F408204

General Info

Members Datasets Scaffolds Average Seq Length
326 177 652 143

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100189530|Ga0070686_1001895301
Length 162
Sequence LGFLWSLVFVVWCFALYPVDELTDEKTMNPTRILPDLQCSLLCEEIRQEINGSFFLIGVINFIRVPKLPVVAFRLCVFNRWAAGLGQFNECVRLIAPDQMTVLRKSEVKFTLQDAALSATNVTVMPQVEFKAAGTYFIEVLVDDVMKLRYPVPIVHTPPPEA

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0.92
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 23.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100189530 3300005544 Bacteria 1467
2 Ga0065707_10580470 3300005295 Unclassified 702
3 Ga0065707_10622725 3300005295 Bacteria 678
4 Ga0065707_10842716 3300005295 Unclassified 561
5 Ga0070683_100710873 3300005329 Bacteria 962
6 Ga0070683_101221362 3300005329 Unclassified 722
7 Ga0070690_101605058 3300005330 Bacteria 527
8 Ga0068869_100887803 3300005334 Bacteria 771
9 Ga0070680_100583582 3300005336 Unclassified 959
10 Ga0070689_100076970 3300005340 Bacteria 2614
11 Ga0070689_100078727 3300005340 Unclassified 2585
12 Ga0070689_100080421 3300005340 Bacteria 2557
13 Ga0070689_100882912 3300005340 Bacteria 790
14 Ga0070691_10089539 3300005341 Bacteria 1516
15 Ga0070675_100988807 3300005354 Unclassified 772
16 Ga0070688_100356711 3300005365 Bacteria 1072
17 Ga0070709_10951514 3300005434 Unclassified 681
18 Ga0070714_100002043 3300005435 Bacteria 14780
19 Ga0070714_100698475 3300005435 Bacteria 979
20 Ga0070705_100169236 3300005440 Bacteria 1469
21 Ga0070694_101401544 3300005444 Unclassified 590
22 Ga0070678_100385829 3300005456 Bacteria 1213
23 Ga0070681_10682524 3300005458 Bacteria 943
24 Ga0068867_100934623 3300005459 Bacteria 782
25 Ga0070685_10182098 3300005466 Unclassified 1353
26 Ga0070679_101069967 3300005530 Unclassified 751
27 Ga0070684_100536395 3300005535 Bacteria 1085
28 Ga0070686_100031033 3300005544 Unclassified 3264
29 Ga0070704_100775312 3300005549 Bacteria 855
30 Ga0068855_100057568 3300005563 Bacteria 4555
31 Ga0068857_101343670 3300005577 Unclassified 694
32 Ga0068856_100543056 3300005614 Unclassified 1183
33 Ga0068856_101042779 3300005614 Unclassified 836
34 Ga0070702_101703267 3300005615 Bacteria 524
35 Ga0068859_100397083 3300005617 Bacteria 1475
36 Ga0068864_100216953 3300005618 Bacteria 1764
37 Ga0068864_100320548 3300005618 Bacteria 1455
38 Ga0068864_101766800 3300005618 Bacteria 623
39 Ga0068863_100026934 3300005841 Bacteria 5482
40 Ga0068863_100467011 3300005841 Bacteria 1240
41 Ga0068863_101554752 3300005841 Bacteria 670
42 Ga0068863_102028040 3300005841 Unclassified 585
43 Ga0068863_102521616 3300005841 Bacteria 523
44 Ga0068858_100479707 3300005842 Bacteria 1200
45 Ga0081455_10755705 3300005937 Unclassified 614
46 Ga0070717_10502959 3300006028 Bacteria 1095
47 Ga0070712_100805253 3300006175 Unclassified 806
48 Ga0070712_100904227 3300006175 Unclassified 761
49 Ga0097621_100035985 3300006237 Bacteria 3957
50 Ga0097621_100141341 3300006237 Bacteria 2057
51 Ga0068871_101087100 3300006358 Unclassified 747
52 Ga0068871_101797920 3300006358 Unclassified 582
53 Ga0075428_100082586 3300006844 Bacteria 3506
54 Ga0075428_100790446 3300006844 Unclassified 1009
55 Ga0075431_100078410 3300006847 Bacteria 3410
56 Ga0075431_100963848 3300006847 Unclassified 821
57 Ga0075433_10736729 3300006852 Unclassified 862
58 Ga0075429_101386096 3300006880 Bacteria 612
59 Ga0097620_100053080 3300006931 Bacteria 4076
60 Ga0097620_100378911 3300006931 Unclassified 1510
61 Ga0097620_100397118 3300006931 Bacteria 1475
62 Ga0097620_100817167 3300006931 Bacteria 1019
63 Ga0075435_100205122 3300007076 Bacteria 1671
64 Ga0075435_101941443 3300007076 Bacteria 517
65 Ga0099794_10099731 3300007265 Bacteria 1449
66 Ga0105240_10104030 3300009093 Bacteria 3448
67 Ga0105240_12501983 3300009093 Unclassified 534
68 Ga0111539_10009455 3300009094 Bacteria 12301
69 Ga0111539_10521789 3300009094 Bacteria 1384
70 Ga0111539_13260372 3300009094 Unclassified 523
71 Ga0105245_10095250 3300009098 Bacteria 2746
72 Ga0105245_12007795 3300009098 Bacteria 632
73 Ga0114129_11685596 3300009147 Bacteria 774
74 Ga0105241_11148178 3300009174 Bacteria 733
75 Ga0105242_10152557 3300009176 Bacteria 2016
76 Ga0105242_10271453 3300009176 Bacteria 1536
77 Ga0105248_13194571 3300009177 Bacteria 521
78 Ga0105238_10448465 3300009551 Bacteria 1287
79 Ga0105249_10359706 3300009553 Bacteria 1477
80 Ga0105239_11188073 3300010375 Bacteria 879
81 Ga0157370_10047623 3300013104 Bacteria 4109
82 Ga0157378_10276516 3300013297 Unclassified 1617
83 Ga0157378_10820054 3300013297 Bacteria 957
84 Ga0157378_12009883 3300013297 Unclassified 628
85 Ga0157372_10667129 3300013307 Unclassified 1211
86 Ga0163163_10000133 3300014325 Bacteria 76552
87 Ga0163163_10017690 3300014325 Bacteria 6655
88 Ga0163163_11380207 3300014325 Bacteria 766
89 Ga0157377_10123429 3300014745 Bacteria 1573
90 Ga0157376_10127483 3300014969 Bacteria 2266
91 Ga0157376_10576555 3300014969 Bacteria 1117
92 Ga0157376_10826749 3300014969 Bacteria 940
93 Ga0157376_12943828 3300014969 Unclassified 515
94 Ga0207699_11435150 3300025906 Unclassified 511
95 Ga0207707_10211898 3300025912 Bacteria 1687
96 Ga0207695_10216157 3300025913 Bacteria 1826
97 Ga0207693_10736897 3300025915 Unclassified 762
98 Ga0207663_10010526 3300025916 Bacteria 4929
99 Ga0207657_10444362 3300025919 Bacteria 1018
100 Ga0207694_10021547 3300025924 Bacteria 4884
101 Ga0207687_10338960 3300025927 Bacteria 1222
102 Ga0207700_11312764 3300025928 Unclassified 644
103 Ga0207664_10002814 3300025929 Bacteria 11544
104 Ga0207686_10475612 3300025934 Bacteria 965
105 Ga0207686_10533222 3300025934 Bacteria 915
106 Ga0207670_10127759 3300025936 Bacteria 1857
107 Ga0207670_10700795 3300025936 Unclassified 838
108 Ga0207661_10908455 3300025944 Unclassified 811
109 Ga0207667_10024048 3300025949 Bacteria 6699
110 Ga0207667_10117124 3300025949 Bacteria 2745
111 Ga0207667_10603286 3300025949 Bacteria 1107
112 Ga0207712_10684269 3300025961 Unclassified 894
113 Ga0207703_10171811 3300026035 Bacteria 1907
114 Ga0207703_10783938 3300026035 Bacteria 909
115 Ga0207639_10267495 3300026041 Unclassified 1498
116 Ga0207708_10293476 3300026075 Bacteria 1320
117 Ga0207702_10463342 3300026078 Unclassified 1231
118 Ga0207702_12081910 3300026078 Unclassified 557
119 Ga0207641_10328524 3300026088 Bacteria 1452
120 Ga0207641_10434409 3300026088 Bacteria 1266
121 Ga0207641_10923524 3300026088 Unclassified 867
122 Ga0207641_10941030 3300026088 Bacteria 859
123 Ga0207641_11329265 3300026088 Bacteria 719
124 Ga0207641_12471855 3300026088 Bacteria 518
125 Ga0207676_10111581 3300026095 Bacteria 2289
126 Ga0207676_11782173 3300026095 Unclassified 614
127 Ga0207674_11749852 3300026116 Unclassified 589
128 Ga0207428_10073402 3300027907 Bacteria 2684
129 Ga0265337_1056360 3300028556 Bacteria 1096
130 Ga0265337_1112319 3300028556 Bacteria 740
131 Ga0265319_1000001 3300028563 Bacteria 549513
132 Ga0265319_1063415 3300028563 Bacteria 1195
133 Ga0265319_1132697 3300028563 Bacteria 774
134 Ga0265334_10344592 3300028573 Unclassified 509
135 Ga0265318_10140649 3300028577 Bacteria 886
136 Ga0265323_10038140 3300028653 Bacteria 1758
137 Ga0265336_10099200 3300028666 Bacteria 868
138 Ga0265336_10202858 3300028666 Bacteria 589
139 Ga0265338_10000040 3300028800 Bacteria 232041
140 Ga0265338_10000075 3300028800 Bacteria 180334
141 Ga0265338_10000196 3300028800 Bacteria 114348
142 Ga0265338_10003666 3300028800 Bacteria 21402
143 Ga0265338_10007588 3300028800 Bacteria 13400
144 Ga0265338_10009444 3300028800 Bacteria 11624
145 Ga0265338_10011453 3300028800 Bacteria 10239
146 Ga0265338_10024485 3300028800 Bacteria 6165
147 Ga0265338_10024750 3300028800 Bacteria 6121
148 Ga0265338_10038522 3300028800 Unclassified 4527
149 Ga0265338_10059640 3300028800 Bacteria 3360
150 Ga0265338_10072978 3300028800 Bacteria 2928
151 Ga0265338_10076222 3300028800 Bacteria 2841
152 Ga0265338_10138833 3300028800 Bacteria 1906
153 Ga0265338_10141493 3300028800 Bacteria 1884
154 Ga0265324_10000339 3300029957 Bacteria 34323
155 Ga0265324_10029753 3300029957 Unclassified 1920
156 Ga0265324_10058580 3300029957 Bacteria 1317
157 Ga0265324_10095041 3300029957 Bacteria 1014
158 Ga0265330_10168709 3300031235 Bacteria 928
159 Ga0265320_10007477 3300031240 Bacteria 6777
160 Ga0265320_10016503 3300031240 Bacteria 4135
161 Ga0265320_10106246 3300031240 Bacteria 1289
162 Ga0265325_10066946 3300031241 Bacteria 1810
163 Ga0265329_10180538 3300031242 Bacteria 690
164 Ga0265329_10264935 3300031242 Bacteria 575
165 Ga0265340_10001332 3300031247 Bacteria 14150
166 Ga0265340_10003993 3300031247 Bacteria 8290
167 Ga0265340_10051681 3300031247 Bacteria 1989
168 Ga0265340_10192492 3300031247 Bacteria 919
169 Ga0265340_10485990 3300031247 Unclassified 543
170 Ga0265339_10017833 3300031249 Bacteria 4196
171 Ga0265331_10132390 3300031250 Bacteria 1137
172 Ga0265327_10003856 3300031251 Bacteria 13833
173 Ga0265327_10050757 3300031251 Bacteria 2168
174 Ga0265327_10089021 3300031251 Bacteria 1509
175 Ga0265316_10026916 3300031344 Bacteria 4773
176 Ga0265316_10058677 3300031344 Bacteria 2996
177 Ga0265316_10313325 3300031344 Bacteria 1141
178 Ga0265313_10002054 3300031595 Bacteria 18055
179 Ga0265314_10179925 3300031711 Unclassified 1268
180 Ga0265314_10488881 3300031711 Bacteria 649
181 Ga0265342_10137265 3300031712 Bacteria 1366
182 Ga0265342_10138307 3300031712 Bacteria 1360
183 Ga0316576_10260597 3300031727 Bacteria 1301
184 Ga0316578_10626411 3300031728 Unclassified 629
185 Ga0316577_10261488 3300031733 Bacteria 979
186 Ga0307416_102192594 3300032002 Bacteria 654
187 Ga0316585_10106602 3300032137 Bacteria 921
188 Ga0316214_1018004 3300033545 Bacteria 982
189 Ga0373934_0146078 3300035086 Bacteria 968
190 Ga0373923_0402288 3300035111 Bacteria 659
191 Ga0373953_0053837 3300035117 Bacteria 1632
192 Ga0373956_0201901 3300035119 Bacteria 942
193 Ga0373962_0167851 3300035242 Unclassified 727
194 Ga0316574_0032736 3300035398 Bacteria 3161
195 Ga0373924_0070178 3300035410 Bacteria 1477
196 Ga0373931_0057456 3300035691 Unclassified 2087
197 Ga0373931_0626634 3300035691 Unclassified 705
198 Ga0373931_1243134 3300035691 Unclassified 511
199 Ga0373933_0078918 3300035724 Bacteria 2015
200 Ga0373947_0704654 3300035725 Bacteria 689
201 Ga0373937_0025594 3300036401 Bacteria 5329
202 Ga0373937_0105309 3300036401 Bacteria 2621
203 Ga0373937_0343631 3300036401 Unclassified 1413
204 Ga0373937_0685653 3300036401 Bacteria 971
205 Ga0316582_0095133 3300036647 Unclassified 1966
206 Ga0316584_0619880 3300036712 Bacteria 748
207 Ga0373925_0860358 3300037068 Bacteria 747
208 Ga0451577_0004934 3300042876 Bacteria 13881
209 Ga0451577_0239426 3300042876 Bacteria 1642
210 Ga0451577_0494610 3300042876 Bacteria 1110
211 Ga0453684_0112424 3300044712 Bacteria 3306
212 Ga0453684_0387514 3300044712 Bacteria 1568
213 Ga0453684_0739322 3300044712 Unclassified 1066
214 Ga0453684_1540201 3300044712 Bacteria 684
215 Ga0451576_0011564 3300045051 Bacteria 10013
216 Ga0451576_0031294 3300045051 Bacteria 5676
217 Ga0451576_0395196 3300045051 Unclassified 1449
218 Ga0451576_0455868 3300045051 Bacteria 1343
219 Ga0451576_0934510 3300045051 Bacteria 910
220 Ga0451576_0942195 3300045051 Unclassified 905
221 Ga0451576_1349222 3300045051 Bacteria 743
222 Ga0451576_1483945 3300045051 Bacteria 705
223 Ga0451576_1744189 3300045051 Bacteria 644
224 Ga0495592_0037591 3300046454 Bacteria 3645
225 Ga0495629_0106388 3300046459 Bacteria 1957
226 Ga0495641_0008631 3300046461 Bacteria 6173
227 Ga0495641_0022140 3300046461 Bacteria 3184
228 Ga0495651_0359682 3300046462 Unclassified 960
229 Ga0495653_0718391 3300046463 Bacteria 606
230 Ga0495582_0126151 3300046473 Bacteria 1444
231 Ga0495639_0097722 3300046475 Bacteria 1384
232 Ga0495639_0484690 3300046475 Bacteria 630
233 Ga0495662_0005401 3300046476 Bacteria 6394
234 Ga0495662_0258153 3300046476 Bacteria 858
235 Ga0495664_0051946 3300046477 Bacteria 2434
236 Ga0495608_0219988 3300046511 Bacteria 1192
237 Ga0495608_0722968 3300046511 Unclassified 591
238 Ga0495618_0025155 3300046514 Bacteria 3693
239 Ga0495618_0470050 3300046514 Unclassified 761
240 Ga0495628_0000142 3300046516 Bacteria 61312
241 Ga0495630_0000819 3300046517 Bacteria 21898
242 Ga0495630_0018100 3300046517 Bacteria 5171
243 Ga0495630_0028750 3300046517 Bacteria 4131
244 Ga0495630_0143813 3300046517 Bacteria 1813
245 Ga0495630_0914885 3300046517 Bacteria 668
246 Ga0495666_0000989 3300046526 Bacteria 13453
247 Ga0495666_0086304 3300046526 Bacteria 1482
248 Ga0495666_0339974 3300046526 Unclassified 677
249 Ga0495652_0037478 3300046529 Bacteria 4207
250 Ga0495652_0159529 3300046529 Unclassified 1753
251 Ga0495652_0353054 3300046529 Bacteria 1053
252 Ga0495640_0006360 3300046533 Bacteria 9356
253 Ga0495640_0050676 3300046533 Bacteria 2859
254 Ga0495640_0066554 3300046533 Bacteria 2430
255 Ga0495640_0401222 3300046533 Bacteria 842
256 Ga0495586_0000008 3300046535 Bacteria 148781
257 Ga0495586_0001796 3300046535 Bacteria 11724
258 Ga0495586_0009718 3300046535 Bacteria 5123
259 Ga0495586_0030765 3300046535 Bacteria 2873
260 Ga0495586_0236108 3300046535 Unclassified 1041
261 Ga0495587_0210522 3300046536 Unclassified 1098
262 Ga0495587_0233254 3300046536 Bacteria 1037
263 Ga0495587_0551701 3300046536 Unclassified 636
264 Ga0495645_0016001 3300046543 Bacteria 5346
265 Ga0495645_0026441 3300046543 Bacteria 4213
266 Ga0495645_0116630 3300046543 Bacteria 1884
267 Ga0495645_0134169 3300046543 Bacteria 1733
268 Ga0495645_0143329 3300046543 Bacteria 1665
269 Ga0495667_0565494 3300046559 Bacteria 710
270 Ga0495667_0872239 3300046559 Unclassified 553
271 Ga0495634_0007801 3300046642 Bacteria 8002
272 Ga0495634_0046049 3300046642 Bacteria 2945
273 Ga0495634_0048036 3300046642 Bacteria 2875
274 Ga0495599_0016369 3300046678 Bacteria 4603
275 Ga0495646_0151793 3300046680 Bacteria 1288
276 Ga0495647_0235674 3300046681 Bacteria 811
277 Ga0495658_0310626 3300046683 Bacteria 998
278 Ga0495658_0681136 3300046683 Bacteria 659
279 Ga0495613_0100146 3300046689 Bacteria 2093
280 Ga0495613_0316634 3300046689 Bacteria 1077
281 Ga0495613_0668358 3300046689 Unclassified 686
282 Ga0495624_0076468 3300046690 Bacteria 2077
283 Ga0495624_0093928 3300046690 Bacteria 1849
284 Ga0495624_0243425 3300046690 Bacteria 1088
285 Ga0495600_0137889 3300046809 Bacteria 1584
286 Ga0495600_0863201 3300046809 Unclassified 536
287 Ga0495604_0490374 3300047317 Unclassified 798
288 Ga0495604_0644522 3300047317 Bacteria 676
289 Ga0495604_0818539 3300047317 Unclassified 586
290 Ga0495674_0000914 3300047319 Bacteria 28204
291 Ga0495674_0040517 3300047319 Bacteria 4166
292 Ga0495674_0213778 3300047319 Bacteria 1596
293 Ga0495676_0019634 3300047321 Bacteria 5942
294 Ga0495676_0030270 3300047321 Bacteria 4598
295 Ga0495675_0053867 3300047444 Unclassified 2553
296 Ga0495675_0141519 3300047444 Bacteria 1491
297 Ga0495675_0318023 3300047444 Bacteria 921
298 Ga0495684_0037137 3300047471 Bacteria 3736
299 Ga0495684_0057940 3300047471 Bacteria 2952
300 Ga0496107_0043386 3300048910 Bacteria 3231
301 Ga0496113_0491021 3300048916 Bacteria 986
302 Ga0496115_0092787 3300048918 Bacteria 2469
303 Ga0501031_0001214 3300049568 Bacteria 15755
304 Ga0501034_0337603 3300049571 Bacteria 1437
305 Ga0501037_0679643 3300049573 Unclassified 686
306 Ga0501039_0321504 3300049575 Bacteria 1216
307 Ga0501043_0184190 3300049579 Bacteria 1626
308 Ga0501201_038249 3300049651 Unclassified 569
309 Ga0501035_0040293 3300049822 Bacteria 4222
310 Ga0501035_1135849 3300049822 Bacteria 609
311 Ga0501044_0000148 3300049823 Bacteria 86490
312 nmdc:mga09592_226073_c1 3300050508 Bacteria 1621
313 nmdc:mga09592_716178_c1 3300050508 Bacteria 851
314 nmdc:mga0qj67_364018_c1 3300050509 Bacteria 1168
315 nmdc:mga06r32_450173_c1 3300050510 Bacteria 1267
316 nmdc:mga08y16_1439652_c1 3300050511 Unclassified 651
317 nmdc:mga08y16_27904_c1 3300050511 Bacteria 5951
318 nmdc:mga08y16_771795_c1 3300050511 Bacteria 956
319 nmdc:mga0n895_267528_c1 3300050512 Bacteria 1734
320 nmdc:mga0rr50_1053519_c1 3300050513 Unclassified 692
321 nmdc:mga0rr50_1849006_c1 3300050513 Unclassified 508
322 nmdc:mga0rr50_86110_c1 3300050513 Bacteria 2436
323 nmdc:mga0a205_697342_c1 3300050515 Unclassified 865
324 Ga0495601_0009277 3300053077 Bacteria 5817
325 Ga0500650_0005169 3300053098 Bacteria 4826
326 Ga0500595_153348 3300053119 Unclassified 643
327 Ga0070686_100189530
328 Ga0065707_10580470
329 Ga0065707_10622725
330 Ga0065707_10842716
331 Ga0070683_100710873
332 Ga0070683_101221362
333 Ga0070690_101605058
334 Ga0068869_100887803
335 Ga0070680_100583582
336 Ga0070689_100076970
337 Ga0070689_100078727
338 Ga0070689_100080421
339 Ga0070689_100882912
340 Ga0070691_10089539
341 Ga0070675_100988807
342 Ga0070688_100356711
343 Ga0070709_10951514
344 Ga0070714_100002043
345 Ga0070714_100698475
346 Ga0070705_100169236
347 Ga0070694_101401544
348 Ga0070678_100385829
349 Ga0070681_10682524
350 Ga0068867_100934623
351 Ga0070685_10182098
352 Ga0070679_101069967
353 Ga0070684_100536395
354 Ga0070686_100031033
355 Ga0070704_100775312
356 Ga0068855_100057568
357 Ga0068857_101343670
358 Ga0068856_100543056
359 Ga0068856_101042779
360 Ga0070702_101703267
361 Ga0068859_100397083
362 Ga0068864_100216953
363 Ga0068864_100320548
364 Ga0068864_101766800
365 Ga0068863_100026934
366 Ga0068863_100467011
367 Ga0068863_101554752
368 Ga0068863_102028040
369 Ga0068863_102521616
370 Ga0068858_100479707
371 Ga0081455_10755705
372 Ga0070717_10502959
373 Ga0070712_100805253
374 Ga0070712_100904227
375 Ga0097621_100035985
376 Ga0097621_100141341
377 Ga0068871_101087100
378 Ga0068871_101797920
379 Ga0075428_100082586
380 Ga0075428_100790446
381 Ga0075431_100078410
382 Ga0075431_100963848
383 Ga0075433_10736729
384 Ga0075429_101386096
385 Ga0097620_100053080
386 Ga0097620_100378911
387 Ga0097620_100397118
388 Ga0097620_100817167
389 Ga0075435_100205122
390 Ga0075435_101941443
391 Ga0099794_10099731
392 Ga0105240_10104030
393 Ga0105240_12501983
394 Ga0111539_10009455
395 Ga0111539_10521789
396 Ga0111539_13260372
397 Ga0105245_10095250
398 Ga0105245_12007795
399 Ga0114129_11685596
400 Ga0105241_11148178
401 Ga0105242_10152557
402 Ga0105242_10271453
403 Ga0105248_13194571
404 Ga0105238_10448465
405 Ga0105249_10359706
406 Ga0105239_11188073
407 Ga0157370_10047623
408 Ga0157378_10276516
409 Ga0157378_10820054
410 Ga0157378_12009883
411 Ga0157372_10667129
412 Ga0163163_10000133
413 Ga0163163_10017690
414 Ga0163163_11380207
415 Ga0157377_10123429
416 Ga0157376_10127483
417 Ga0157376_10576555
418 Ga0157376_10826749
419 Ga0157376_12943828
420 Ga0207699_11435150
421 Ga0207707_10211898
422 Ga0207695_10216157
423 Ga0207693_10736897
424 Ga0207663_10010526
425 Ga0207657_10444362
426 Ga0207694_10021547
427 Ga0207687_10338960
428 Ga0207700_11312764
429 Ga0207664_10002814
430 Ga0207686_10475612
431 Ga0207686_10533222
432 Ga0207670_10127759
433 Ga0207670_10700795
434 Ga0207661_10908455
435 Ga0207667_10024048
436 Ga0207667_10117124
437 Ga0207667_10603286
438 Ga0207712_10684269
439 Ga0207703_10171811
440 Ga0207703_10783938
441 Ga0207639_10267495
442 Ga0207708_10293476
443 Ga0207702_10463342
444 Ga0207702_12081910
445 Ga0207641_10328524
446 Ga0207641_10434409
447 Ga0207641_10923524
448 Ga0207641_10941030
449 Ga0207641_11329265
450 Ga0207641_12471855
451 Ga0207676_10111581
452 Ga0207676_11782173
453 Ga0207674_11749852
454 Ga0207428_10073402
455 Ga0265337_1056360
456 Ga0265337_1112319
457 Ga0265319_1000001
458 Ga0265319_1063415
459 Ga0265319_1132697
460 Ga0265334_10344592
461 Ga0265318_10140649
462 Ga0265323_10038140
463 Ga0265336_10099200
464 Ga0265336_10202858
465 Ga0265338_10000040
466 Ga0265338_10000075
467 Ga0265338_10000196
468 Ga0265338_10003666
469 Ga0265338_10007588
470 Ga0265338_10009444
471 Ga0265338_10011453
472 Ga0265338_10024485
473 Ga0265338_10024750
474 Ga0265338_10038522
475 Ga0265338_10059640
476 Ga0265338_10072978
477 Ga0265338_10076222
478 Ga0265338_10138833
479 Ga0265338_10141493
480 Ga0265324_10000339
481 Ga0265324_10029753
482 Ga0265324_10058580
483 Ga0265324_10095041
484 Ga0265330_10168709
485 Ga0265320_10007477
486 Ga0265320_10016503
487 Ga0265320_10106246
488 Ga0265325_10066946
489 Ga0265329_10180538
490 Ga0265329_10264935
491 Ga0265340_10001332
492 Ga0265340_10003993
493 Ga0265340_10051681
494 Ga0265340_10192492
495 Ga0265340_10485990
496 Ga0265339_10017833
497 Ga0265331_10132390
498 Ga0265327_10003856
499 Ga0265327_10050757
500 Ga0265327_10089021
501 Ga0265316_10026916
502 Ga0265316_10058677
503 Ga0265316_10313325
504 Ga0265313_10002054
505 Ga0265314_10179925
506 Ga0265314_10488881
507 Ga0265342_10137265
508 Ga0265342_10138307
509 Ga0316576_10260597
510 Ga0316578_10626411
511 Ga0316577_10261488
512 Ga0307416_102192594
513 Ga0316585_10106602
514 Ga0316214_1018004
515 Ga0373934_0146078
516 Ga0373923_0402288
517 Ga0373953_0053837
518 Ga0373956_0201901
519 Ga0373962_0167851
520 Ga0316574_0032736
521 Ga0373924_0070178
522 Ga0373931_0057456
523 Ga0373931_0626634
524 Ga0373931_1243134
525 Ga0373933_0078918
526 Ga0373947_0704654
527 Ga0373937_0025594
528 Ga0373937_0105309
529 Ga0373937_0343631
530 Ga0373937_0685653
531 Ga0316582_0095133
532 Ga0316584_0619880
533 Ga0373925_0860358
534 Ga0451577_0004934
535 Ga0451577_0239426
536 Ga0451577_0494610
537 Ga0453684_0112424
538 Ga0453684_0387514
539 Ga0453684_0739322
540 Ga0453684_1540201
541 Ga0451576_0011564
542 Ga0451576_0031294
543 Ga0451576_0395196
544 Ga0451576_0455868
545 Ga0451576_0934510
546 Ga0451576_0942195
547 Ga0451576_1349222
548 Ga0451576_1483945
549 Ga0451576_1744189
550 Ga0495592_0037591
551 Ga0495629_0106388
552 Ga0495641_0008631
553 Ga0495641_0022140
554 Ga0495651_0359682
555 Ga0495653_0718391
556 Ga0495582_0126151
557 Ga0495639_0097722
558 Ga0495639_0484690
559 Ga0495662_0005401
560 Ga0495662_0258153
561 Ga0495664_0051946
562 Ga0495608_0219988
563 Ga0495608_0722968
564 Ga0495618_0025155
565 Ga0495618_0470050
566 Ga0495628_0000142
567 Ga0495630_0000819
568 Ga0495630_0018100
569 Ga0495630_0028750
570 Ga0495630_0143813
571 Ga0495630_0914885
572 Ga0495666_0000989
573 Ga0495666_0086304
574 Ga0495666_0339974
575 Ga0495652_0037478
576 Ga0495652_0159529
577 Ga0495652_0353054
578 Ga0495640_0006360
579 Ga0495640_0050676
580 Ga0495640_0066554
581 Ga0495640_0401222
582 Ga0495586_0000008
583 Ga0495586_0001796
584 Ga0495586_0009718
585 Ga0495586_0030765
586 Ga0495586_0236108
587 Ga0495587_0210522
588 Ga0495587_0233254
589 Ga0495587_0551701
590 Ga0495645_0016001
591 Ga0495645_0026441
592 Ga0495645_0116630
593 Ga0495645_0134169
594 Ga0495645_0143329
595 Ga0495667_0565494
596 Ga0495667_0872239
597 Ga0495634_0007801
598 Ga0495634_0046049
599 Ga0495634_0048036
600 Ga0495599_0016369
601 Ga0495646_0151793
602 Ga0495647_0235674
603 Ga0495658_0310626
604 Ga0495658_0681136
605 Ga0495613_0100146
606 Ga0495613_0316634
607 Ga0495613_0668358
608 Ga0495624_0076468
609 Ga0495624_0093928
610 Ga0495624_0243425
611 Ga0495600_0137889
612 Ga0495600_0863201
613 Ga0495604_0490374
614 Ga0495604_0644522
615 Ga0495604_0818539
616 Ga0495674_0000914
617 Ga0495674_0040517
618 Ga0495674_0213778
619 Ga0495676_0019634
620 Ga0495676_0030270
621 Ga0495675_0053867
622 Ga0495675_0141519
623 Ga0495675_0318023
624 Ga0495684_0037137
625 Ga0495684_0057940
626 Ga0496107_0043386
627 Ga0496113_0491021
628 Ga0496115_0092787
629 Ga0501031_0001214
630 Ga0501034_0337603
631 Ga0501037_0679643
632 Ga0501039_0321504
633 Ga0501043_0184190
634 Ga0501201_038249
635 Ga0501035_0040293
636 Ga0501035_1135849
637 Ga0501044_0000148
638 nmdc:mga09592_226073_c1
639 nmdc:mga09592_716178_c1
640 nmdc:mga0qj67_364018_c1
641 nmdc:mga06r32_450173_c1
642 nmdc:mga08y16_1439652_c1
643 nmdc:mga08y16_27904_c1
644 nmdc:mga08y16_771795_c1
645 nmdc:mga0n895_267528_c1
646 nmdc:mga0rr50_1053519_c1
647 nmdc:mga0rr50_1849006_c1
648 nmdc:mga0rr50_86110_c1
649 nmdc:mga0a205_697342_c1
650 Ga0495601_0009277
651 Ga0500650_0005169
652 Ga0500595_153348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22091

DUF6941

Family of unknown function (DUF6941)

38

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d8g-assembly1.cif.gz_A d341a d367a calcium binding mutant of bacteroides uniformis beta-glucuronidase 2 0.8117 47 107
3cmg-assembly1.cif.gz_A crystal structure of putative beta-galactosidase from bacteroides fragilis 0.802 47 107
4fip-assembly1.cif.gz_E structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.7584 58 83
6d8g-assembly1.cif.gz_B d341a d367a calcium binding mutant of bacteroides uniformis beta-glucuronidase 2 0.7378 47 105
5uj6-assembly1.cif.gz_A crystal structure of bacteroides uniformis beta-glucuronidase 0.7282 47 105
ID Description Score Start End Superfamily
af_P48301_215_445_2.70.50.80 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1; 0.7444 47 82 2.70.50.80
af_C0HDP4_346_500_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7355 47 107 2.60.40.150
5z1aA02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7062 47 117 2.60.40.10
af_C6SYE3_33_121_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7058 57 108 2.60.40.1120
5b71F00 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6802 12 119 2.60.40.1930
ID Description Score Start End GO Terms
AF-A0A2V6A0T2-F1-model_v4 Uncharacterized protein 0.8901 46 124
AF-A0A7W1CVJ1-F1-model_v4 Uncharacterized protein 0.8665 6 124
AF-A0A2V6I8S2-F1-model_v4 Uncharacterized protein 0.8652 2 124
AF-A0A4Q5NQY8-F1-model_v4 Uncharacterized protein 0.8579 6 124
AF-A0A832HW15-F1-model_v4 Uncharacterized protein 0.8505 1 120 GO:0016020

Map