F408065

General Info

Members Datasets Scaffolds Average Seq Length
325 194 650 150

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0045313|Ga0500559_0045313_377_868
Length 163
Sequence MSIRVAAQEADFDVGAELARLEALGGGGVASFTGVVRGDDSGKAGGAAGLTALRLEAYPGMTQRALEGIAAEAATRWSLAGLTLIHRFGTLGIGDRIVLVGTAARHRAAALEACAFLIDWAKTKAPLWKQEIFADGTTRWIEPRASDDAAAAEWDASAEHGKP

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
173 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
183 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
187 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
188 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
189 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
190 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
191 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
192 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
193 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
194 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 3.38
Rhizosphere 82.15
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0045313 3300053136 Bacteria 1925
2 SwRhRL2b_contig_645837 2162886007 Bacteria 2865
3 JGI24736J21556_1001483 3300001904 Bacteria 4292
4 JGI24741J21665_1000228 3300001915 Bacteria 16799
5 JGI24740J21852_10008724 3300001979 Bacteria 4024
6 JGI24739J22299_10002767 3300001989 Bacteria 6741
7 JGI24739J22299_10081354 3300001989 Bacteria 995
8 JGI24737J22298_10001502 3300001990 Bacteria 8302
9 JGI24737J22298_10068479 3300001990 Bacteria 1061
10 JGI24735J21928_10000586 3300002067 Bacteria 12808
11 JGI24735J21928_10003416 3300002067 Bacteria 5416
12 JGI24738J21930_10001423 3300002075 Bacteria 6636
13 JGI24738J21930_10007152 3300002075 Bacteria 2587
14 JGI24738J21930_10010385 3300002075 Bacteria 2073
15 JGI24744J21845_10000267 3300002077 Bacteria 8508
16 JGI24751J29686_10000195 3300002459 Bacteria 26688
17 rootL2_10177419 3300003322 Bacteria 2302
18 Ga0065704_10008199 3300005289 Bacteria 4967
19 Ga0065707_10004914 3300005295 Bacteria 4993
20 Ga0065707_10087462 3300005295 Bacteria 5014
21 Ga0070658_10095369 3300005327 Bacteria 2456
22 Ga0070658_10294339 3300005327 Bacteria 1384
23 Ga0070676_10163065 3300005328 Bacteria 1436
24 Ga0070670_100000033 3300005331 Bacteria 158509
25 Ga0070670_100000639 3300005331 Bacteria 27231
26 Ga0070670_101107550 3300005331 Unclassified 722
27 Ga0070666_10005633 3300005335 Bacteria 7686
28 Ga0070666_10034718 3300005335 Bacteria 3342
29 Ga0070660_100002644 3300005339 Bacteria 12315
30 Ga0070660_100006410 3300005339 Bacteria 8154
31 Ga0070660_100328190 3300005339 Bacteria 1258
32 Ga0070660_100832701 3300005339 Bacteria 777
33 Ga0070661_100059465 3300005344 Bacteria 2802
34 Ga0070661_100317610 3300005344 Bacteria 1216
35 Ga0070668_100000003 3300005347 Bacteria 195738
36 Ga0070668_100072912 3300005347 Bacteria 2676
37 Ga0070669_100000005 3300005353 Bacteria 309134
38 Ga0070669_100018613 3300005353 Bacteria 4964
39 Ga0070669_100670740 3300005353 Bacteria 873
40 Ga0070675_100007973 3300005354 Bacteria 8207
41 Ga0070671_100000061 3300005355 Bacteria 73646
42 Ga0070671_100025946 3300005355 Bacteria 4812
43 Ga0070671_101283880 3300005355 Unclassified 645
44 Ga0070674_100004933 3300005356 Bacteria 7648
45 Ga0070659_100368488 3300005366 Bacteria 1208
46 Ga0070667_100000035 3300005367 Bacteria 173461
47 Ga0070667_100005221 3300005367 Bacteria 10854
48 Ga0070667_101324173 3300005367 Bacteria 675
49 Ga0070667_101490851 3300005367 Bacteria 635
50 Ga0070663_100009261 3300005455 Bacteria 6092
51 Ga0070678_100007498 3300005456 Bacteria 6478
52 Ga0070662_100003187 3300005457 Bacteria 10196
53 Ga0070662_100305064 3300005457 Bacteria 1294
54 Ga0070662_101177392 3300005457 Bacteria 659
55 Ga0068853_100008080 3300005539 Bacteria 8441
56 Ga0068853_100331425 3300005539 Bacteria 1412
57 Ga0070672_100077827 3300005543 Bacteria 2653
58 Ga0070665_100840519 3300005548 Bacteria 931
59 Ga0070664_100121726 3300005564 Bacteria 2285
60 Ga0068857_100109767 3300005577 Bacteria 2479
61 Ga0068857_100237961 3300005577 Bacteria 1666
62 Ga0068854_100000051 3300005578 Bacteria 86667
63 Ga0068854_100036629 3300005578 Bacteria 3441
64 Ga0068856_100008621 3300005614 Bacteria 9916
65 Ga0068852_100515573 3300005616 Bacteria 1192
66 Ga0068852_100637643 3300005616 Bacteria 1072
67 Ga0068852_100873100 3300005616 Bacteria 916
68 Ga0068852_101153698 3300005616 Bacteria 795
69 Ga0068859_100002190 3300005617 Bacteria 19848
70 Ga0068859_100283695 3300005617 Bacteria 1749
71 Ga0068864_100000042 3300005618 Bacteria 162930
72 Ga0068864_100000861 3300005618 Bacteria 25572
73 Ga0068861_100002413 3300005719 Bacteria 12172
74 Ga0068851_10129505 3300005834 Bacteria 1363
75 Ga0068863_100001950 3300005841 Bacteria 20502
76 Ga0068863_100026727 3300005841 Bacteria 5503
77 Ga0068858_100000465 3300005842 Bacteria 42293
78 Ga0068860_100000106 3300005843 Bacteria 133556
79 Ga0068860_100332267 3300005843 Bacteria 1493
80 Ga0068862_100000005 3300005844 Bacteria 350713
81 Ga0068862_100000677 3300005844 Bacteria 34813
82 Ga0068862_100323134 3300005844 Bacteria 1425
83 Ga0097621_100020039 3300006237 Bacteria 5149
84 Ga0068865_100277064 3300006881 Bacteria 1334
85 Ga0097620_100002190 3300006931 Bacteria 19848
86 Ga0097620_100283708 3300006931 Bacteria 1749
87 Ga0105251_10009288 3300009011 Bacteria 5822
88 Ga0114129_10116752 3300009147 Bacteria 3677
89 Ga0105243_10092224 3300009148 Bacteria 2497
90 Ga0105241_10314105 3300009174 Bacteria 1349
91 Ga0105248_10000171 3300009177 Bacteria 75565
92 Ga0105248_10375099 3300009177 Bacteria 1601
93 Ga0105237_10002989 3300009545 Bacteria 20424
94 Ga0105237_10046738 3300009545 Bacteria 4354
95 Ga0105238_10020860 3300009551 Bacteria 6675
96 Ga0105238_10266463 3300009551 Bacteria 1693
97 Ga0105148_100086 3300009978 Bacteria 14695
98 Ga0105239_10000061 3300010375 Bacteria 154661
99 Ga0105239_10696174 3300010375 Bacteria 1162
100 Ga0105239_10857415 3300010375 Bacteria 1042
101 Ga0157373_10018144 3300013100 Bacteria 5125
102 Ga0157373_10077309 3300013100 Bacteria 2348
103 Ga0157373_10221824 3300013100 Bacteria 1334
104 Ga0157371_10031118 3300013102 Bacteria 3845
105 Ga0157371_10110145 3300013102 Bacteria 1955
106 Ga0157371_10203926 3300013102 Bacteria 1418
107 Ga0157371_10337127 3300013102 Bacteria 1096
108 Ga0157369_10214837 3300013105 Bacteria 2014
109 Ga0157374_10021559 3300013296 Bacteria 5735
110 Ga0157372_10033614 3300013307 Bacteria 5635
111 Ga0157372_10629058 3300013307 Bacteria 1250
112 Ga0157372_10649250 3300013307 Bacteria 1229
113 Ga0157372_10683702 3300013307 Bacteria 1194
114 Ga0157372_10699514 3300013307 Bacteria 1179
115 Ga0163163_10013144 3300014325 Bacteria 7565
116 Ga0157380_10006098 3300014326 Bacteria 8448
117 Ga0157380_10173524 3300014326 Bacteria 1886
118 Ga0157379_10613519 3300014968 Bacteria 1016
119 Ga0163161_10003807 3300017792 Bacteria 10577
120 Ga0163161_10272792 3300017792 Bacteria 1324
121 Ga0213875_10000323 3300021388 Bacteria 45327
122 Ga0207656_10079009 3300025321 Bacteria 1475
123 Ga0207713_1034815 3300025735 Bacteria 2182
124 Ga0207680_10053938 3300025903 Bacteria 2416
125 Ga0207647_10000195 3300025904 Bacteria 49520
126 Ga0207647_10003079 3300025904 Bacteria 12537
127 Ga0207647_10011660 3300025904 Bacteria 6155
128 Ga0207647_10189258 3300025904 Bacteria 1193
129 Ga0207645_10160816 3300025907 Bacteria 1469
130 Ga0207705_10001763 3300025909 Bacteria 17086
131 Ga0207705_10182371 3300025909 Bacteria 1585
132 Ga0207705_10599319 3300025909 Bacteria 857
133 Ga0207705_10794718 3300025909 Bacteria 734
134 Ga0207654_10019316 3300025911 Bacteria 3595
135 Ga0207654_10275515 3300025911 Bacteria 1136
136 Ga0207695_10013684 3300025913 Bacteria 9657
137 Ga0207671_10005232 3300025914 Bacteria 12051
138 Ga0207671_10746045 3300025914 Bacteria 778
139 Ga0207657_10008571 3300025919 Bacteria 10361
140 Ga0207657_10009826 3300025919 Bacteria 9585
141 Ga0207657_10321694 3300025919 Bacteria 1223
142 Ga0207657_10769920 3300025919 Bacteria 745
143 Ga0207649_10011858 3300025920 Bacteria 4821
144 Ga0207649_10222954 3300025920 Bacteria 1344
145 Ga0207681_10000003 3300025923 Bacteria 713245
146 Ga0207681_10014843 3300025923 Bacteria 4851
147 Ga0207681_10019678 3300025923 Bacteria 4269
148 Ga0207694_10129588 3300025924 Bacteria 2021
149 Ga0207694_10474608 3300025924 Bacteria 1046
150 Ga0207650_10000012 3300025925 Bacteria 437889
151 Ga0207650_10015130 3300025925 Bacteria 5369
152 Ga0207659_10007049 3300025926 Bacteria 6897
153 Ga0207644_10000069 3300025931 Bacteria 75201
154 Ga0207644_10599692 3300025931 Bacteria 914
155 Ga0207690_10195924 3300025932 Bacteria 1531
156 Ga0207690_10396391 3300025932 Bacteria 1100
157 Ga0207706_10003037 3300025933 Bacteria 16179
158 Ga0207706_10126025 3300025933 Bacteria 2252
159 Ga0207706_10384653 3300025933 Bacteria 1217
160 Ga0207709_10078439 3300025935 Bacteria 2120
161 Ga0207669_10002608 3300025937 Bacteria 7711
162 Ga0207704_10263487 3300025938 Bacteria 1301
163 Ga0207691_10060811 3300025940 Bacteria 3432
164 Ga0207711_10001461 3300025941 Bacteria 22080
165 Ga0207711_10370348 3300025941 Bacteria 1328
166 Ga0207661_10926278 3300025944 Bacteria 803
167 Ga0207679_10053455 3300025945 Bacteria 2968
168 Ga0207667_10254274 3300025949 Bacteria 1797
169 Ga0207668_10000006 3300025972 Bacteria 191468
170 Ga0207668_10026421 3300025972 Bacteria 3769
171 Ga0207668_10125314 3300025972 Bacteria 1952
172 Ga0207640_10001537 3300025981 Bacteria 12441
173 Ga0207640_10013098 3300025981 Bacteria 4743
174 Ga0207640_10017027 3300025981 Bacteria 4244
175 Ga0207640_10640763 3300025981 Bacteria 904
176 Ga0207658_10000026 3300025986 Bacteria 178292
177 Ga0207658_10009247 3300025986 Bacteria 6683
178 Ga0207703_10000234 3300026035 Bacteria 63325
179 Ga0207639_10000269 3300026041 Bacteria 37143
180 Ga0207639_10012721 3300026041 Bacteria 5870
181 Ga0207639_10027130 3300026041 Bacteria 4168
182 Ga0207639_10190824 3300026041 Bacteria 1750
183 Ga0207678_10000400 3300026067 Bacteria 39732
184 Ga0207678_10001983 3300026067 Bacteria 18643
185 Ga0207702_10006623 3300026078 Bacteria 9964
186 Ga0207641_10000617 3300026088 Bacteria 38890
187 Ga0207641_10001438 3300026088 Bacteria 23396
188 Ga0207676_10000009 3300026095 Bacteria 545256
189 Ga0207676_10004386 3300026095 Bacteria 9979
190 Ga0207674_10003571 3300026116 Bacteria 18967
191 Ga0207675_100001338 3300026118 Bacteria 24709
192 Ga0207683_10026399 3300026121 Bacteria 5012
193 Ga0207698_12349426 3300026142 Bacteria 545
194 Ga0268266_10043391 3300028379 Bacteria 3843
195 Ga0268265_10000001 3300028380 Bacteria 1230727
196 Ga0268265_10000380 3300028380 Bacteria 47826
197 Ga0268265_10399614 3300028380 Bacteria 1270
198 Ga0268264_10000076 3300028381 Bacteria 255518
199 Ga0268264_10472080 3300028381 Bacteria 1219
200 Ga0307408_100003396 3300031548 Bacteria 10921
201 Ga0307408_100034106 3300031548 Bacteria 3561
202 Ga0307408_100288246 3300031548 Bacteria 1370
203 Ga0307405_10014422 3300031731 Bacteria 4250
204 Ga0307405_10017685 3300031731 Bacteria 3918
205 Ga0307405_11027322 3300031731 Bacteria 705
206 Ga0307406_10031543 3300031901 Bacteria 3228
207 Ga0307406_10232516 3300031901 Bacteria 1377
208 Ga0307412_10000933 3300031911 Bacteria 16724
209 Ga0307412_10013627 3300031911 Bacteria 4774
210 Ga0307412_10033013 3300031911 Bacteria 3285
211 Ga0307416_100090872 3300032002 Bacteria 2620
212 Ga0307416_100967713 3300032002 Bacteria 953
213 Ga0307414_10187265 3300032004 Bacteria 1671
214 Ga0307414_10619787 3300032004 Bacteria 972
215 Ga0307411_10099909 3300032005 Bacteria 2049
216 Ga0395905_0015362 3300037471 Bacteria 7277
217 Ga0395905_0325084 3300037471 Bacteria 1428
218 Ga0436364_0129444 3300037853 Bacteria 50814
219 Ga0395901_0605102 3300038443 Bacteria 1105
220 Ga0436365_0285743 3300039437 Bacteria 711
221 Ga0451789_0739190 3300041443 Bacteria 547
222 Ga0451802_0768085 3300041460 Bacteria 1834
223 Ga0451806_295426 3300041462 Bacteria 2967
224 Ga0451807_2500641 3300041486 Bacteria 2041
225 Ga0451845_0392982 3300041501 Bacteria 693
226 Ga0451849_0243155 3300041505 Bacteria 988
227 Ga0439458_0022048 3300042157 Bacteria 1477
228 Ga0466973_0107406 3300044659 Bacteria 2345
229 Ga0466966_0020439 3300044684 Bacteria 4353
230 Ga0466961_0295990 3300044693 Bacteria 989
231 Ga0466963_0239465 3300044694 Bacteria 1272
232 Ga0466971_0373601 3300044719 Bacteria 692
233 Ga0466970_0093515 3300044765 Bacteria 1633
234 Ga0466959_0072564 3300045049 Bacteria 2491
235 Ga0466958_0066211 3300045836 Bacteria 2206
236 Ga0495638_0265450 3300046460 Bacteria 939
237 Ga0495638_0307406 3300046460 Bacteria 852
238 Ga0495584_0049795 3300046491 Bacteria 2110
239 Ga0495632_0000001 3300046519 Bacteria 873295
240 Ga0495637_0000330 3300046520 Bacteria 36746
241 Ga0495643_0000020 3300046522 Bacteria 294973
242 Ga0495648_0126528 3300046524 Bacteria 1364
243 Ga0495663_0000002 3300046525 Bacteria 495384
244 Ga0495633_0000213 3300046558 Bacteria 72710
245 Ga0495633_0003218 3300046558 Bacteria 11022
246 Ga0495633_0110138 3300046558 Bacteria 1276
247 Ga0495633_0150619 3300046558 Bacteria 1074
248 Ga0495671_0000016 3300046692 Bacteria 294821
249 Ga0495687_080891 3300047443 Bacteria 1273
250 Ga0495673_0035658 3300047469 Bacteria 2289
251 Ga0495681_0003075 3300047470 Bacteria 11701
252 Ga0495686_0000197 3300047472 Bacteria 112818
253 Ga0495686_0002725 3300047472 Bacteria 16154
254 Ga0495686_0005357 3300047472 Bacteria 10149
255 Ga0495686_0029169 3300047472 Bacteria 3591
256 Ga0496100_0176740 3300048903 Bacteria 1542
257 Ga0496108_0003224 3300048911 Bacteria 13116
258 Ga0496108_0630829 3300048911 Bacteria 932
259 Ga0496110_0302406 3300048913 Bacteria 1457
260 Ga0496111_0085939 3300048914 Bacteria 2301
261 Ga0496111_0659231 3300048914 Bacteria 763
262 Ga0496113_0506537 3300048916 Bacteria 969
263 Ga0496116_0035885 3300048919 Bacteria 3478
264 Ga0496117_0084685 3300048920 Bacteria 2067
265 Ga0496117_0215805 3300048920 Bacteria 1072
266 Ga0496118_0026247 3300048921 Bacteria 4969
267 Ga0496118_0089205 3300048921 Bacteria 2130
268 Ga0496119_0072336 3300048922 Bacteria 2015
269 Ga0496121_0000192 3300048924 Bacteria 136529
270 Ga0496121_0000584 3300048924 Bacteria 68507
271 Ga0496121_0010392 3300048924 Bacteria 10509
272 Ga0496121_0071730 3300048924 Bacteria 2784
273 Ga0496122_0011471 3300048925 Bacteria 8966
274 Ga0496122_0568006 3300048925 Bacteria 537
275 Ga0496124_0086543 3300048927 Bacteria 2564
276 Ga0496124_0132276 3300048927 Bacteria 1980
277 Ga0496124_0552451 3300048927 Bacteria 760
278 Ga0496125_0001515 3300048928 Bacteria 33290
279 Ga0496125_0011116 3300048928 Bacteria 9030
280 Ga0496125_0082923 3300048928 Bacteria 2441
281 Ga0496125_0154435 3300048928 Bacteria 1570
282 Ga0496125_0328550 3300048928 Bacteria 923
283 Ga0496126_0021282 3300048929 Bacteria 6337
284 Ga0496126_0072270 3300048929 Bacteria 3069
285 Ga0496126_0236607 3300048929 Bacteria 1528
286 Ga0496126_0248848 3300048929 Bacteria 1482
287 Ga0496126_0438267 3300048929 Bacteria 1054
288 Ga0501031_0301811 3300049568 Bacteria 1038
289 Ga0501032_0199879 3300049569 Bacteria 1304
290 Ga0501043_0050154 3300049579 Bacteria 3281
291 Ga0501043_0204577 3300049579 Bacteria 1531
292 Ga0501046_0031392 3300049580 Bacteria 4306
293 Ga0501047_0001735 3300049581 Bacteria 21178
294 Ga0501047_0001840 3300049581 Bacteria 20467
295 Ga0501047_0897711 3300049581 Bacteria 700
296 Ga0501048_0079289 3300049582 Bacteria 2317
297 Ga0501223_000004 3300049663 Bacteria 141027
298 Ga0501235_000242 3300049669 Bacteria 9987
299 Ga0501236_004068 3300049670 Bacteria 1724
300 Ga0501246_000921 3300049676 Bacteria 2198
301 Ga0501225_0000003 3300049705 Bacteria 141070
302 Ga0501225_0000673 3300049705 Bacteria 10658
303 Ga0501225_0006456 3300049705 Bacteria 3423
304 Ga0501083_0839970 3300049744 Bacteria 598
305 Ga0501282_009829 3300049778 Bacteria 1026
306 Ga0501044_0101391 3300049823 Bacteria 2896
307 nmdc:mga0k408_582610_c1 3300050493 Bacteria 660
308 nmdc:mga07m45_193628_c1 3300050496 Bacteria 1182
309 Ga0500643_006760 3300053087 Bacteria 4734
310 Ga0500562_000252 3300053108 Bacteria 13785
311 Ga0500559_0004676 3300053136 Bacteria 6447
312 Ga0500564_181945 3300053138 Bacteria 876
313 Ga0500624_000099 3300053157 Bacteria 42473
314 Ga0500624_001219 3300053157 Bacteria 4599
315 Ga0500633_0379462 3300053160 Bacteria 512
316 Ga0500636_0019007 3300053177 Bacteria 4065
317 2643727849 2643221541 Bacteria 5498788
318 2644039103 2643221605 Bacteria 4772303
319 2644043201 2643221606 Bacteria 5588032
320 2644395368 2643221671 Bacteria 5496681
321 2778124435 2775507255 Bacteria 3945731
322 2809061832 2808606401 Bacteria 4586670
323 2809077796 2808606404 Bacteria 4652788
324 2809082496 2808606405 Bacteria 4586632
325 2880519985 2880518877 Bacteria 5012590
326 Ga0500559_0045313
327 SwRhRL2b_contig_645837
328 JGI24736J21556_1001483
329 JGI24741J21665_1000228
330 JGI24740J21852_10008724
331 JGI24739J22299_10002767
332 JGI24739J22299_10081354
333 JGI24737J22298_10001502
334 JGI24737J22298_10068479
335 JGI24735J21928_10000586
336 JGI24735J21928_10003416
337 JGI24738J21930_10001423
338 JGI24738J21930_10007152
339 JGI24738J21930_10010385
340 JGI24744J21845_10000267
341 JGI24751J29686_10000195
342 rootL2_10177419
343 Ga0065704_10008199
344 Ga0065707_10004914
345 Ga0065707_10087462
346 Ga0070658_10095369
347 Ga0070658_10294339
348 Ga0070676_10163065
349 Ga0070670_100000033
350 Ga0070670_100000639
351 Ga0070670_101107550
352 Ga0070666_10005633
353 Ga0070666_10034718
354 Ga0070660_100002644
355 Ga0070660_100006410
356 Ga0070660_100328190
357 Ga0070660_100832701
358 Ga0070661_100059465
359 Ga0070661_100317610
360 Ga0070668_100000003
361 Ga0070668_100072912
362 Ga0070669_100000005
363 Ga0070669_100018613
364 Ga0070669_100670740
365 Ga0070675_100007973
366 Ga0070671_100000061
367 Ga0070671_100025946
368 Ga0070671_101283880
369 Ga0070674_100004933
370 Ga0070659_100368488
371 Ga0070667_100000035
372 Ga0070667_100005221
373 Ga0070667_101324173
374 Ga0070667_101490851
375 Ga0070663_100009261
376 Ga0070678_100007498
377 Ga0070662_100003187
378 Ga0070662_100305064
379 Ga0070662_101177392
380 Ga0068853_100008080
381 Ga0068853_100331425
382 Ga0070672_100077827
383 Ga0070665_100840519
384 Ga0070664_100121726
385 Ga0068857_100109767
386 Ga0068857_100237961
387 Ga0068854_100000051
388 Ga0068854_100036629
389 Ga0068856_100008621
390 Ga0068852_100515573
391 Ga0068852_100637643
392 Ga0068852_100873100
393 Ga0068852_101153698
394 Ga0068859_100002190
395 Ga0068859_100283695
396 Ga0068864_100000042
397 Ga0068864_100000861
398 Ga0068861_100002413
399 Ga0068851_10129505
400 Ga0068863_100001950
401 Ga0068863_100026727
402 Ga0068858_100000465
403 Ga0068860_100000106
404 Ga0068860_100332267
405 Ga0068862_100000005
406 Ga0068862_100000677
407 Ga0068862_100323134
408 Ga0097621_100020039
409 Ga0068865_100277064
410 Ga0097620_100002190
411 Ga0097620_100283708
412 Ga0105251_10009288
413 Ga0114129_10116752
414 Ga0105243_10092224
415 Ga0105241_10314105
416 Ga0105248_10000171
417 Ga0105248_10375099
418 Ga0105237_10002989
419 Ga0105237_10046738
420 Ga0105238_10020860
421 Ga0105238_10266463
422 Ga0105148_100086
423 Ga0105239_10000061
424 Ga0105239_10696174
425 Ga0105239_10857415
426 Ga0157373_10018144
427 Ga0157373_10077309
428 Ga0157373_10221824
429 Ga0157371_10031118
430 Ga0157371_10110145
431 Ga0157371_10203926
432 Ga0157371_10337127
433 Ga0157369_10214837
434 Ga0157374_10021559
435 Ga0157372_10033614
436 Ga0157372_10629058
437 Ga0157372_10649250
438 Ga0157372_10683702
439 Ga0157372_10699514
440 Ga0163163_10013144
441 Ga0157380_10006098
442 Ga0157380_10173524
443 Ga0157379_10613519
444 Ga0163161_10003807
445 Ga0163161_10272792
446 Ga0213875_10000323
447 Ga0207656_10079009
448 Ga0207713_1034815
449 Ga0207680_10053938
450 Ga0207647_10000195
451 Ga0207647_10003079
452 Ga0207647_10011660
453 Ga0207647_10189258
454 Ga0207645_10160816
455 Ga0207705_10001763
456 Ga0207705_10182371
457 Ga0207705_10599319
458 Ga0207705_10794718
459 Ga0207654_10019316
460 Ga0207654_10275515
461 Ga0207695_10013684
462 Ga0207671_10005232
463 Ga0207671_10746045
464 Ga0207657_10008571
465 Ga0207657_10009826
466 Ga0207657_10321694
467 Ga0207657_10769920
468 Ga0207649_10011858
469 Ga0207649_10222954
470 Ga0207681_10000003
471 Ga0207681_10014843
472 Ga0207681_10019678
473 Ga0207694_10129588
474 Ga0207694_10474608
475 Ga0207650_10000012
476 Ga0207650_10015130
477 Ga0207659_10007049
478 Ga0207644_10000069
479 Ga0207644_10599692
480 Ga0207690_10195924
481 Ga0207690_10396391
482 Ga0207706_10003037
483 Ga0207706_10126025
484 Ga0207706_10384653
485 Ga0207709_10078439
486 Ga0207669_10002608
487 Ga0207704_10263487
488 Ga0207691_10060811
489 Ga0207711_10001461
490 Ga0207711_10370348
491 Ga0207661_10926278
492 Ga0207679_10053455
493 Ga0207667_10254274
494 Ga0207668_10000006
495 Ga0207668_10026421
496 Ga0207668_10125314
497 Ga0207640_10001537
498 Ga0207640_10013098
499 Ga0207640_10017027
500 Ga0207640_10640763
501 Ga0207658_10000026
502 Ga0207658_10009247
503 Ga0207703_10000234
504 Ga0207639_10000269
505 Ga0207639_10012721
506 Ga0207639_10027130
507 Ga0207639_10190824
508 Ga0207678_10000400
509 Ga0207678_10001983
510 Ga0207702_10006623
511 Ga0207641_10000617
512 Ga0207641_10001438
513 Ga0207676_10000009
514 Ga0207676_10004386
515 Ga0207674_10003571
516 Ga0207675_100001338
517 Ga0207683_10026399
518 Ga0207698_12349426
519 Ga0268266_10043391
520 Ga0268265_10000001
521 Ga0268265_10000380
522 Ga0268265_10399614
523 Ga0268264_10000076
524 Ga0268264_10472080
525 Ga0307408_100003396
526 Ga0307408_100034106
527 Ga0307408_100288246
528 Ga0307405_10014422
529 Ga0307405_10017685
530 Ga0307405_11027322
531 Ga0307406_10031543
532 Ga0307406_10232516
533 Ga0307412_10000933
534 Ga0307412_10013627
535 Ga0307412_10033013
536 Ga0307416_100090872
537 Ga0307416_100967713
538 Ga0307414_10187265
539 Ga0307414_10619787
540 Ga0307411_10099909
541 Ga0395905_0015362
542 Ga0395905_0325084
543 Ga0436364_0129444
544 Ga0395901_0605102
545 Ga0436365_0285743
546 Ga0451789_0739190
547 Ga0451802_0768085
548 Ga0451806_295426
549 Ga0451807_2500641
550 Ga0451845_0392982
551 Ga0451849_0243155
552 Ga0439458_0022048
553 Ga0466973_0107406
554 Ga0466966_0020439
555 Ga0466961_0295990
556 Ga0466963_0239465
557 Ga0466971_0373601
558 Ga0466970_0093515
559 Ga0466959_0072564
560 Ga0466958_0066211
561 Ga0495638_0265450
562 Ga0495638_0307406
563 Ga0495584_0049795
564 Ga0495632_0000001
565 Ga0495637_0000330
566 Ga0495643_0000020
567 Ga0495648_0126528
568 Ga0495663_0000002
569 Ga0495633_0000213
570 Ga0495633_0003218
571 Ga0495633_0110138
572 Ga0495633_0150619
573 Ga0495671_0000016
574 Ga0495687_080891
575 Ga0495673_0035658
576 Ga0495681_0003075
577 Ga0495686_0000197
578 Ga0495686_0002725
579 Ga0495686_0005357
580 Ga0495686_0029169
581 Ga0496100_0176740
582 Ga0496108_0003224
583 Ga0496108_0630829
584 Ga0496110_0302406
585 Ga0496111_0085939
586 Ga0496111_0659231
587 Ga0496113_0506537
588 Ga0496116_0035885
589 Ga0496117_0084685
590 Ga0496117_0215805
591 Ga0496118_0026247
592 Ga0496118_0089205
593 Ga0496119_0072336
594 Ga0496121_0000192
595 Ga0496121_0000584
596 Ga0496121_0010392
597 Ga0496121_0071730
598 Ga0496122_0011471
599 Ga0496122_0568006
600 Ga0496124_0086543
601 Ga0496124_0132276
602 Ga0496124_0552451
603 Ga0496125_0001515
604 Ga0496125_0011116
605 Ga0496125_0082923
606 Ga0496125_0154435
607 Ga0496125_0328550
608 Ga0496126_0021282
609 Ga0496126_0072270
610 Ga0496126_0236607
611 Ga0496126_0248848
612 Ga0496126_0438267
613 Ga0501031_0301811
614 Ga0501032_0199879
615 Ga0501043_0050154
616 Ga0501043_0204577
617 Ga0501046_0031392
618 Ga0501047_0001735
619 Ga0501047_0001840
620 Ga0501047_0897711
621 Ga0501048_0079289
622 Ga0501223_000004
623 Ga0501235_000242
624 Ga0501236_004068
625 Ga0501246_000921
626 Ga0501225_0000003
627 Ga0501225_0000673
628 Ga0501225_0006456
629 Ga0501083_0839970
630 Ga0501282_009829
631 Ga0501044_0101391
632 nmdc:mga0k408_582610_c1
633 nmdc:mga07m45_193628_c1
634 Ga0500643_006760
635 Ga0500562_000252
636 Ga0500559_0004676
637 Ga0500564_181945
638 Ga0500624_000099
639 Ga0500624_001219
640 Ga0500633_0379462
641 Ga0500636_0019007
642 2643727849
643 2644039103
644 2644043201
645 2644395368
646 2778124435
647 2809061832
648 2809077796
649 2809082496
650 2880519985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

7

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9578 1 145
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9546 1 120
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.9498 1 120
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9447 1 145
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9335 1 120
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9557 2 145 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.939 2 132 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9362 2 145 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9335 1 120 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9254 2 133 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1B6Z5U6-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.987 1 147 GO:0006777
GO:0030366
AF-A0A248LE25-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9807 52 147 GO:0006777
GO:0030366
AF-A0A1Z5YSD3-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9801 1 145 GO:0006777
GO:0030366
AF-A0A1W9JY99-F1-model_v4 deleted 0.9795 3 147
AF-A0A526YMD2-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9789 26 147 GO:0006777
GO:0030366

Map