Ga0068859_100174297 3300005617 Bacteria 2233
82 Ga0068864_100009227 3300005618 Bacteria 8135
83 Ga0068861_100062313 3300005719 Bacteria 2864
84 Ga0068870_10000116 3300005840 Bacteria 27118
85 Ga0068863_100127729 3300005841 Bacteria 2426
86 Ga0068863_100262865 3300005841 Bacteria 1669
87 Ga0068858_100533524 3300005842 Unclassified 1135
88 Ga0068860_100026987 3300005843 Bacteria 5534
89 Ga0068860_100090830 3300005843 Bacteria 2909
90 Ga0068860_100135074 3300005843 Bacteria 2369
91 Ga0068862_100001160 3300005844 Bacteria 24859
92 Ga0081539_10000106 3300005985 Bacteria 195771
93 Ga0081539_10034610 3300005985 Bacteria 3050
94 Ga0075432_10012952 3300006058 Bacteria 2834
95 Ga0097621_100096056 3300006237 Bacteria 2487
96 Ga0068871_100077621 3300006358 Bacteria 2745
97 Ga0068871_100130249 3300006358 Bacteria 2132
98 Ga0075428_100008549 3300006844 Bacteria 11357
99 Ga0075428_100099187 3300006844 Bacteria 3176
100 Ga0075428_100276739 3300006844 Unclassified 1806
101 Ga0075430_100021114 3300006846 Bacteria 5536
102 Ga0075431_100002468 3300006847 Bacteria 17819
103 Ga0075431_100024444 3300006847 Bacteria 6191
104 Ga0075431_100043715 3300006847 Bacteria 4621
105 Ga0075433_10000046 3300006852 Bacteria 50848
106 Ga0075433_10030409 3300006852 Bacteria 4607
107 Ga0075434_100003408 3300006871 Bacteria 14231
108 Ga0075434_100030467 3300006871 Bacteria 5313
109 Ga0075429_100001838 3300006880 Bacteria 17564
110 Ga0075429_100048899 3300006880 Bacteria 3677
111 Ga0075429_100060036 3300006880 Bacteria 3313
112 Ga0068865_100089754 3300006881 Bacteria 2227
113 Ga0068865_100341185 3300006881 Bacteria 1211
114 Ga0097620_100004915 3300006931 Bacteria 13603
115 Ga0097620_100016193 3300006931 Bacteria 7489
116 Ga0097620_100027412 3300006931 Bacteria 5714
117 Ga0097620_100092620 3300006931 Bacteria 3074
118 Ga0097620_100174304 3300006931 Bacteria 2233
119 Ga0111539_10008735 3300009094 Bacteria 12851
120 Ga0111539_10010941 3300009094 Bacteria 11419
121 Ga0111539_10110839 3300009094 Unclassified 3221
122 Ga0105247_10027848 3300009101 Bacteria 3416
123 Ga0114129_10001001 3300009147 Bacteria 36877
124 Ga0114129_10107825 3300009147 Bacteria 3846
125 Ga0114129_10261721 3300009147 Bacteria 2318
126 Ga0105248_10059143 3300009177 Bacteria 4304
127 Ga0105248_10101667 3300009177 Bacteria 3240
128 Ga0105248_11385299 3300009177 Bacteria 796
129 Ga0105249_10002415 3300009553 Bacteria 16219
130 Ga0105249_10005725 3300009553 Bacteria 10748
131 Ga0105239_10473971 3300010375 Bacteria 1422
132 Ga0105246_10115408 3300011119 Bacteria 1980
133 Ga0163162_10471605 3300013306 Bacteria 1387
134 Ga0157375_10009928 3300013308 Bacteria 8374
135 Ga0157375_10065530 3300013308 Bacteria 3621
136 Ga0157375_10377809 3300013308 Bacteria 1583
137 Ga0163163_10168310 3300014325 Bacteria 2238
138 Ga0163163_10173770 3300014325 Bacteria 2201
139 Ga0157380_10022180 3300014326 Bacteria 4775
140 Ga0157380_10028404 3300014326 Bacteria 4264
141 Ga0157380_10032116 3300014326 Bacteria 4036
142 Ga0157380_10398908 3300014326 Bacteria 1304
143 Ga0157380_10832620 3300014326 Bacteria 943
144 Ga0157377_10061381 3300014745 Bacteria 2148
145 Ga0157379_10017289 3300014968 Bacteria 6354
146 Ga0157376_10112893 3300014969 Bacteria 2395
147 Ga0157376_10478274 3300014969 Unclassified 1220
148 Ga0207697_10000871 3300025315 Bacteria 17103
149 Ga0207697_10087870 3300025315 Bacteria 1316
150 Ga0207656_10011609 3300025321 Bacteria 3334
151 Ga0207682_10002068 3300025893 Bacteria 9092
152 Ga0207682_10055847 3300025893 Bacteria 1643
153 Ga0207688_10000194 3300025901 Bacteria 26932
154 Ga0207688_10259241 3300025901 Bacteria 1055
155 Ga0207680_10036257 3300025903 Bacteria 2839
156 Ga0207645_10004034 3300025907 Bacteria 10941
157 Ga0207643_10000174 3300025908 Bacteria 44035
158 Ga0207643_10012411 3300025908 Bacteria 4605
159 Ga0207643_10045601 3300025908 Unclassified 2476
160 Ga0207662_10009361 3300025918 Bacteria 5386
161 Ga0207662_10030979 3300025918 Bacteria 3107
162 Ga0207657_10062790 3300025919 Bacteria 3179
163 Ga0207657_10240050 3300025919 Unclassified 1447
164 Ga0207649_10065830 3300025920 Bacteria 2295
165 Ga0207649_10276268 3300025920 Bacteria 1220
166 Ga0207649_10355871 3300025920 Bacteria 1085
167 Ga0207649_10364312 3300025920 Bacteria 1073
168 Ga0207646_10482213 3300025922 Unclassified 1118
169 Ga0207681_10001114 3300025923 Bacteria 17394
170 Ga0207681_10038408 3300025923 Bacteria 3172
171 Ga0207681_10057218 3300025923 Bacteria 2663
172 Ga0207681_10507170 3300025923 Unclassified 988
173 Ga0207650_10005435 3300025925 Bacteria 8697
174 Ga0207650_10081322 3300025925 Bacteria 2457
175 Ga0207650_10292831 3300025925 Bacteria 1328
176 Ga0207659_10002076 3300025926 Bacteria 11872
177 Ga0207659_10006735 3300025926 Bacteria 7059
178 Ga0207659_10102463 3300025926 Bacteria 2161
179 Ga0207700_10017407 3300025928 Bacteria 4800
180 Ga0207644_10026113 3300025931 Bacteria 4022
181 Ga0207644_10260004 3300025931 Bacteria 1388
182 Ga0207690_10208364 3300025932 Bacteria 1489
183 Ga0207706_10006531 3300025933 Bacteria 10806
184 Ga0207706_10031818 3300025933 Bacteria 4699
185 Ga0207706_10391408 3300025933 Bacteria 1206
186 Ga0207670_10013894 3300025936 Bacteria 4765
187 Ga0207670_10072239 3300025936 Bacteria 2388
188 Ga0207670_10121809 3300025936 Bacteria 1897
189 Ga0207669_10001514 3300025937 Bacteria 9914
190 Ga0207669_10073964 3300025937 Bacteria 2152
191 Ga0207669_10426184 3300025937 Bacteria 1045
192 Ga0207704_10030025 3300025938 Bacteria 3042
193 Ga0207704_10356423 3300025938 Bacteria 1141
194 Ga0207691_10010082 3300025940 Bacteria 9067
195 Ga0207691_10034790 3300025940 Bacteria 4682
196 Ga0207691_10263732 3300025940 Bacteria 1485
197 Ga0207691_10317389 3300025940 Bacteria 1336
198 Ga0207689_10000609 3300025942 Bacteria 34221
199 Ga0207689_10194927 3300025942 Bacteria 1672
200 Ga0207679_10011698 3300025945 Bacteria 5696
201 Ga0207679_10090637 3300025945 Bacteria 2364
202 Ga0207651_10008589 3300025960 Bacteria 5527
203 Ga0207712_10017973 3300025961 Bacteria 4600
204 Ga0207712_10019911 3300025961 Bacteria 4388
205 Ga0207658_10017581 3300025986 Bacteria 4930
206 Ga0207703_10006104 3300026035 Bacteria 9639
207 Ga0207639_10408482 3300026041 Bacteria 1225
208 Ga0207678_10085823 3300026067 Bacteria 2691
209 Ga0207678_10183246 3300026067 Unclassified 1788
210 Ga0207678_10347375 3300026067 Bacteria 1279
211 Ga0207708_10035155 3300026075 Bacteria 3813
212 Ga0207708_10135207 3300026075 Bacteria 1930
213 Ga0207641_10054828 3300026088 Bacteria 3384
214 Ga0207641_10321454 3300026088 Bacteria 1468
215 Ga0207641_10467377 3300026088 Bacteria 1221
216 Ga0207648_10001267 3300026089 Bacteria 28179
217 Ga0207648_10029491 3300026089 Bacteria 4865
218 Ga0207676_10411344 3300026095 Bacteria 1266
219 Ga0207674_10027294 3300026116 Bacteria 6042
220 Ga0207674_10027709 3300026116 Bacteria 5989
221 Ga0207675_100001592 3300026118 Bacteria 22726
222 Ga0207675_100016847 3300026118 Bacteria 6827
223 Ga0207675_100253866 3300026118 Bacteria 1702
224 Ga0207675_100345449 3300026118 Bacteria 1457
225 Ga0207675_100731138 3300026118 Bacteria 1000
226 Ga0207683_10020036 3300026121 Bacteria 5715
227 Ga0207683_10030278 3300026121 Bacteria 4689
228 Ga0207683_10100979 3300026121 Bacteria 2576
229 Ga0207683_10166665 3300026121 Bacteria 1994
230 Ga0207683_10586457 3300026121 Bacteria 1031
231 Ga0209974_10023028 3300027876 Unclassified 2062
232 Ga0207428_10001460 3300027907 Bacteria 24714
233 Ga0207428_10006729 3300027907 Bacteria 10555
234 Ga0207428_10083447 3300027907 Bacteria 2492
235 Ga0207428_10083912 3300027907 Bacteria 2483
236 Ga0207428_10258334 3300027907 Bacteria 1298
237 Ga0268265_10000925 3300028380 Bacteria 27113
238 Ga0268265_10736314 3300028380 Bacteria 956
239 Ga0268264_10013027 3300028381 Bacteria 6836
240 Ga0268264_10068400 3300028381 Bacteria 3001
241 Ga0268264_10073003 3300028381 Bacteria 2911
242 Ga0268264_10084982 3300028381 Bacteria 2715
243 Ga0307408_100006371 3300031548 Bacteria 7829
244 Ga0307413_10001857 3300031824 Bacteria 8326
245 Ga0307413_10009374 3300031824 Bacteria 4681
246 Ga0307413_10161424 3300031824 Bacteria 1575
247 Ga0307410_10069539 3300031852 Bacteria 2436
248 Ga0307407_10023676 3300031903 Bacteria 3207
249 Ga0307407_10254773 3300031903 Unclassified 1204
250 Ga0307412_10005973 3300031911 Bacteria 6859
251 Ga0307412_10030614 3300031911 Bacteria 3391
252 Ga0307412_10486073 3300031911 Bacteria 1025
253 Ga0307409_100225019 3300031995 Bacteria 1696
254 Ga0307409_100225948 3300031995 Bacteria 1693
255 Ga0307416_100034849 3300032002 Bacteria 3836
256 Ga0307416_100486912 3300032002 Bacteria 1295
257 Ga0307414_10268278 3300032004 Bacteria 1428
258 Ga0307411_10002910 3300032005 Bacteria 7754
259 Ga0307411_10004603 3300032005 Bacteria 6638
260 Ga0307415_100096042 3300032126 Unclassified 2159
261 Ga0373939_0041575 3300035114 Bacteria 1386
262 Ga0373956_0004818 3300035119 Bacteria 5398
263 Ga0373955_0001450 3300035172 Bacteria 10076
264 Ga0373937_0000867 3300036401 Bacteria 26012
265 Ga0439453_0014148 3300041408 Bacteria 1365
266 Ga0450923_012830 3300042125 Bacteria 1531
267 Ga0450894_005950 3300042131 Bacteria 1578
268 Ga0450895_001252 3300042132 Bacteria 1732
269 Ga0439435_0001925 3300042436 Bacteria 3988
270 Ga0451576_0010723 3300045051 Bacteria 10493
271 Ga0495592_0340554 3300046454 Bacteria 964
272 Ga0495584_0071405 3300046491 Bacteria 1745
273 Ga0495644_0164846 3300046523 Bacteria 850
274 Ga0495663_0071801 3300046525 Bacteria 1103
275 Ga0495621_0027261 3300046539 Bacteria 1933
276 Ga0495621_0034838 3300046539 Bacteria 1741
277 Ga0495621_0113674 3300046539 Bacteria 1040
278 Ga0495656_0021020 3300046615 Bacteria 2537
279 Ga0495656_0153699 3300046615 Bacteria 1113
280 Ga0495659_0025057 3300046664 Bacteria 2039
281 Ga0495670_0032184 3300046691 Bacteria 2608
282 Ga0495677_0094209 3300047445 Bacteria 1130
283 Ga0496108_0320226 3300048911 Bacteria 1352
284 Ga0496109_0385956 3300048912 Unclassified 1323
285 Ga0496112_0346173 3300048915 Bacteria 1429
286 Ga0501071_0040750 3300049587 Bacteria 3325
287 Ga0501071_0249828 3300049587 Bacteria 1339
288 Ga0501073_0023678 3300049589 Bacteria 4407
289 Ga0501074_0131921 3300049590 Bacteria 1787
290 Ga0501083_0308481 3300049744 Bacteria 1029
291 nmdc:mga05p37_107083_c1 3300050507 Bacteria 3439
292 nmdc:mga05p37_227452_c1 3300050507 Bacteria 2248
293 nmdc:mga05p37_472645_c1 3300050507 Bacteria 1446
294 nmdc:mga05p37_55_c1 3300050507 Bacteria 98735
295 nmdc:mga09592_2145_c1 3300050508 Bacteria 15922
296 nmdc:mga09592_31926_c1 3300050508 Bacteria 4389
297 nmdc:mga0qj67_138145_c1 3300050509 Bacteria 1975
298 nmdc:mga0qj67_50929_c1 3300050509 Bacteria 3274
299 nmdc:mga06r32_307520_c1 3300050510 Bacteria 1570
300 nmdc:mga06r32_4392_c1 3300050510 Bacteria 12608
301 nmdc:mga06r32_73611_c1 3300050510 Bacteria 3310
302 nmdc:mga06r32_74055_c1 3300050510 Bacteria 3300
303 nmdc:mga08y16_153978_c1 3300050511 Unclassified 2389
304 nmdc:mga08y16_2456_c1 3300050511 Bacteria 19031
305 nmdc:mga08y16_6089_c1 3300050511 Bacteria 12652
306 nmdc:mga08y16_79368_c1 3300050511 Bacteria 3421
307 nmdc:mga08y16_88428_c1 3300050511 Unclassified 3229
308 nmdc:mga0n895_25798_c1 3300050512 Bacteria 5558
309 nmdc:mga0n895_46954_c1 3300050512 Bacteria 4221
310 nmdc:mga0rr50_91154_c1 3300050513 Bacteria 2373
311 nmdc:mga0a205_135397_c1 3300050515 Bacteria 2364
312 nmdc:mga0a205_1548_c1 3300050515 Bacteria 19684
313 nmdc:mga0a205_175800_c1 3300050515 Bacteria 2036
314 nmdc:mga0a205_28759_c1 3300050515 Bacteria 5315
315 Ga0495601_0245120 3300053077 Bacteria 1170
316 Ga0495595_0260303 3300053084 Bacteria 869
317 Ga0495619_0034475 3300053085 Bacteria 3291
318 Ga0590071_000493 3300059421 Bacteria 11519
319 Ga0590071_000951 3300059421 Bacteria 8007
320 Ga0590074_004987 3300059423 Bacteria 2194
321 Ga0590074_010498 3300059423 Bacteria 1548
322 Ga0590075_000624 3300059424 Bacteria 9470
323 Ga0590075_001153 3300059424 Bacteria 6696
324 Ga0590077_000332 3300059426 Bacteria 13343
325 Ga0590077_000619 3300059426 Bacteria 9561
326 Ga0501082_0255954 3300060353 Bacteria 1523
327 Ga0111539_10004106
328 MBSR1b_contig_6755799
329 JGI24746J21847_1005201
330 JGI24750J21931_1013275
331 Ga0065712_10111296
332 Ga0065707_10008302
333 Ga0070676_10042610
334 Ga0070683_100237038
335 Ga0070690_100042300
336 Ga0070690_100247603
337 Ga0070670_100028437
338 Ga0070670_100048051
339 Ga0070670_100532282
340 Ga0070677_10011216
341 Ga0070677_10073092
342 Ga0068869_100062791
343 Ga0070666_10048111
344 Ga0068868_100077238
345 Ga0070660_100371617
346 Ga0070689_100039634
347 Ga0070689_100049610
348 Ga0070689_100128503
349 Ga0070689_100168468
350 Ga0070687_100026702
351 Ga0070668_100062658
352 Ga0070668_100497062
353 Ga0070668_100510132
354 Ga0070669_100000909
355 Ga0070669_100004543
356 Ga0070675_100000948
357 Ga0070675_100001075
358 Ga0070675_100208893
359 Ga0070671_100026264
360 Ga0070674_100014675
361 Ga0070674_100056993
362 Ga0070673_100701227
363 Ga0070688_100020842
364 Ga0070688_100160990
365 Ga0070659_100249000
366 Ga0070667_100007410
367 Ga0070701_10070039
368 Ga0070701_10115753
369 Ga0070701_10335559
370 Ga0070701_10383796
371 Ga0070694_100037409
372 Ga0070663_100019438
373 Ga0070663_100233360
374 Ga0070678_100086285
375 Ga0070678_100142177
376 Ga0070678_100574566
377 Ga0070662_100079008
378 Ga0070662_100087414
379 Ga0070681_10116786
380 Ga0068867_100002728
381 Ga0068867_100098099
382 Ga0068867_100106733
383 Ga0070685_10056365
384 Ga0070685_10359626
385 Ga0070698_100006302
386 Ga0070698_100662968
387 Ga0070699_100354432
388 Ga0068853_100409813
389 Ga0070672_100013126
390 Ga0070686_100008953
391 Ga0070695_100034731
392 Ga0070665_100031816
393 Ga0070665_100207866
394 Ga0070704_100001450
395 Ga0070704_100002223
396 Ga0070704_100290050
397 Ga0070664_100012923
398 Ga0070664_100013716
399 Ga0068857_100070512
400 Ga0070702_100048257
401 Ga0070702_100176614
402 Ga0068852_100193865
403 Ga0068859_100004915
404 Ga0068859_100016193
405 Ga0068859_100027412
406 Ga0068859_100092623
407 Ga0068859_100174297
408 Ga0068864_100009227
409 Ga0068861_100062313
410 Ga0068870_10000116
411 Ga0068863_100127729
412 Ga0068863_100262865
413 Ga0068858_100533524
414 Ga0068860_100026987
415 Ga0068860_100090830
416 Ga0068860_100135074
417 Ga0068862_100001160
418 Ga0081539_10000106
419 Ga0081539_10034610
420 Ga0075432_10012952
421 Ga0097621_100096056
422 Ga0068871_100077621
423 Ga0068871_100130249
424 Ga0075428_100008549
425 Ga0075428_100099187
426 Ga0075428_100276739
427 Ga0075430_100021114
428 Ga0075431_100002468
429 Ga0075431_100024444
430 Ga0075431_100043715
431 Ga0075433_10000046
432 Ga0075433_10030409
433 Ga0075434_100003408
434 Ga0075434_100030467
435 Ga0075429_100001838
436 Ga0075429_100048899
437 Ga0075429_100060036
438 Ga0068865_100089754
439 Ga0068865_100341185
440 Ga0097620_100004915
441 Ga0097620_100016193
442 Ga0097620_100027412
443 Ga0097620_100092620
444 Ga0097620_100174304
445 Ga0111539_10008735
446 Ga0111539_10010941
447 Ga0111539_10110839
448 Ga0105247_10027848
449 Ga0114129_10001001
450 Ga0114129_10107825
451 Ga0114129_10261721
452 Ga0105248_10059143
453 Ga0105248_10101667
454 Ga0105248_11385299
455 Ga0105249_10002415
456 Ga0105249_10005725
457 Ga0105239_10473971
458 Ga0105246_10115408
459 Ga0163162_10471605
460 Ga0157375_10009928
461 Ga0157375_10065530
462 Ga0157375_10377809
463 Ga0163163_10168310
464 Ga0163163_10173770
465 Ga0157380_10022180
466 Ga0157380_10028404
467 Ga0157380_10032116
468 Ga0157380_10398908
469 Ga0157380_10832620
470 Ga0157377_10061381
471 Ga0157379_10017289
472 Ga0157376_10112893
473 Ga0157376_10478274
474 Ga0207697_10000871
475 Ga0207697_10087870
476 Ga0207656_10011609
477 Ga0207682_10002068
478 Ga0207682_10055847
479 Ga0207688_10000194
480 Ga0207688_10259241
481 Ga0207680_10036257
482 Ga0207645_10004034
483 Ga0207643_10000174
484 Ga0207643_10012411
485 Ga0207643_10045601
486 Ga0207662_10009361
487 Ga0207662_10030979
488 Ga0207657_10062790
489 Ga0207657_10240050
490 Ga0207649_10065830
491 Ga0207649_10276268
492 Ga0207649_10355871
493 Ga0207649_10364312
494 Ga0207646_10482213
495 Ga0207681_10001114
496 Ga0207681_10038408
497 Ga0207681_10057218
498 Ga0207681_10507170
499 Ga0207650_10005435
500 Ga0207650_10081322
501 Ga0207650_10292831
502 Ga0207659_10002076
503 Ga0207659_10006735
504 Ga0207659_10102463
505 Ga0207700_10017407
506 Ga0207644_10026113
507 Ga0207644_10260004
508 Ga0207690_10208364
509 Ga0207706_10006531
510 Ga0207706_10031818
511 Ga0207706_10391408
512 Ga0207670_10013894
513 Ga0207670_10072239
514 Ga0207670_10121809
515 Ga0207669_10001514
516 Ga0207669_10073964
517 Ga0207669_10426184
518 Ga0207704_10030025
519 Ga0207704_10356423
520 Ga0207691_10010082
521 Ga0207691_10034790
522 Ga0207691_10263732
523 Ga0207691_10317389
524 Ga0207689_10000609
525 Ga0207689_10194927
526 Ga0207679_10011698
527 Ga0207679_10090637
528 Ga0207651_10008589
529 Ga0207712_10017973
530 Ga0207712_10019911
531 Ga0207658_10017581
532 Ga0207703_10006104
533 Ga0207639_10408482
534 Ga0207678_10085823
535 Ga0207678_10183246
536 Ga0207678_10347375
537 Ga0207708_10035155
538 Ga0207708_10135207
539 Ga0207641_10054828
540 Ga0207641_10321454
541 Ga0207641_10467377
542 Ga0207648_10001267
543 Ga0207648_10029491
544 Ga0207676_10411344
545 Ga0207674_10027294
546 Ga0207674_10027709
547 Ga0207675_100001592
548 Ga0207675_100016847
549 Ga0207675_100253866
550 Ga0207675_100345449
551 Ga0207675_100731138
552 Ga0207683_10020036
553 Ga0207683_10030278
554 Ga0207683_10100979
555 Ga0207683_10166665
556 Ga0207683_10586457
557 Ga0209974_10023028
558 Ga0207428_10001460
559 Ga0207428_10006729
560 Ga0207428_10083447
561 Ga0207428_10083912
562 Ga0207428_10258334
563 Ga0268265_10000925
564 Ga0268265_10736314
565 Ga0268264_10013027
566 Ga0268264_10068400
567 Ga0268264_10073003
568 Ga0268264_10084982
569 Ga0307408_100006371
570 Ga0307413_10001857
571 Ga0307413_10009374
572 Ga0307413_10161424
573 Ga0307410_10069539
574 Ga0307407_10023676
575 Ga0307407_10254773
576 Ga0307412_10005973
577 Ga0307412_10030614
578 Ga0307412_10486073
579 Ga0307409_100225019
580 Ga0307409_100225948
581 Ga0307416_100034849
582 Ga0307416_100486912
583 Ga0307414_10268278
584 Ga0307411_10002910
585 Ga0307411_10004603
586 Ga0307415_100096042
587 Ga0373939_0041575
588 Ga0373956_0004818
589 Ga0373955_0001450
590 Ga0373937_0000867
591 Ga0439453_0014148
592 Ga0450923_012830
593 Ga0450894_005950
594 Ga0450895_001252
595 Ga0439435_0001925
596 Ga0451576_0010723
597 Ga0495592_0340554
598 Ga0495584_0071405
599 Ga0495644_0164846
600 Ga0495663_0071801
601 Ga0495621_0027261
602 Ga0495621_0034838
603 Ga0495621_0113674
604 Ga0495656_0021020
605 Ga0495656_0153699
606 Ga0495659_0025057
607 Ga0495670_0032184
608 Ga0495677_0094209
609 Ga0496108_0320226
610 Ga0496109_0385956
611 Ga0496112_0346173
612 Ga0501071_0040750
613 Ga0501071_0249828
614 Ga0501073_0023678
615 Ga0501074_0131921
616 Ga0501083_0308481
617 nmdc:mga05p37_107083_c1
618 nmdc:mga05p37_227452_c1
619 nmdc:mga05p37_472645_c1
620 nmdc:mga05p37_55_c1
621 nmdc:mga09592_2145_c1
622 nmdc:mga09592_31926_c1
623 nmdc:mga0qj67_138145_c1
624 nmdc:mga0qj67_50929_c1
625 nmdc:mga06r32_307520_c1
626 nmdc:mga06r32_4392_c1
627 nmdc:mga06r32_73611_c1
628 nmdc:mga06r32_74055_c1
629 nmdc:mga08y16_153978_c1
630 nmdc:mga08y16_2456_c1
631 nmdc:mga08y16_6089_c1
632 nmdc:mga08y16_79368_c1
633 nmdc:mga08y16_88428_c1
634 nmdc:mga0n895_25798_c1
635 nmdc:mga0n895_46954_c1
636 nmdc:mga0rr50_91154_c1
637 nmdc:mga0a205_135397_c1
638 nmdc:mga0a205_1548_c1
639 nmdc:mga0a205_175800_c1
640 nmdc:mga0a205_28759_c1
641 Ga0495601_0245120
642 Ga0495595_0260303
643 Ga0495619_0034475
644 Ga0590071_000493
645 Ga0590071_000951
646 Ga0590074_004987
647 Ga0590074_010498
648 Ga0590075_000624
649 Ga0590075_001153
650 Ga0590077_000332
651 Ga0590077_000619
652 Ga0501082_0255954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

52

187

0.95

PF00633

HHH

Helix-hairpin-helix motif

117

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofe-assembly1.cif.gz_A structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis 0.9315 21 116
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9295 2 195
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9294 2 201
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9127 2 208
4ofh-assembly1.cif.gz_A structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis 0.9078 21 118
ID Description Score Start End Superfamily
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9937 14 124 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9849 14 124 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9784 14 123 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9728 23 120 1.10.340.30
af_O35980_108_217_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9559 21 121 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A1F2SD76-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9907 1 198 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A3N5PDU9-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9898 1 207 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A7K0M3Y1-F1-model_v4 Endonuclease III 0.9883 2 176 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A7X6LQZ2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.988 2 181 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0016829
GO:0019104
GO:0046872
GO:0051539
AF-A0A076NLE0-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.987 2 181 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078

Map