F408258

General Info

Members Datasets Scaffolds Average Seq Length
326 118 652 312

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100195686|Ga0075434_1001956862
Length 320
Sequence MSQPPLLLLLVGLPPTPSSLRVRIWRRLRSLGAVPLKRSAYLLPDTPERYEDFQWLAQEIQREGGDATLMRVQQIENVDRADVLRLFHEPRDQDYRHLATRYRKLLQSLDRKSAAASARVQDELARLAKDHQRVREIDFFDAPGGAEVRRLEEAIAMRTRRPESARRSEAPAPALDLAALRGRRWVTRPRPHVDRIASAWLIKRFIDPKAEFVFAPPAEFPADAIPFDAPGVELSHQGEDCTFETLVKRARLRDRRLMRLAEVVHEADLRDGKYAHDEARGIDVAIRALLAASPDDHQVLAQGLALFEGLYATTPRKAST

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 99.69
Stem 0
Stem Tuber 0
Unclassified 8.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100195686 3300006871 Bacteria 2041
2 Ga0065704_10137209 3300005289 Bacteria 1557
3 Ga0065707_10184290 3300005295 Bacteria 1398
4 Ga0070676_10040458 3300005328 Bacteria 2699
5 Ga0068869_100037378 3300005334 Bacteria 3452
6 Ga0070680_100016241 3300005336 Bacteria 5856
7 Ga0070680_100034637 3300005336 Bacteria 4072
8 Ga0070668_100056711 3300005347 Unclassified 3026
9 Ga0070669_100056615 3300005353 Unclassified 2875
10 Ga0070669_100260366 3300005353 Unclassified 1384
11 Ga0070703_10013948 3300005406 Bacteria 2284
12 Ga0070701_10126563 3300005438 Bacteria 1446
13 Ga0070708_100013510 3300005445 Bacteria 6690
14 Ga0070708_100020786 3300005445 Bacteria 5541
15 Ga0070708_100071372 3300005445 Bacteria 3126
16 Ga0070708_100106007 3300005445 Bacteria 2580
17 Ga0070708_100163546 3300005445 Unclassified 2075
18 Ga0070662_100072353 3300005457 Unclassified 2545
19 Ga0070706_100019960 3300005467 Bacteria 6178
20 Ga0070706_100079503 3300005467 Bacteria 3035
21 Ga0070706_100129089 3300005467 Bacteria 2358
22 Ga0070707_100030664 3300005468 Bacteria 5121
23 Ga0070707_100348491 3300005468 Bacteria 1438
24 Ga0070707_100392308 3300005468 Bacteria 1348
25 Ga0070698_100016088 3300005471 Bacteria 7898
26 Ga0070699_100027773 3300005518 Bacteria 4879
27 Ga0070699_100039657 3300005518 Bacteria 4077
28 Ga0070699_100084123 3300005518 Bacteria 2776
29 Ga0070697_100021600 3300005536 Bacteria 5101
30 Ga0070697_100077257 3300005536 Bacteria 2738
31 Ga0070697_100123283 3300005536 Bacteria 2169
32 Ga0070672_100023182 3300005543 Bacteria 4572
33 Ga0070695_100009045 3300005545 Bacteria 5921
34 Ga0070695_100010181 3300005545 Bacteria 5608
35 Ga0070696_100064444 3300005546 Bacteria 2568
36 Ga0070696_100224800 3300005546 Bacteria 1410
37 Ga0070704_100007326 3300005549 Bacteria 6564
38 Ga0070704_100069462 3300005549 Unclassified 2552
39 Ga0070704_100095953 3300005549 Bacteria 2222
40 Ga0068866_10068699 3300005718 Bacteria 1864
41 Ga0068861_100035183 3300005719 Bacteria 3708
42 Ga0068870_10011098 3300005840 Bacteria 4164
43 Ga0068860_100037527 3300005843 Bacteria 4638
44 Ga0068860_100112242 3300005843 Bacteria 2606
45 Ga0068860_100182263 3300005843 Bacteria 2030
46 Ga0068860_100331835 3300005843 Bacteria 1494
47 Ga0068862_100035138 3300005844 Bacteria 4243
48 Ga0068862_100304589 3300005844 Bacteria 1467
49 Ga0081455_10000620 3300005937 Bacteria 46038
50 Ga0081539_10000020 3300005985 Bacteria 366549
51 Ga0081539_10001068 3300005985 Bacteria 50134
52 Ga0075432_10008271 3300006058 Bacteria 3546
53 Ga0075428_100001825 3300006844 Bacteria 22809
54 Ga0075428_100001927 3300006844 Bacteria 22262
55 Ga0075428_100008970 3300006844 Bacteria 11095
56 Ga0075428_100009708 3300006844 Bacteria 10687
57 Ga0075428_100013826 3300006844 Bacteria 8989
58 Ga0075428_100046545 3300006844 Bacteria 4765
59 Ga0075428_100050438 3300006844 Plasmid 4564
60 Ga0075428_100075070 3300006844 Bacteria 3693
61 Ga0075428_100078040 3300006844 Bacteria 3615
62 Ga0075428_100108895 3300006844 Bacteria 3019
63 Ga0075428_100159699 3300006844 Unclassified 2447
64 Ga0075428_100281605 3300006844 Bacteria 1789
65 Ga0075428_100289356 3300006844 Bacteria 1762
66 Ga0075430_100000198 3300006846 Bacteria 40771
67 Ga0075430_100007827 3300006846 Bacteria 9029
68 Ga0075430_100020710 3300006846 Bacteria 5594
69 Ga0075430_100050356 3300006846 Bacteria 3513
70 Ga0075430_100136276 3300006846 Bacteria 2045
71 Ga0075430_100162832 3300006846 Bacteria 1857
72 Ga0075430_100237258 3300006846 Bacteria 1511
73 Ga0075430_100267648 3300006846 Bacteria 1415
74 Ga0075431_100000401 3300006847 Bacteria 34959
75 Ga0075431_100001612 3300006847 Bacteria 21063
76 Ga0075431_100002865 3300006847 Bacteria 16685
77 Ga0075431_100004610 3300006847 Bacteria 13535
78 Ga0075431_100008479 3300006847 Bacteria 10294
79 Ga0075431_100026593 3300006847 Bacteria 5936
80 Ga0075431_100028550 3300006847 Bacteria 5736
81 Ga0075431_100050307 3300006847 Bacteria 4297
82 Ga0075431_100186325 3300006847 Bacteria 2128
83 Ga0075431_100484814 3300006847 Bacteria 1229
84 Ga0075431_100500751 3300006847 Bacteria 1206
85 Ga0075433_10004075 3300006852 Bacteria 11326
86 Ga0075433_10014705 3300006852 Bacteria 6404
87 Ga0075433_10038948 3300006852 Bacteria 4108
88 Ga0075433_10050026 3300006852 Bacteria 3638
89 Ga0075433_10111918 3300006852 Unclassified 2422
90 Ga0075433_10114571 3300006852 Bacteria 2392
91 Ga0075433_10119625 3300006852 Bacteria 2338
92 Ga0075433_10215850 3300006852 Bacteria 1704
93 Ga0075434_100003558 3300006871 Bacteria 13912
94 Ga0075434_100012612 3300006871 Bacteria 8013
95 Ga0075434_100018359 3300006871 Bacteria 6757
96 Ga0075434_100168719 3300006871 Bacteria 2209
97 Ga0075429_100012042 3300006880 Bacteria 7496
98 Ga0075429_100032296 3300006880 Bacteria 4550
99 Ga0075429_100061248 3300006880 Bacteria 3278
100 Ga0075429_100068247 3300006880 Bacteria 3094
101 Ga0075429_100145239 3300006880 Bacteria 2076
102 Ga0075429_100202102 3300006880 Bacteria 1741
103 Ga0068865_100201244 3300006881 Unclassified 1546
104 Ga0068865_100390696 3300006881 Bacteria 1137
105 Ga0075436_100000299 3300006914 Bacteria 31641
106 Ga0075435_100006890 3300007076 Bacteria 8064
107 Ga0075435_100008845 3300007076 Bacteria 7255
108 Ga0075435_100015076 3300007076 Bacteria 5802
109 Ga0111539_10002165 3300009094 Bacteria 26287
110 Ga0111539_10226139 3300009094 Bacteria 2179
111 Ga0114129_10000491 3300009147 Bacteria 47883
112 Ga0114129_10003489 3300009147 Bacteria 22114
113 Ga0114129_10004114 3300009147 Bacteria 20557
114 Ga0114129_10006071 3300009147 Bacteria 17121
115 Ga0114129_10006358 3300009147 Bacteria 16746
116 Ga0114129_10007088 3300009147 Bacteria 15950
117 Ga0114129_10014430 3300009147 Bacteria 11259
118 Ga0114129_10028891 3300009147 Bacteria 7856
119 Ga0114129_10053217 3300009147 Bacteria 5677
120 Ga0114129_10056451 3300009147 Bacteria 5500
121 Ga0114129_10078658 3300009147 Bacteria 4587
122 Ga0114129_10087678 3300009147 Bacteria 4315
123 Ga0114129_10126497 3300009147 Bacteria 3513
124 Ga0114129_10137183 3300009147 Unclassified 3356
125 Ga0114129_10169609 3300009147 Bacteria 2976
126 Ga0114129_10222037 3300009147 Bacteria 2548
127 Ga0114129_10258626 3300009147 Bacteria 2335
128 Ga0114129_10582867 3300009147 Bacteria 1451
129 Ga0114129_10588579 3300009147 Bacteria 1443
130 Ga0105243_10055692 3300009148 Unclassified 3142
131 Ga0105243_10066603 3300009148 Bacteria 2897
132 Ga0105241_10047612 3300009174 Unclassified 3261
133 Ga0105241_10113179 3300009174 Bacteria 2175
134 Ga0105249_10053675 3300009553 Bacteria 3684
135 Ga0105249_10061652 3300009553 Bacteria 3442
136 Ga0105249_10169870 3300009553 Unclassified 2114
137 Ga0157371_10266128 3300013102 Bacteria 1236
138 Ga0157378_10328608 3300013297 Bacteria 1487
139 Ga0163162_10020118 3300013306 Bacteria 6553
140 Ga0157375_10073304 3300013308 Bacteria 3442
141 Ga0157380_10248125 3300014326 Unclassified 1609
142 Ga0207653_10006671 3300025885 Bacteria 3606
143 Ga0207643_10086361 3300025908 Bacteria 1823
144 Ga0207684_10000695 3300025910 Bacteria 39753
145 Ga0207684_10033584 3300025910 Bacteria 4363
146 Ga0207684_10045232 3300025910 Bacteria 3735
147 Ga0207654_10059829 3300025911 Unclassified 2224
148 Ga0207654_10136697 3300025911 Bacteria 1558
149 Ga0207660_10014073 3300025917 Bacteria 5252
150 Ga0207660_10088802 3300025917 Bacteria 2287
151 Ga0207646_10004912 3300025922 Bacteria 14305
152 Ga0207646_10029200 3300025922 Bacteria 5014
153 Ga0207681_10074923 3300025923 Unclassified 2372
154 Ga0207706_10039541 3300025933 Bacteria 4182
155 Ga0207709_10009622 3300025935 Bacteria 5323
156 Ga0207704_10093483 3300025938 Unclassified 1982
157 Ga0207691_10033580 3300025940 Bacteria 4777
158 Ga0207689_10062418 3300025942 Bacteria 3064
159 Ga0207712_10020244 3300025961 Bacteria 4355
160 Ga0207712_10103712 3300025961 Bacteria 2119
161 Ga0207674_10036578 3300026116 Bacteria 5113
162 Ga0207675_100052457 3300026118 Bacteria 3805
163 Ga0209971_1027216 3300027682 Bacteria 1367
164 Ga0207428_10001469 3300027907 Bacteria 24671
165 Ga0207428_10020604 3300027907 Bacteria 5599
166 Ga0268265_10057292 3300028380 Bacteria 2969
167 Ga0268265_10072281 3300028380 Bacteria 2690
168 Ga0268264_10288289 3300028381 Bacteria 1541
169 Ga0268264_10292896 3300028381 Unclassified 1529
170 Ga0268264_10393233 3300028381 Bacteria 1330
171 Ga0307408_100070469 3300031548 Bacteria 2581
172 Ga0307416_100087912 3300032002 Bacteria 2655
173 Ga0307411_10119884 3300032005 Bacteria 1901
174 Ga0373932_0022362 3300035112 Bacteria 1679
175 Ga0373931_0004471 3300035691 Bacteria 6390
176 Ga0373931_0006416 3300035691 Bacteria 5495
177 Ga0373931_0015498 3300035691 Bacteria 3740
178 Ga0395899_0144451 3300037312 Bacteria 1691
179 Ga0395900_0021887 3300037418 Bacteria 6537
180 Ga0395900_0071121 3300037418 Bacteria 3576
181 Ga0395900_0566867 3300037418 Bacteria 1079
182 Ga0395898_0069886 3300037466 Bacteria 3396
183 Ga0395905_0023937 3300037471 Bacteria 5766
184 Ga0395905_0070923 3300037471 Bacteria 3266
185 Ga0395901_0000952 3300038443 Bacteria 31503
186 Ga0395901_0157285 3300038443 Bacteria 2387
187 Ga0395901_0377822 3300038443 Bacteria 1459
188 Ga0242420_018461 3300038996 Unclassified 1228
189 Ga0451577_0015409 3300042876 Bacteria 7113
190 Ga0451577_0246945 3300042876 Bacteria 1615
191 Ga0453684_0298763 3300044712 Bacteria 1831
192 Ga0451576_0012758 3300045051 Bacteria 9430
193 Ga0451576_0037638 3300045051 Bacteria 5124
194 Ga0451576_0125649 3300045051 Bacteria 2672
195 Ga0495580_0048711 3300046472 Bacteria 2998
196 Ga0495642_0015612 3300046528 Unclassified 2955
197 Ga0495621_0078314 3300046539 Unclassified 1229
198 Ga0495669_0197913 3300046684 Bacteria 960
199 Ga0496102_0003004 3300048905 Bacteria 14290
200 Ga0501036_0316955 3300049572 Unclassified 1303
201 Ga0501036_0417678 3300049572 Bacteria 1118
202 Ga0501037_0068333 3300049573 Unclassified 2587
203 Ga0501038_0079457 3300049574 Bacteria 2766
204 Ga0501040_0005772 3300049576 Bacteria 8012
205 Ga0501040_0106572 3300049576 Unclassified 1958
206 Ga0501040_0116806 3300049576 Bacteria 1869
207 Ga0501040_0218133 3300049576 Bacteria 1357
208 Ga0501041_0021632 3300049577 Bacteria 3853
209 Ga0501041_0033441 3300049577 Bacteria 3111
210 Ga0501042_0010739 3300049578 Bacteria 6156
211 Ga0501042_0044745 3300049578 Bacteria 3155
212 Ga0501042_0179388 3300049578 Bacteria 1528
213 Ga0501043_0261399 3300049579 Bacteria 1331
214 Ga0501046_0000274 3300049580 Bacteria 52364
215 Ga0501046_0127019 3300049580 Bacteria 1936
216 Ga0501048_0028826 3300049582 Bacteria 4029
217 Ga0501068_0128571 3300049584 Bacteria 1583
218 Ga0501068_0187018 3300049584 Bacteria 1311
219 Ga0501071_0364881 3300049587 Bacteria 1100
220 Ga0501072_0005885 3300049588 Bacteria 9341
221 Ga0501072_0019131 3300049588 Bacteria 5290
222 Ga0501072_0068991 3300049588 Bacteria 2791
223 Ga0501072_0235984 3300049588 Bacteria 1457
224 Ga0501073_0062710 3300049589 Bacteria 2593
225 Ga0501073_0316975 3300049589 Bacteria 1076
226 Ga0501074_0006561 3300049590 Bacteria 8413
227 Ga0501075_0037265 3300049591 Bacteria 3632
228 Ga0501075_0063707 3300049591 Bacteria 2780
229 Ga0501076_0051050 3300049592 Bacteria 3272
230 Ga0501076_0071646 3300049592 Bacteria 2773
231 Ga0501077_0021552 3300049593 Bacteria 4078
232 Ga0501077_0054279 3300049593 Bacteria 2545
233 Ga0501077_0124758 3300049593 Unclassified 1632
234 Ga0501079_0221414 3300049741 Bacteria 1478
235 Ga0501079_0311221 3300049741 Bacteria 1232
236 Ga0501081_0031252 3300049743 Bacteria 3608
237 Ga0501081_0088438 3300049743 Bacteria 2176
238 Ga0501083_0039529 3300049744 Bacteria 3204
239 Ga0501083_0069745 3300049744 Bacteria 2339
240 Ga0501045_0001967 3300049824 Bacteria 13875
241 Ga0501045_0183241 3300049824 Bacteria 1560
242 Ga0501045_0234218 3300049824 Bacteria 1367
243 nmdc:mga05p37_1017_c1 3300050507 Bacteria 31916
244 nmdc:mga05p37_11799_c1 3300050507 Bacteria 10415
245 nmdc:mga05p37_134424_c1 3300050507 Bacteria 3034
246 nmdc:mga05p37_13707_c1 3300050507 Bacteria 9717
247 nmdc:mga05p37_140958_c1 3300050507 Bacteria 2954
248 nmdc:mga05p37_1447_c1 3300050507 Bacteria 27609
249 nmdc:mga05p37_1449_c1 3300050507 Bacteria 27580
250 nmdc:mga05p37_182734_c1 3300050507 Bacteria 2551
251 nmdc:mga05p37_193262_c1 3300050507 Bacteria 2469
252 nmdc:mga05p37_22775_c1 3300050507 Bacteria 7598
253 nmdc:mga05p37_4491_c1 3300050507 Bacteria 16307
254 nmdc:mga05p37_503051_c1 3300050507 Unclassified 1390
255 nmdc:mga05p37_508553_c1 3300050507 Bacteria 1381
256 nmdc:mga05p37_575684_c1 3300050507 Bacteria 1276
257 nmdc:mga05p37_65802_c1 3300050507 Bacteria 4460
258 nmdc:mga05p37_77195_c1 3300050507 Bacteria 4101
259 nmdc:mga05p37_79768_c1 3300050507 Bacteria 4031
260 nmdc:mga05p37_83828_c1 3300050507 Bacteria 3927
261 nmdc:mga05p37_9198_c1 3300050507 Bacteria 11678
262 nmdc:mga05p37_97644_c1 3300050507 Bacteria 3619
263 nmdc:mga09592_10028_c1 3300050508 Bacteria 7702
264 nmdc:mga09592_135650_c1 3300050508 Bacteria 2120
265 nmdc:mga09592_21673_c1 3300050508 Bacteria 5297
266 nmdc:mga09592_31014_c1 3300050508 Bacteria 4453
267 nmdc:mga09592_35230_c1 3300050508 Bacteria 4189
268 nmdc:mga09592_356367_c1 3300050508 Bacteria 1266
269 nmdc:mga09592_43522_c1 3300050508 Plasmid 3779
270 nmdc:mga09592_58342_c1 3300050508 Bacteria 3264
271 nmdc:mga09592_85131_c1 3300050508 Bacteria 2697
272 nmdc:mga0qj67_128078_c1 3300050509 Bacteria 2054
273 nmdc:mga0qj67_143791_c1 3300050509 Bacteria 1934
274 nmdc:mga0qj67_146331_c1 3300050509 Bacteria 1916
275 nmdc:mga0qj67_3530_c1 3300050509 Bacteria 11293
276 nmdc:mga0qj67_40834_c1 3300050509 Bacteria 3647
277 nmdc:mga0qj67_42440_c1 3300050509 Bacteria 3580
278 nmdc:mga06r32_101583_c1 3300050510 Bacteria 2823
279 nmdc:mga06r32_1053_c1 3300050510 Bacteria 24905
280 nmdc:mga06r32_11300_c1 3300050510 Bacteria 8042
281 nmdc:mga06r32_27204_c1 3300050510 Bacteria 5340
282 nmdc:mga06r32_27802_c1 3300050510 Bacteria 5288
283 nmdc:mga06r32_36482_c1 3300050510 Bacteria 4646
284 nmdc:mga06r32_368192_c1 3300050510 Bacteria 1420
285 nmdc:mga06r32_585461_c1 3300050510 Bacteria 1088
286 nmdc:mga06r32_59784_c1 3300050510 Bacteria 3667
287 nmdc:mga06r32_62134_c1 3300050510 Bacteria 3598
288 nmdc:mga06r32_630_c1 3300050510 Bacteria 30687
289 nmdc:mga06r32_6555_c1 3300050510 Bacteria 10460
290 nmdc:mga06r32_84962_c1 3300050510 Bacteria 3085
291 nmdc:mga06r32_906_c1 3300050510 Bacteria 26424
292 nmdc:mga06r32_9723_c1 3300050510 Bacteria 8685
293 nmdc:mga08y16_114790_c1 3300050511 Bacteria 2804
294 nmdc:mga08y16_51778_c1 3300050511 Bacteria 4296
295 nmdc:mga08y16_6396_c1 3300050511 Bacteria 12348
296 nmdc:mga0n895_19199_c1 3300050512 Bacteria 6348
297 nmdc:mga0n895_1964_c1 3300050512 Bacteria 15770
298 nmdc:mga0n895_37845_c1 3300050512 Bacteria 4670
299 nmdc:mga0n895_59673_c1 3300050512 Bacteria 3764
300 nmdc:mga0n895_65543_c1 3300050512 Bacteria 3595
301 nmdc:mga0n895_694741_c1 3300050512 Bacteria 1014
302 nmdc:mga0n895_8579_c1 3300050512 Bacteria 8862
303 nmdc:mga0rr50_263480_c1 3300050513 Bacteria 1434
304 nmdc:mga0rr50_3695_c1 3300050513 Bacteria 8864
305 nmdc:mga0rr50_56618_c1 3300050513 Bacteria 2930
306 nmdc:mga0rr50_6984_c1 3300050513 Bacteria 6926
307 nmdc:mga08x19_17589_c1 3300050514 Bacteria 4376
308 nmdc:mga08x19_623_c1 3300050514 Bacteria 22823
309 nmdc:mga08x19_9304_c1 3300050514 Bacteria 5874
310 nmdc:mga0a205_15176_c1 3300050515 Bacteria 7196
311 nmdc:mga0a205_17342_c2 3300050515 Bacteria 5313
312 nmdc:mga0a205_38881_c1 3300050515 Bacteria 4578
313 nmdc:mga0a205_4070_c1 3300050515 Bacteria 13075
314 nmdc:mga0a205_40886_c1 3300050515 Bacteria 4465
315 nmdc:mga0a205_68897_c1 3300050515 Bacteria 3417
316 nmdc:mga0a205_78924_c1 3300050515 Unclassified 3180
317 nmdc:mga0a205_9669_c1 3300050515 Bacteria 8830
318 Ga0501084_0006458 3300054114 Bacteria 9642
319 Ga0501084_0041912 3300054114 Bacteria 3828
320 Ga0501084_0128927 3300054114 Unclassified 2129
321 Ga0501084_0214567 3300054114 Bacteria 1624
322 Ga0501084_0607840 3300054114 Bacteria 924
323 Ga0501082_0023854 3300060353 Bacteria 5275
324 Ga0530510_0000127 3300061734 Bacteria 44086
325 Ga0530510_0020481 3300061734 Bacteria 4702
326 Ga0530510_0173459 3300061734 Bacteria 1598
327 Ga0075434_100195686
328 Ga0065704_10137209
329 Ga0065707_10184290
330 Ga0070676_10040458
331 Ga0068869_100037378
332 Ga0070680_100016241
333 Ga0070680_100034637
334 Ga0070668_100056711
335 Ga0070669_100056615
336 Ga0070669_100260366
337 Ga0070703_10013948
338 Ga0070701_10126563
339 Ga0070708_100013510
340 Ga0070708_100020786
341 Ga0070708_100071372
342 Ga0070708_100106007
343 Ga0070708_100163546
344 Ga0070662_100072353
345 Ga0070706_100019960
346 Ga0070706_100079503
347 Ga0070706_100129089
348 Ga0070707_100030664
349 Ga0070707_100348491
350 Ga0070707_100392308
351 Ga0070698_100016088
352 Ga0070699_100027773
353 Ga0070699_100039657
354 Ga0070699_100084123
355 Ga0070697_100021600
356 Ga0070697_100077257
357 Ga0070697_100123283
358 Ga0070672_100023182
359 Ga0070695_100009045
360 Ga0070695_100010181
361 Ga0070696_100064444
362 Ga0070696_100224800
363 Ga0070704_100007326
364 Ga0070704_100069462
365 Ga0070704_100095953
366 Ga0068866_10068699
367 Ga0068861_100035183
368 Ga0068870_10011098
369 Ga0068860_100037527
370 Ga0068860_100112242
371 Ga0068860_100182263
372 Ga0068860_100331835
373 Ga0068862_100035138
374 Ga0068862_100304589
375 Ga0081455_10000620
376 Ga0081539_10000020
377 Ga0081539_10001068
378 Ga0075432_10008271
379 Ga0075428_100001825
380 Ga0075428_100001927
381 Ga0075428_100008970
382 Ga0075428_100009708
383 Ga0075428_100013826
384 Ga0075428_100046545
385 Ga0075428_100050438
386 Ga0075428_100075070
387 Ga0075428_100078040
388 Ga0075428_100108895
389 Ga0075428_100159699
390 Ga0075428_100281605
391 Ga0075428_100289356
392 Ga0075430_100000198
393 Ga0075430_100007827
394 Ga0075430_100020710
395 Ga0075430_100050356
396 Ga0075430_100136276
397 Ga0075430_100162832
398 Ga0075430_100237258
399 Ga0075430_100267648
400 Ga0075431_100000401
401 Ga0075431_100001612
402 Ga0075431_100002865
403 Ga0075431_100004610
404 Ga0075431_100008479
405 Ga0075431_100026593
406 Ga0075431_100028550
407 Ga0075431_100050307
408 Ga0075431_100186325
409 Ga0075431_100484814
410 Ga0075431_100500751
411 Ga0075433_10004075
412 Ga0075433_10014705
413 Ga0075433_10038948
414 Ga0075433_10050026
415 Ga0075433_10111918
416 Ga0075433_10114571
417 Ga0075433_10119625
418 Ga0075433_10215850
419 Ga0075434_100003558
420 Ga0075434_100012612
421 Ga0075434_100018359
422 Ga0075434_100168719
423 Ga0075429_100012042
424 Ga0075429_100032296
425 Ga0075429_100061248
426 Ga0075429_100068247
427 Ga0075429_100145239
428 Ga0075429_100202102
429 Ga0068865_100201244
430 Ga0068865_100390696
431 Ga0075436_100000299
432 Ga0075435_100006890
433 Ga0075435_100008845
434 Ga0075435_100015076
435 Ga0111539_10002165
436 Ga0111539_10226139
437 Ga0114129_10000491
438 Ga0114129_10003489
439 Ga0114129_10004114
440 Ga0114129_10006071
441 Ga0114129_10006358
442 Ga0114129_10007088
443 Ga0114129_10014430
444 Ga0114129_10028891
445 Ga0114129_10053217
446 Ga0114129_10056451
447 Ga0114129_10078658
448 Ga0114129_10087678
449 Ga0114129_10126497
450 Ga0114129_10137183
451 Ga0114129_10169609
452 Ga0114129_10222037
453 Ga0114129_10258626
454 Ga0114129_10582867
455 Ga0114129_10588579
456 Ga0105243_10055692
457 Ga0105243_10066603
458 Ga0105241_10047612
459 Ga0105241_10113179
460 Ga0105249_10053675
461 Ga0105249_10061652
462 Ga0105249_10169870
463 Ga0157371_10266128
464 Ga0157378_10328608
465 Ga0163162_10020118
466 Ga0157375_10073304
467 Ga0157380_10248125
468 Ga0207653_10006671
469 Ga0207643_10086361
470 Ga0207684_10000695
471 Ga0207684_10033584
472 Ga0207684_10045232
473 Ga0207654_10059829
474 Ga0207654_10136697
475 Ga0207660_10014073
476 Ga0207660_10088802
477 Ga0207646_10004912
478 Ga0207646_10029200
479 Ga0207681_10074923
480 Ga0207706_10039541
481 Ga0207709_10009622
482 Ga0207704_10093483
483 Ga0207691_10033580
484 Ga0207689_10062418
485 Ga0207712_10020244
486 Ga0207712_10103712
487 Ga0207674_10036578
488 Ga0207675_100052457
489 Ga0209971_1027216
490 Ga0207428_10001469
491 Ga0207428_10020604
492 Ga0268265_10057292
493 Ga0268265_10072281
494 Ga0268264_10288289
495 Ga0268264_10292896
496 Ga0268264_10393233
497 Ga0307408_100070469
498 Ga0307416_100087912
499 Ga0307411_10119884
500 Ga0373932_0022362
501 Ga0373931_0004471
502 Ga0373931_0006416
503 Ga0373931_0015498
504 Ga0395899_0144451
505 Ga0395900_0021887
506 Ga0395900_0071121
507 Ga0395900_0566867
508 Ga0395898_0069886
509 Ga0395905_0023937
510 Ga0395905_0070923
511 Ga0395901_0000952
512 Ga0395901_0157285
513 Ga0395901_0377822
514 Ga0242420_018461
515 Ga0451577_0015409
516 Ga0451577_0246945
517 Ga0453684_0298763
518 Ga0451576_0012758
519 Ga0451576_0037638
520 Ga0451576_0125649
521 Ga0495580_0048711
522 Ga0495642_0015612
523 Ga0495621_0078314
524 Ga0495669_0197913
525 Ga0496102_0003004
526 Ga0501036_0316955
527 Ga0501036_0417678
528 Ga0501037_0068333
529 Ga0501038_0079457
530 Ga0501040_0005772
531 Ga0501040_0106572
532 Ga0501040_0116806
533 Ga0501040_0218133
534 Ga0501041_0021632
535 Ga0501041_0033441
536 Ga0501042_0010739
537 Ga0501042_0044745
538 Ga0501042_0179388
539 Ga0501043_0261399
540 Ga0501046_0000274
541 Ga0501046_0127019
542 Ga0501048_0028826
543 Ga0501068_0128571
544 Ga0501068_0187018
545 Ga0501071_0364881
546 Ga0501072_0005885
547 Ga0501072_0019131
548 Ga0501072_0068991
549 Ga0501072_0235984
550 Ga0501073_0062710
551 Ga0501073_0316975
552 Ga0501074_0006561
553 Ga0501075_0037265
554 Ga0501075_0063707
555 Ga0501076_0051050
556 Ga0501076_0071646
557 Ga0501077_0021552
558 Ga0501077_0054279
559 Ga0501077_0124758
560 Ga0501079_0221414
561 Ga0501079_0311221
562 Ga0501081_0031252
563 Ga0501081_0088438
564 Ga0501083_0039529
565 Ga0501083_0069745
566 Ga0501045_0001967
567 Ga0501045_0183241
568 Ga0501045_0234218
569 nmdc:mga05p37_1017_c1
570 nmdc:mga05p37_11799_c1
571 nmdc:mga05p37_134424_c1
572 nmdc:mga05p37_13707_c1
573 nmdc:mga05p37_140958_c1
574 nmdc:mga05p37_1447_c1
575 nmdc:mga05p37_1449_c1
576 nmdc:mga05p37_182734_c1
577 nmdc:mga05p37_193262_c1
578 nmdc:mga05p37_22775_c1
579 nmdc:mga05p37_4491_c1
580 nmdc:mga05p37_503051_c1
581 nmdc:mga05p37_508553_c1
582 nmdc:mga05p37_575684_c1
583 nmdc:mga05p37_65802_c1
584 nmdc:mga05p37_77195_c1
585 nmdc:mga05p37_79768_c1
586 nmdc:mga05p37_83828_c1
587 nmdc:mga05p37_9198_c1
588 nmdc:mga05p37_97644_c1
589 nmdc:mga09592_10028_c1
590 nmdc:mga09592_135650_c1
591 nmdc:mga09592_21673_c1
592 nmdc:mga09592_31014_c1
593 nmdc:mga09592_35230_c1
594 nmdc:mga09592_356367_c1
595 nmdc:mga09592_43522_c1
596 nmdc:mga09592_58342_c1
597 nmdc:mga09592_85131_c1
598 nmdc:mga0qj67_128078_c1
599 nmdc:mga0qj67_143791_c1
600 nmdc:mga0qj67_146331_c1
601 nmdc:mga0qj67_3530_c1
602 nmdc:mga0qj67_40834_c1
603 nmdc:mga0qj67_42440_c1
604 nmdc:mga06r32_101583_c1
605 nmdc:mga06r32_1053_c1
606 nmdc:mga06r32_11300_c1
607 nmdc:mga06r32_27204_c1
608 nmdc:mga06r32_27802_c1
609 nmdc:mga06r32_36482_c1
610 nmdc:mga06r32_368192_c1
611 nmdc:mga06r32_585461_c1
612 nmdc:mga06r32_59784_c1
613 nmdc:mga06r32_62134_c1
614 nmdc:mga06r32_630_c1
615 nmdc:mga06r32_6555_c1
616 nmdc:mga06r32_84962_c1
617 nmdc:mga06r32_906_c1
618 nmdc:mga06r32_9723_c1
619 nmdc:mga08y16_114790_c1
620 nmdc:mga08y16_51778_c1
621 nmdc:mga08y16_6396_c1
622 nmdc:mga0n895_19199_c1
623 nmdc:mga0n895_1964_c1
624 nmdc:mga0n895_37845_c1
625 nmdc:mga0n895_59673_c1
626 nmdc:mga0n895_65543_c1
627 nmdc:mga0n895_694741_c1
628 nmdc:mga0n895_8579_c1
629 nmdc:mga0rr50_263480_c1
630 nmdc:mga0rr50_3695_c1
631 nmdc:mga0rr50_56618_c1
632 nmdc:mga0rr50_6984_c1
633 nmdc:mga08x19_17589_c1
634 nmdc:mga08x19_623_c1
635 nmdc:mga08x19_9304_c1
636 nmdc:mga0a205_15176_c1
637 nmdc:mga0a205_17342_c2
638 nmdc:mga0a205_38881_c1
639 nmdc:mga0a205_4070_c1
640 nmdc:mga0a205_40886_c1
641 nmdc:mga0a205_68897_c1
642 nmdc:mga0a205_78924_c1
643 nmdc:mga0a205_9669_c1
644 Ga0501084_0006458
645 Ga0501084_0041912
646 Ga0501084_0128927
647 Ga0501084_0214567
648 Ga0501084_0607840
649 Ga0501082_0023854
650 Ga0530510_0000127
651 Ga0530510_0020481
652 Ga0530510_0173459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

185

314

0.99

PF20229

ChrB_N

Protein ChrB, N-terminal

21

161

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exc-assembly1.cif.gz_X-2 structure of the rna'se sso8090 from sulfolobus solfataricus 0.7749 6 72
2i0x-assembly1.cif.gz_A hypothetical protein pf1117 from pyrococcus furiosus 0.7578 6 79
5g4d-assembly1.cif.gz_A-2 crystal structure of the cas2 in t.onnurineus 0.7523 2 79
5zyf-assembly3.cif.gz_F crystal structure of streptococcus pyogenes type ii-a cas2 0.7502 5 74
7mi5-assembly1.cif.gz_F asymmetrical pam-non pam prespacer bound cas4/cas1/cas2 complex 0.7446 4 81
ID Description Score Start End Superfamily
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7984 6 72 3.30.70.240
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7678 6 72 3.30.70.240
3excX01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7349 7 72 3.30.70.240
4es1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.728 1 79 3.30.70.240
3excX01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7153 7 72 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A2V6X8M0-F1-model_v4 ChrB N-terminal domain-containing protein 0.9431 12 161
AF-A0A2V6QWR4-F1-model_v4 ChrB protein 0.9419 5 111
AF-A0A132NL69-F1-model_v4 Chromate resistance protein 0.9367 6 68
AF-A0A7J2Z028-F1-model_v4 ChrB N-terminal domain-containing protein 0.9359 4 75
AF-A0A4Y7X6X3-F1-model_v4 deleted 0.9346 3 95

Map