F408144

General Info

Members Datasets Scaffolds Average Seq Length
326 214 652 173

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10010718|Ga0070676_100107182
Length 195
Sequence MSSPGRQGPPRGPFVAPSEYRSAQHQGTPVSDVLLEGLAPVVDAGTRLIVLGSFPGVASLRAQQYYGHPRNHFWPILSALWGIDLVAAPYARRLDAVRRHHLGIWDVYASCRREGSLDSAIEQAQLNDLAGLRQLAPGLQAIAHNGGESARAMRVTRTLGLPVLRLPSTSPANASWSFERKLAAWRAAFEAHGVA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
199 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
200 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
213 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
214 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.71
Nodule 0.61
Rhizoplane 2.76
Rhizosphere 66.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10010718 3300005328 Bacteria 4974
2 JGI24735J21928_10052626 3300002067 Bacteria 1174
3 JGI24744J21845_10014318 3300002077 Bacteria 1594
4 JGI25159J45721_1002260 3300002987 Bacteria 7432
5 rootL2_10079308 3300003322 Bacteria 1379
6 rootL2_10270943 3300003322 Bacteria 1322
7 JGI26128J50194_1000199 3300003347 Bacteria 2811
8 Ga0055524_1000125 3300003775 Bacteria 90042
9 Ga0055530_10002627 3300003791 Bacteria 11278
10 Ga0055540_1000011 3300003792 Bacteria 282927
11 Ga0070658_10497782 3300005327 Bacteria 1052
12 Ga0070676_10018030 3300005328 Bacteria 3909
13 Ga0070676_10099090 3300005328 Bacteria 1798
14 Ga0070670_100050794 3300005331 Bacteria 3563
15 Ga0070670_100849199 3300005331 Bacteria 826
16 Ga0068869_101512134 3300005334 Bacteria 596
17 Ga0070660_100167341 3300005339 Bacteria 1774
18 Ga0070661_100036628 3300005344 Bacteria 3566
19 Ga0070661_100139331 3300005344 Bacteria 1827
20 Ga0070671_100148649 3300005355 Bacteria 1978
21 Ga0070674_101099039 3300005356 Bacteria 702
22 Ga0070659_100000596 3300005366 Bacteria 26453
23 Ga0070659_100071378 3300005366 Bacteria 2761
24 Ga0070667_100006189 3300005367 Bacteria 9953
25 Ga0070667_100126481 3300005367 Bacteria 2227
26 Ga0070678_100711160 3300005456 Bacteria 906
27 Ga0070662_100039097 3300005457 Bacteria 3373
28 Ga0070662_100537383 3300005457 Bacteria 978
29 Ga0068867_100011571 3300005459 Bacteria 6230
30 Ga0068867_100024455 3300005459 Bacteria 4328
31 Ga0068867_100448789 3300005459 Bacteria 1098
32 Ga0068867_101202128 3300005459 Bacteria 696
33 Ga0070706_100074998 3300005467 Bacteria 3130
34 Ga0068853_100232248 3300005539 Bacteria 1688
35 Ga0070665_100060177 3300005548 Bacteria 3807
36 Ga0070665_100378023 3300005548 Bacteria 1424
37 Ga0070664_100005397 3300005564 Bacteria 10262
38 Ga0070664_100113418 3300005564 Bacteria 2367
39 Ga0070664_100381896 3300005564 Bacteria 1286
40 Ga0068857_100121109 3300005577 Bacteria 2355
41 Ga0068857_100420065 3300005577 Bacteria 1247
42 Ga0068854_100281061 3300005578 Bacteria 1340
43 Ga0068854_100721714 3300005578 Bacteria 862
44 Ga0068852_100059250 3300005616 Bacteria 3320
45 Ga0068852_100228003 3300005616 Bacteria 1775
46 Ga0068852_100506912 3300005616 Bacteria 1202
47 Ga0068852_100594795 3300005616 Bacteria 1110
48 Ga0068859_100115185 3300005617 Bacteria 2753
49 Ga0068864_100017189 3300005618 Bacteria 6033
50 Ga0068851_10212259 3300005834 Bacteria 1084
51 Ga0068870_10022117 3300005840 Bacteria 3121
52 Ga0068860_100142938 3300005843 Bacteria 2301
53 Ga0075365_10245881 3300006038 Bacteria 1256
54 Ga0075363_100057675 3300006048 Bacteria 2084
55 Ga0075362_10007378 3300006177 Bacteria 4161
56 Ga0075362_10010957 3300006177 Bacteria 3559
57 Ga0075362_10377732 3300006177 Bacteria 712
58 Ga0075367_10087098 3300006178 Bacteria 1896
59 Ga0075369_10044256 3300006186 Bacteria 1912
60 Ga0075427_10044846 3300006194 Bacteria 752
61 Ga0075366_10001422 3300006195 Bacteria 11937
62 Ga0075366_10003392 3300006195 Bacteria 8398
63 Ga0075366_10005598 3300006195 Bacteria 6814
64 Ga0075366_10171109 3300006195 Bacteria 1318
65 Ga0075366_10183600 3300006195 Bacteria 1271
66 Ga0075366_10207627 3300006195 Bacteria 1192
67 Ga0075366_10396227 3300006195 Bacteria 850
68 Ga0075370_10006891 3300006353 Bacteria 5751
69 Ga0075370_10010130 3300006353 Bacteria 4914
70 Ga0075370_10371580 3300006353 Bacteria 856
71 Ga0068865_100055018 3300006881 Bacteria 2768
72 Ga0097620_100115174 3300006931 Bacteria 2753
73 Ga0079104_1000910 3300006946 Bacteria 23895
74 Ga0105240_10003836 3300009093 Bacteria 23255
75 Ga0105240_10502085 3300009093 Bacteria 1348
76 Ga0105245_10152022 3300009098 Bacteria 2189
77 Ga0114129_10031370 3300009147 Bacteria 7513
78 Ga0105243_10043951 3300009148 Bacteria 3503
79 Ga0105242_10283978 3300009176 Bacteria 1504
80 Ga0105237_10001634 3300009545 Bacteria 29121
81 Ga0105237_10599343 3300009545 Bacteria 1109
82 Ga0105238_10007933 3300009551 Bacteria 10621
83 Ga0105239_10000486 3300010375 Bacteria 57901
84 Ga0105246_10043092 3300011119 Bacteria 3060
85 Ga0157378_10183169 3300013297 Bacteria 1971
86 Ga0157378_10290624 3300013297 Bacteria 1579
87 Ga0163162_10069272 3300013306 Bacteria 3579
88 Ga0163162_10252200 3300013306 Bacteria 1897
89 Ga0157375_10178746 3300013308 Bacteria 2273
90 Ga0157375_10361045 3300013308 Bacteria 1619
91 Ga0163163_10581083 3300014325 Bacteria 1183
92 Ga0157379_10037499 3300014968 Bacteria 4322
93 Ga0182007_10020137 3300015262 Bacteria 2390
94 Ga0213872_10068652 3300021361 Bacteria 1599
95 Ga0209759_1000621 3300025256 Bacteria 33854
96 Ga0209759_1010423 3300025256 Bacteria 2724
97 Ga0209759_1027090 3300025256 Bacteria 1189
98 Ga0209675_1015536 3300025291 Bacteria 2254
99 Ga0209675_1024700 3300025291 Bacteria 1530
100 Ga0209050_1000583 3300025298 Bacteria 59089
101 Ga0209050_1010750 3300025298 Bacteria 4460
102 Ga0209256_1000113 3300025299 Bacteria 175296
103 Ga0209051_1000020 3300025303 Bacteria 508628
104 Ga0209051_1012103 3300025303 Bacteria 4197
105 Ga0209257_1000085 3300025304 Bacteria 291117
106 Ga0207682_10174905 3300025893 Bacteria 978
107 Ga0207645_10005609 3300025907 Bacteria 9076
108 Ga0207645_10005949 3300025907 Bacteria 8790
109 Ga0207645_10091843 3300025907 Bacteria 1952
110 Ga0207643_10043286 3300025908 Bacteria 2541
111 Ga0207705_10045252 3300025909 Bacteria 3163
112 Ga0207684_10114045 3300025910 Bacteria 2314
113 Ga0207695_10038054 3300025913 Bacteria 5185
114 Ga0207695_10200859 3300025913 Bacteria 1908
115 Ga0207671_10003234 3300025914 Bacteria 16385
116 Ga0207681_10488361 3300025923 Bacteria 1007
117 Ga0207694_10123307 3300025924 Bacteria 2070
118 Ga0207650_10297557 3300025925 Bacteria 1317
119 Ga0207687_10041819 3300025927 Bacteria 3150
120 Ga0207644_10053869 3300025931 Bacteria 2896
121 Ga0207690_10011977 3300025932 Bacteria 5186
122 Ga0207706_10001982 3300025933 Bacteria 20071
123 Ga0207706_10709992 3300025933 Bacteria 859
124 Ga0207686_10267107 3300025934 Bacteria 1257
125 Ga0207709_10042106 3300025935 Bacteria 2745
126 Ga0207709_10492070 3300025935 Bacteria 955
127 Ga0207691_10039321 3300025940 Bacteria 4376
128 Ga0207679_10004599 3300025945 Bacteria 8585
129 Ga0207679_10419845 3300025945 Bacteria 1180
130 Ga0207640_10165746 3300025981 Bacteria 1640
131 Ga0207658_10242526 3300025986 Bacteria 1527
132 Ga0207677_10143320 3300026023 Bacteria 1833
133 Ga0207639_11182958 3300026041 Bacteria 717
134 Ga0207678_10415572 3300026067 Bacteria 1166
135 Ga0207648_10036974 3300026089 Bacteria 4301
136 Ga0207648_10041227 3300026089 Bacteria 4054
137 Ga0207648_10058899 3300026089 Bacteria 3350
138 Ga0207674_10047702 3300026116 Bacteria 4389
139 Ga0207674_10504836 3300026116 Bacteria 1168
140 Ga0207683_10118906 3300026121 Bacteria 2371
141 Ga0207683_10607348 3300026121 Bacteria 1013
142 Ga0207698_10174827 3300026142 Bacteria 1895
143 Ga0207698_10205938 3300026142 Bacteria 1766
144 Ga0207698_10322766 3300026142 Bacteria 1447
145 Ga0209281_1000195 3300027111 Bacteria 139144
146 Ga0209995_1028043 3300027471 Bacteria 940
147 Ga0209968_1001661 3300027526 Bacteria 3359
148 Ga0209970_1000227 3300027614 Bacteria 9093
149 Ga0209966_1000039 3300027695 Bacteria 54525
150 Ga0268266_10086339 3300028379 Bacteria 2743
151 Ga0268266_10490534 3300028379 Bacteria 1172
152 Ga0268266_10587239 3300028379 Bacteria 1069
153 Ga0268264_10124191 3300028381 Bacteria 2279
154 Ga0265334_10008764 3300028573 Bacteria 4297
155 Ga0307517_10132723 3300028786 Bacteria 1785
156 Ga0307515_10000132 3300028794 Bacteria 176547
157 Ga0307515_10023627 3300028794 Bacteria 10762
158 Ga0307515_10026937 3300028794 Bacteria 9857
159 Ga0307515_10228398 3300028794 Bacteria 1660
160 Ga0307515_10385899 3300028794 Bacteria 1031
161 Ga0265324_10002861 3300029957 Bacteria 8490
162 Ga0265327_10000341 3300031251 Bacteria 88581
163 Ga0307513_10038748 3300031456 Bacteria 5290
164 Ga0307509_10002549 3300031507 Bacteria 29262
165 Ga0307509_10015712 3300031507 Bacteria 8812
166 Ga0307509_10040785 3300031507 Bacteria 5046
167 Ga0307509_10045908 3300031507 Bacteria 4706
168 Ga0307509_10238177 3300031507 Bacteria 1615
169 Ga0307408_100036385 3300031548 Bacteria 3460
170 Ga0307408_100582326 3300031548 Bacteria 992
171 Ga0307508_10000893 3300031616 Bacteria 34750
172 Ga0307508_10067671 3300031616 Bacteria 3141
173 Ga0307508_10174792 3300031616 Bacteria 1750
174 Ga0307514_10044350 3300031649 Bacteria 3484
175 Ga0307514_10198723 3300031649 Bacteria 1264
176 Ga0307516_10000054 3300031730 Bacteria 126288
177 Ga0307516_10003657 3300031730 Bacteria 19544
178 Ga0307516_10006860 3300031730 Bacteria 13264
179 Ga0307516_10112483 3300031730 Bacteria 2523
180 Ga0307516_10123077 3300031730 Bacteria 2381
181 Ga0307516_10799899 3300031730 Bacteria 604
182 Ga0307413_10000903 3300031824 Bacteria 10501
183 Ga0307410_10007196 3300031852 Bacteria 6072
184 Ga0307410_10222784 3300031852 Bacteria 1452
185 Ga0307406_10016236 3300031901 Bacteria 4323
186 Ga0307406_10261704 3300031901 Bacteria 1309
187 Ga0307407_10021609 3300031903 Bacteria 3323
188 Ga0307412_10002162 3300031911 Bacteria 10904
189 Ga0307412_10351483 3300031911 Bacteria 1184
190 Ga0307416_100006454 3300032002 Bacteria 7346
191 Ga0307416_101896124 3300032002 Bacteria 699
192 Ga0307411_10031621 3300032005 Bacteria 3259
193 Ga0307411_10800618 3300032005 Bacteria 830
194 Ga0307411_11003225 3300032005 Bacteria 747
195 Ga0307411_11140678 3300032005 Bacteria 704
196 Ga0307411_11240409 3300032005 Bacteria 677
197 Ga0307415_100033264 3300032126 Bacteria 3346
198 Ga0307510_10017610 3300033180 Bacteria 8420
199 Ga0307510_10040755 3300033180 Bacteria 5091
200 Ga0307510_10062152 3300033180 Bacteria 3818
201 Ga0373925_0219600 3300037068 Bacteria 1517
202 Ga0395905_0000460 3300037471 Bacteria 56900
203 Ga0436361_1112532 3300039447 Bacteria 2954
204 Ga0439461_0023074 3300041410 Bacteria 1250
205 Ga0451807_2202337 3300041486 Bacteria 875
206 Ga0451833_1170525 3300041491 Bacteria 702
207 Ga0451851_0654403 3300041507 Bacteria 573
208 Ga0439441_136584 3300042001 Bacteria 571
209 Ga0439449_0065254 3300042007 Bacteria 1343
210 Ga0450919_000577 3300042121 Bacteria 4621
211 Ga0450920_016122 3300042122 Bacteria 1424
212 Ga0450890_004724 3300042127 Bacteria 1773
213 Ga0450898_022846 3300042134 Bacteria 1109
214 Ga0450898_094929 3300042134 Bacteria 619
215 Ga0450899_012174 3300042135 Bacteria 965
216 Ga0439458_0040356 3300042157 Bacteria 1131
217 Ga0439434_0015856 3300042435 Bacteria 2248
218 Ga0439464_0053111 3300042439 Bacteria 1175
219 Ga0450918_000150 3300042531 Bacteria 15323
220 Ga0451577_0003919 3300042876 Bacteria 16077
221 Ga0451577_0029559 3300042876 Bacteria 4954
222 Ga0466972_0001003 3300044658 Bacteria 13562
223 Ga0466972_0040949 3300044658 Bacteria 2256
224 Ga0466972_0042078 3300044658 Bacteria 2223
225 Ga0466965_0031470 3300044683 Bacteria 2588
226 Ga0466965_0079215 3300044683 Bacteria 1659
227 Ga0466961_0036310 3300044693 Bacteria 3163
228 Ga0466963_0039340 3300044694 Bacteria 3096
229 Ga0466963_0529044 3300044694 Bacteria 832
230 Ga0466964_0009859 3300044706 Bacteria 3598
231 Ga0466964_0287263 3300044706 Bacteria 824
232 Ga0453684_0014067 3300044712 Bacteria 12869
233 Ga0453684_0379775 3300044712 Bacteria 1587
234 Ga0466970_0003683 3300044765 Bacteria 7482
235 Ga0466957_0026331 3300044842 Bacteria 3449
236 Ga0466959_0000073 3300045049 Bacteria 66721
237 Ga0451576_0530497 3300045051 Bacteria 1237
238 Ga0451576_1395217 3300045051 Bacteria 729
239 Ga0466958_0228214 3300045836 Bacteria 1188
240 Ga0466967_0021937 3300045976 Bacteria 5198
241 Ga0466967_0033376 3300045976 Bacteria 4356
242 Ga0466967_0151632 3300045976 Bacteria 2167
243 Ga0495592_0010185 3300046454 Bacteria 7088
244 Ga0495590_0085131 3300046457 Bacteria 1115
245 Ga0495629_0477777 3300046459 Bacteria 842
246 Ga0495650_0002900 3300046471 Bacteria 13036
247 Ga0495650_0074801 3300046471 Bacteria 1320
248 Ga0495639_0062332 3300046475 Bacteria 1710
249 Ga0495585_0008941 3300046492 Bacteria 6041
250 Ga0495583_0000200 3300046506 Bacteria 100827
251 Ga0495606_0001544 3300046507 Bacteria 30344
252 Ga0495610_0036622 3300046512 Bacteria 2505
253 Ga0495632_0004869 3300046519 Bacteria 9004
254 Ga0495632_0341938 3300046519 Bacteria 659
255 Ga0495648_0223568 3300046524 Bacteria 927
256 Ga0495666_0087028 3300046526 Bacteria 1476
257 Ga0495597_0010168 3300046542 Bacteria 4610
258 Ga0495597_0051590 3300046542 Bacteria 1813
259 Ga0495668_0028159 3300046616 Bacteria 3179
260 Ga0495625_0009650 3300046660 Bacteria 8045
261 Ga0495625_0241783 3300046660 Bacteria 1175
262 Ga0495625_0270265 3300046660 Bacteria 1097
263 Ga0495625_0343767 3300046660 Bacteria 945
264 Ga0495646_0572166 3300046680 Bacteria 576
265 Ga0495658_0601877 3300046683 Bacteria 704
266 Ga0495669_0072706 3300046684 Bacteria 1569
267 Ga0495613_0846969 3300046689 Bacteria 594
268 Ga0495671_0060125 3300046692 Bacteria 1876
269 Ga0495649_0000068 3300046694 Bacteria 92317
270 Ga0495649_0001817 3300046694 Bacteria 15673
271 Ga0495649_0284644 3300046694 Bacteria 844
272 Ga0495589_0002321 3300046794 Bacteria 10694
273 Ga0495604_0080213 3300047317 Bacteria 2446
274 Ga0495683_0028526 3300047323 Bacteria 2853
275 Ga0495687_000915 3300047443 Bacteria 30729
276 Ga0495686_0132936 3300047472 Bacteria 1474
277 Ga0495614_0139899 3300048089 Bacteria 1075
278 Ga0495626_0122059 3300048091 Bacteria 1119
279 Ga0496101_0534579 3300048904 Bacteria 927
280 Ga0496102_0018890 3300048905 Bacteria 6065
281 Ga0496102_0090823 3300048905 Bacteria 2826
282 Ga0496106_0057060 3300048909 Bacteria 2953
283 Ga0496109_0131016 3300048912 Bacteria 2340
284 Ga0496110_0054831 3300048913 Bacteria 3506
285 Ga0496114_0030493 3300048917 Bacteria 4438
286 Ga0496114_0537076 3300048917 Bacteria 1034
287 Ga0496124_0000126 3300048927 Bacteria 159539
288 Ga0496124_0173693 3300048927 Bacteria 1666
289 Ga0496125_0017251 3300048928 Bacteria 6897
290 nmdc:mga03683_12988_c1 3300050489 Bacteria 3055
291 nmdc:mga0k408_1184_c1 3300050493 Bacteria 14276
292 nmdc:mga0k408_1268_c1 3300050493 Bacteria 13721
293 nmdc:mga0k408_27894_c1 3300050493 Bacteria 3209
294 nmdc:mga0k408_349179_c1 3300050493 Bacteria 882
295 nmdc:mga0k408_46090_c1 3300050493 Bacteria 2517
296 nmdc:mga0k408_674_c1 3300050493 Bacteria 18724
297 nmdc:mga06z11_39879_c1 3300050494 Bacteria 2340
298 nmdc:mga07m45_180703_c1 3300050496 Bacteria 1227
299 nmdc:mga07m45_1872_c1 3300050496 Bacteria 9721
300 nmdc:mga07m45_5363_c1 3300050496 Bacteria 6385
301 nmdc:mga05p37_373244_c1 3300050507 Bacteria 1673
302 nmdc:mga0sz30_27313_c1 3300050516 Bacteria 2344
303 Ga0500635_0022516 3300053080 Bacteria 1954
304 Ga0500578_0201237 3300053086 Bacteria 1219
305 Ga0500651_0006961 3300053093 Bacteria 6561
306 Ga0500651_0041622 3300053093 Bacteria 2896
307 Ga0500651_0053616 3300053093 Bacteria 2529
308 Ga0500650_0206291 3300053098 Bacteria 894
309 Ga0500562_014972 3300053108 Bacteria 1988
310 Ga0500593_002514 3300053117 Bacteria 6743
311 Ga0500607_083143 3300053121 Bacteria 1628
312 Ga0500608_033064 3300053122 Bacteria 2460
313 Ga0500655_001756 3300053133 Bacteria 4061
314 Ga0500658_0006603 3300053134 Bacteria 4301
315 Ga0500559_0000014 3300053136 Bacteria 160139
316 Ga0500568_0025024 3300053139 Bacteria 2522
317 Ga0500568_0037472 3300053139 Bacteria 1967
318 Ga0500590_015227 3300053148 Bacteria 3969
319 Ga0500619_074091 3300053154 Bacteria 1136
320 Ga0500622_0010264 3300053156 Bacteria 5147
321 Ga0500633_0240899 3300053160 Bacteria 673
322 Ga0500636_0024850 3300053177 Bacteria 3540
323 Ga0590074_013178 3300059423 Bacteria 1394
324 2511242999 2511231002 Bacteria 5042903
325 2644248860 2643221644 Bacteria 6865017
326 2644338741 2643221660 Bacteria 4208257
327 Ga0070676_10010718
328 JGI24735J21928_10052626
329 JGI24744J21845_10014318
330 JGI25159J45721_1002260
331 rootL2_10079308
332 rootL2_10270943
333 JGI26128J50194_1000199
334 Ga0055524_1000125
335 Ga0055530_10002627
336 Ga0055540_1000011
337 Ga0070658_10497782
338 Ga0070676_10018030
339 Ga0070676_10099090
340 Ga0070670_100050794
341 Ga0070670_100849199
342 Ga0068869_101512134
343 Ga0070660_100167341
344 Ga0070661_100036628
345 Ga0070661_100139331
346 Ga0070671_100148649
347 Ga0070674_101099039
348 Ga0070659_100000596
349 Ga0070659_100071378
350 Ga0070667_100006189
351 Ga0070667_100126481
352 Ga0070678_100711160
353 Ga0070662_100039097
354 Ga0070662_100537383
355 Ga0068867_100011571
356 Ga0068867_100024455
357 Ga0068867_100448789
358 Ga0068867_101202128
359 Ga0070706_100074998
360 Ga0068853_100232248
361 Ga0070665_100060177
362 Ga0070665_100378023
363 Ga0070664_100005397
364 Ga0070664_100113418
365 Ga0070664_100381896
366 Ga0068857_100121109
367 Ga0068857_100420065
368 Ga0068854_100281061
369 Ga0068854_100721714
370 Ga0068852_100059250
371 Ga0068852_100228003
372 Ga0068852_100506912
373 Ga0068852_100594795
374 Ga0068859_100115185
375 Ga0068864_100017189
376 Ga0068851_10212259
377 Ga0068870_10022117
378 Ga0068860_100142938
379 Ga0075365_10245881
380 Ga0075363_100057675
381 Ga0075362_10007378
382 Ga0075362_10010957
383 Ga0075362_10377732
384 Ga0075367_10087098
385 Ga0075369_10044256
386 Ga0075427_10044846
387 Ga0075366_10001422
388 Ga0075366_10003392
389 Ga0075366_10005598
390 Ga0075366_10171109
391 Ga0075366_10183600
392 Ga0075366_10207627
393 Ga0075366_10396227
394 Ga0075370_10006891
395 Ga0075370_10010130
396 Ga0075370_10371580
397 Ga0068865_100055018
398 Ga0097620_100115174
399 Ga0079104_1000910
400 Ga0105240_10003836
401 Ga0105240_10502085
402 Ga0105245_10152022
403 Ga0114129_10031370
404 Ga0105243_10043951
405 Ga0105242_10283978
406 Ga0105237_10001634
407 Ga0105237_10599343
408 Ga0105238_10007933
409 Ga0105239_10000486
410 Ga0105246_10043092
411 Ga0157378_10183169
412 Ga0157378_10290624
413 Ga0163162_10069272
414 Ga0163162_10252200
415 Ga0157375_10178746
416 Ga0157375_10361045
417 Ga0163163_10581083
418 Ga0157379_10037499
419 Ga0182007_10020137
420 Ga0213872_10068652
421 Ga0209759_1000621
422 Ga0209759_1010423
423 Ga0209759_1027090
424 Ga0209675_1015536
425 Ga0209675_1024700
426 Ga0209050_1000583
427 Ga0209050_1010750
428 Ga0209256_1000113
429 Ga0209051_1000020
430 Ga0209051_1012103
431 Ga0209257_1000085
432 Ga0207682_10174905
433 Ga0207645_10005609
434 Ga0207645_10005949
435 Ga0207645_10091843
436 Ga0207643_10043286
437 Ga0207705_10045252
438 Ga0207684_10114045
439 Ga0207695_10038054
440 Ga0207695_10200859
441 Ga0207671_10003234
442 Ga0207681_10488361
443 Ga0207694_10123307
444 Ga0207650_10297557
445 Ga0207687_10041819
446 Ga0207644_10053869
447 Ga0207690_10011977
448 Ga0207706_10001982
449 Ga0207706_10709992
450 Ga0207686_10267107
451 Ga0207709_10042106
452 Ga0207709_10492070
453 Ga0207691_10039321
454 Ga0207679_10004599
455 Ga0207679_10419845
456 Ga0207640_10165746
457 Ga0207658_10242526
458 Ga0207677_10143320
459 Ga0207639_11182958
460 Ga0207678_10415572
461 Ga0207648_10036974
462 Ga0207648_10041227
463 Ga0207648_10058899
464 Ga0207674_10047702
465 Ga0207674_10504836
466 Ga0207683_10118906
467 Ga0207683_10607348
468 Ga0207698_10174827
469 Ga0207698_10205938
470 Ga0207698_10322766
471 Ga0209281_1000195
472 Ga0209995_1028043
473 Ga0209968_1001661
474 Ga0209970_1000227
475 Ga0209966_1000039
476 Ga0268266_10086339
477 Ga0268266_10490534
478 Ga0268266_10587239
479 Ga0268264_10124191
480 Ga0265334_10008764
481 Ga0307517_10132723
482 Ga0307515_10000132
483 Ga0307515_10023627
484 Ga0307515_10026937
485 Ga0307515_10228398
486 Ga0307515_10385899
487 Ga0265324_10002861
488 Ga0265327_10000341
489 Ga0307513_10038748
490 Ga0307509_10002549
491 Ga0307509_10015712
492 Ga0307509_10040785
493 Ga0307509_10045908
494 Ga0307509_10238177
495 Ga0307408_100036385
496 Ga0307408_100582326
497 Ga0307508_10000893
498 Ga0307508_10067671
499 Ga0307508_10174792
500 Ga0307514_10044350
501 Ga0307514_10198723
502 Ga0307516_10000054
503 Ga0307516_10003657
504 Ga0307516_10006860
505 Ga0307516_10112483
506 Ga0307516_10123077
507 Ga0307516_10799899
508 Ga0307413_10000903
509 Ga0307410_10007196
510 Ga0307410_10222784
511 Ga0307406_10016236
512 Ga0307406_10261704
513 Ga0307407_10021609
514 Ga0307412_10002162
515 Ga0307412_10351483
516 Ga0307416_100006454
517 Ga0307416_101896124
518 Ga0307411_10031621
519 Ga0307411_10800618
520 Ga0307411_11003225
521 Ga0307411_11140678
522 Ga0307411_11240409
523 Ga0307415_100033264
524 Ga0307510_10017610
525 Ga0307510_10040755
526 Ga0307510_10062152
527 Ga0373925_0219600
528 Ga0395905_0000460
529 Ga0436361_1112532
530 Ga0439461_0023074
531 Ga0451807_2202337
532 Ga0451833_1170525
533 Ga0451851_0654403
534 Ga0439441_136584
535 Ga0439449_0065254
536 Ga0450919_000577
537 Ga0450920_016122
538 Ga0450890_004724
539 Ga0450898_022846
540 Ga0450898_094929
541 Ga0450899_012174
542 Ga0439458_0040356
543 Ga0439434_0015856
544 Ga0439464_0053111
545 Ga0450918_000150
546 Ga0451577_0003919
547 Ga0451577_0029559
548 Ga0466972_0001003
549 Ga0466972_0040949
550 Ga0466972_0042078
551 Ga0466965_0031470
552 Ga0466965_0079215
553 Ga0466961_0036310
554 Ga0466963_0039340
555 Ga0466963_0529044
556 Ga0466964_0009859
557 Ga0466964_0287263
558 Ga0453684_0014067
559 Ga0453684_0379775
560 Ga0466970_0003683
561 Ga0466957_0026331
562 Ga0466959_0000073
563 Ga0451576_0530497
564 Ga0451576_1395217
565 Ga0466958_0228214
566 Ga0466967_0021937
567 Ga0466967_0033376
568 Ga0466967_0151632
569 Ga0495592_0010185
570 Ga0495590_0085131
571 Ga0495629_0477777
572 Ga0495650_0002900
573 Ga0495650_0074801
574 Ga0495639_0062332
575 Ga0495585_0008941
576 Ga0495583_0000200
577 Ga0495606_0001544
578 Ga0495610_0036622
579 Ga0495632_0004869
580 Ga0495632_0341938
581 Ga0495648_0223568
582 Ga0495666_0087028
583 Ga0495597_0010168
584 Ga0495597_0051590
585 Ga0495668_0028159
586 Ga0495625_0009650
587 Ga0495625_0241783
588 Ga0495625_0270265
589 Ga0495625_0343767
590 Ga0495646_0572166
591 Ga0495658_0601877
592 Ga0495669_0072706
593 Ga0495613_0846969
594 Ga0495671_0060125
595 Ga0495649_0000068
596 Ga0495649_0001817
597 Ga0495649_0284644
598 Ga0495589_0002321
599 Ga0495604_0080213
600 Ga0495683_0028526
601 Ga0495687_000915
602 Ga0495686_0132936
603 Ga0495614_0139899
604 Ga0495626_0122059
605 Ga0496101_0534579
606 Ga0496102_0018890
607 Ga0496102_0090823
608 Ga0496106_0057060
609 Ga0496109_0131016
610 Ga0496110_0054831
611 Ga0496114_0030493
612 Ga0496114_0537076
613 Ga0496124_0000126
614 Ga0496124_0173693
615 Ga0496125_0017251
616 nmdc:mga03683_12988_c1
617 nmdc:mga0k408_1184_c1
618 nmdc:mga0k408_1268_c1
619 nmdc:mga0k408_27894_c1
620 nmdc:mga0k408_349179_c1
621 nmdc:mga0k408_46090_c1
622 nmdc:mga0k408_674_c1
623 nmdc:mga06z11_39879_c1
624 nmdc:mga07m45_180703_c1
625 nmdc:mga07m45_1872_c1
626 nmdc:mga07m45_5363_c1
627 nmdc:mga05p37_373244_c1
628 nmdc:mga0sz30_27313_c1
629 Ga0500635_0022516
630 Ga0500578_0201237
631 Ga0500651_0006961
632 Ga0500651_0041622
633 Ga0500651_0053616
634 Ga0500650_0206291
635 Ga0500562_014972
636 Ga0500593_002514
637 Ga0500607_083143
638 Ga0500608_033064
639 Ga0500655_001756
640 Ga0500658_0006603
641 Ga0500559_0000014
642 Ga0500568_0025024
643 Ga0500568_0037472
644 Ga0500590_015227
645 Ga0500619_074091
646 Ga0500622_0010264
647 Ga0500633_0240899
648 Ga0500636_0024850
649 Ga0590074_013178
650 2511242999
651 2644248860
652 2644338741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

39

190

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.9068 2 162
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.8962 2 162
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.7498 7 161
5cys-assembly1.cif.gz_A structure of the enzyme-product complex resulting from tdg action on a gcac mismatch 0.7411 5 162
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.7324 7 162
ID Description Score Start End Superfamily
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9068 2 162 3.40.470.10
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8962 2 162 3.40.470.10
af_A4I7J6_7_234_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8416 7 159 3.40.470.10
af_A4I7J6_7_234_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7709 7 159 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7652 4 162 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A8A7VGW6-F1-model_v4 deleted 0.9991 2 162
AF-A0A554WN66-F1-model_v4 HypoxanDNAglyco: DNA-deoxyinosine glycosylase 0.9987 3 166
AF-A0A0N0JDD8-F1-model_v4 DNA-deoxyinosine glycosylase 0.9973 2 162
AF-A0A2W4WCE0-F1-model_v4 DNA-deoxyinosine glycosylase 0.9958 1 159
AF-A0A839LFY4-F1-model_v4 DNA-deoxyinosine glycosylase (EC 3.2.2.15) 0.9953 2 162 GO:0016798

Map