F407814
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 245 | 323 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10133495|Ga0105237_101334952 |
| Length | 160 |
| Sequence | MLRSLRPTQSSGGRLFFARLRSEVSMTTRTATCCCGQLSIEVHGTPRGVGVCHCFACQRRTGSGFAALASFAPPYRVSGRATEYVRVGDQGARFTFRFCPVCGTNLFHTEHGYEDRSVSVAVGAFGDPAFPPPTDSVYDSRRHAWVRLPDDMIAFPKDPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 236 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 237 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 242 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 245 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.46 |
| Nodule | 0.92 |
| Rhizoplane | 3.08 |
| Rhizosphere | 83.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6058718 | 2162886011 | Bacteria | 1637 |
| 2 | JGI24749J21850_1019237 | 3300002076 | Bacteria | 965 |
| 3 | JGI24751J29686_10002265 | 3300002459 | Unclassified | 3900 |
| 4 | rootH1_10011795 | 3300003316 | Bacteria | 4282 |
| 5 | rootH1_10015006 | 3300003316 | Bacteria | 2544 |
| 6 | rootH1_10015006 | 3300003323 | Bacteria | 10853 |
| 7 | rootL2_10128957 | 3300003322 | Bacteria | 3420 |
| 8 | rootH1_10003971 | 3300003323 | Bacteria | 7163 |
| 9 | Ga0055539_1000366 | 3300003752 | Bacteria | 19209 |
| 10 | Ga0055533_1000100 | 3300003756 | Bacteria | 111692 |
| 11 | Ga0055525_1000164 | 3300003759 | Bacteria | 85555 |
| 12 | Ga0055525_1000877 | 3300003759 | Bacteria | 8702 |
| 13 | Ga0055527_1000061 | 3300003760 | Bacteria | 91171 |
| 14 | Ga0055527_1000065 | 3300003760 | Bacteria | 88416 |
| 15 | Ga0055535_1000195 | 3300003761 | Bacteria | 64294 |
| 16 | Ga0055535_1000197 | 3300003761 | Bacteria | 64126 |
| 17 | Ga0055542_1000097 | 3300003762 | Bacteria | 118227 |
| 18 | Ga0055542_1000140 | 3300003762 | Bacteria | 90195 |
| 19 | Ga0055529_1000157 | 3300003763 | Bacteria | 93119 |
| 20 | Ga0055529_1000269 | 3300003763 | Bacteria | 61800 |
| 21 | Ga0065714_10131555 | 3300005288 | Bacteria | 1241 |
| 22 | Ga0065712_10006332 | 3300005290 | Bacteria | 3644 |
| 23 | Ga0065715_10109848 | 3300005293 | Unclassified | 2649 |
| 24 | Ga0065707_10107107 | 3300005295 | Bacteria | 2569 |
| 25 | Ga0070676_10067131 | 3300005328 | Bacteria | 2144 |
| 26 | Ga0070680_100871738 | 3300005336 | Bacteria | 776 |
| 27 | Ga0068868_100539281 | 3300005338 | Bacteria | 1027 |
| 28 | Ga0070660_100770581 | 3300005339 | Archaea | 808 |
| 29 | Ga0070689_101120637 | 3300005340 | Bacteria | 704 |
| 30 | Ga0070689_101228599 | 3300005340 | Bacteria | 673 |
| 31 | Ga0070687_100510630 | 3300005343 | Bacteria | 811 |
| 32 | Ga0070668_100018304 | 3300005347 | Bacteria | 5258 |
| 33 | Ga0070669_100002170 | 3300005353 | Bacteria | 14186 |
| 34 | Ga0070675_100216385 | 3300005354 | Bacteria | 1667 |
| 35 | Ga0070671_100968153 | 3300005355 | Bacteria | 745 |
| 36 | Ga0070673_100382439 | 3300005364 | Bacteria | 1255 |
| 37 | Ga0070688_100663547 | 3300005365 | Bacteria | 804 |
| 38 | Ga0070688_101298967 | 3300005365 | Bacteria | 587 |
| 39 | Ga0070714_100001345 | 3300005435 | Bacteria | 17773 |
| 40 | Ga0070700_100224380 | 3300005441 | Unclassified | 1333 |
| 41 | Ga0070694_100231762 | 3300005444 | Unclassified | 1389 |
| 42 | Ga0070678_100215281 | 3300005456 | Bacteria | 1594 |
| 43 | Ga0070678_100987245 | 3300005456 | Bacteria | 773 |
| 44 | Ga0070662_100009449 | 3300005457 | Bacteria | 6376 |
| 45 | Ga0070681_10020881 | 3300005458 | Bacteria | 6558 |
| 46 | Ga0070681_11221172 | 3300005458 | Bacteria | 674 |
| 47 | Ga0068867_100118910 | 3300005459 | Bacteria | 2039 |
| 48 | Ga0070706_100034608 | 3300005467 | Unclassified | 4666 |
| 49 | Ga0070707_100115519 | 3300005468 | Plasmid | 2605 |
| 50 | Ga0070679_100175051 | 3300005530 | Bacteria | 2118 |
| 51 | Ga0070697_100056997 | 3300005536 | Unclassified | 3179 |
| 52 | Ga0070665_100036795 | 3300005548 | Bacteria | 4922 |
| 53 | Ga0070665_100294068 | 3300005548 | Bacteria | 1626 |
| 54 | Ga0068855_100371098 | 3300005563 | Bacteria | 1573 |
| 55 | Ga0068857_100093722 | 3300005577 | Unclassified | 2689 |
| 56 | Ga0068857_100596396 | 3300005577 | Bacteria | 1044 |
| 57 | Ga0068856_100010471 | 3300005614 | Bacteria | 9002 |
| 58 | Ga0068856_100142358 | 3300005614 | Bacteria | 2405 |
| 59 | Ga0068852_100123351 | 3300005616 | Bacteria | 2375 |
| 60 | Ga0068852_101523418 | 3300005616 | Bacteria | 691 |
| 61 | Ga0068859_100917901 | 3300005617 | Bacteria | 960 |
| 62 | Ga0068864_100294799 | 3300005618 | Bacteria | 1517 |
| 63 | Ga0068866_10379358 | 3300005718 | Archaea | 906 |
| 64 | Ga0068861_100001539 | 3300005719 | Bacteria | 14623 |
| 65 | Ga0068861_100172793 | 3300005719 | Bacteria | 1792 |
| 66 | Ga0068861_100800175 | 3300005719 | Bacteria | 885 |
| 67 | Ga0068870_10002423 | 3300005840 | Bacteria | 7762 |
| 68 | Ga0068870_10068839 | 3300005840 | Bacteria | 1924 |
| 69 | Ga0068863_100040586 | 3300005841 | Bacteria | 4425 |
| 70 | Ga0068863_100669080 | 3300005841 | Bacteria | 1030 |
| 71 | Ga0068863_100808615 | 3300005841 | Bacteria | 935 |
| 72 | Ga0068860_100327398 | 3300005843 | Bacteria | 1504 |
| 73 | Ga0068862_100000292 | 3300005844 | Bacteria | 54831 |
| 74 | Ga0068862_100120450 | 3300005844 | Bacteria | 2312 |
| 75 | Ga0068862_100200082 | 3300005844 | Bacteria | 1801 |
| 76 | Ga0068862_100370173 | 3300005844 | Bacteria | 1334 |
| 77 | Ga0075362_10123151 | 3300006177 | Bacteria | 1229 |
| 78 | Ga0075366_10748072 | 3300006195 | Unclassified | 607 |
| 79 | Ga0097621_100585536 | 3300006237 | Bacteria | 1018 |
| 80 | Ga0075370_10089065 | 3300006353 | Bacteria | 1779 |
| 81 | Ga0075428_100016435 | 3300006844 | Bacteria | 8175 |
| 82 | Ga0075428_100161703 | 3300006844 | Bacteria | 2430 |
| 83 | Ga0075430_100602097 | 3300006846 | Bacteria | 907 |
| 84 | Ga0075434_100325586 | 3300006871 | Unclassified | 1557 |
| 85 | Ga0075429_100000901 | 3300006880 | Bacteria | 23511 |
| 86 | Ga0075429_100543487 | 3300006880 | Bacteria | 1018 |
| 87 | Ga0068865_100044269 | 3300006881 | Bacteria | 3046 |
| 88 | Ga0068865_100268688 | 3300006881 | Unclassified | 1353 |
| 89 | Ga0097620_100917997 | 3300006931 | Bacteria | 960 |
| 90 | Ga0105240_10258484 | 3300009093 | Unclassified | 2010 |
| 91 | Ga0111539_10029717 | 3300009094 | Bacteria | 6652 |
| 92 | Ga0105245_10308459 | 3300009098 | Bacteria | 1555 |
| 93 | Ga0105245_10580238 | 3300009098 | Bacteria | 1146 |
| 94 | Ga0114129_10078504 | 3300009147 | Bacteria | 4592 |
| 95 | Ga0105243_10033528 | 3300009148 | Unclassified | 3971 |
| 96 | Ga0105243_10118645 | 3300009148 | Bacteria | 2226 |
| 97 | Ga0105243_12240502 | 3300009148 | Bacteria | 583 |
| 98 | Ga0105241_10621646 | 3300009174 | Bacteria | 978 |
| 99 | Ga0105242_10031924 | 3300009176 | Unclassified | 4210 |
| 100 | Ga0105242_10362520 | 3300009176 | Bacteria | 1342 |
| 101 | Ga0105242_11725369 | 3300009176 | Bacteria | 663 |
| 102 | Ga0105248_11499650 | 3300009177 | Bacteria | 763 |
| 103 | Ga0105248_12295618 | 3300009177 | Bacteria | 614 |
| 104 | Ga0105237_10133495 | 3300009545 | Bacteria | 2477 |
| 105 | Ga0105237_11822966 | 3300009545 | Bacteria | 616 |
| 106 | Ga0105238_10966103 | 3300009551 | Bacteria | 872 |
| 107 | Ga0105249_10105904 | 3300009553 | Unclassified | 2652 |
| 108 | Ga0105249_10765708 | 3300009553 | Unclassified | 1028 |
| 109 | Ga0105249_12791471 | 3300009553 | Bacteria | 560 |
| 110 | Ga0105239_11033065 | 3300010375 | Bacteria | 945 |
| 111 | Ga0105246_10801123 | 3300011119 | Archaea | 836 |
| 112 | Ga0105246_11482270 | 3300011119 | Bacteria | 636 |
| 113 | Ga0157374_10060337 | 3300013296 | Bacteria | 3549 |
| 114 | Ga0157378_10201718 | 3300013297 | Bacteria | 1881 |
| 115 | Ga0157378_10722124 | 3300013297 | Bacteria | 1017 |
| 116 | Ga0157372_10833456 | 3300013307 | Bacteria | 1071 |
| 117 | Ga0157375_10218434 | 3300013308 | Bacteria | 2064 |
| 118 | Ga0163163_10145877 | 3300014325 | Bacteria | 2410 |
| 119 | Ga0163163_11159775 | 3300014325 | Bacteria | 835 |
| 120 | Ga0163163_12321520 | 3300014325 | Unclassified | 595 |
| 121 | Ga0182008_10006894 | 3300014497 | Bacteria | 6313 |
| 122 | Ga0157377_10000595 | 3300014745 | Bacteria | 14992 |
| 123 | Ga0157379_10286072 | 3300014968 | Bacteria | 1500 |
| 124 | Ga0157376_10246670 | 3300014969 | Bacteria | 1666 |
| 125 | Ga0157376_11897780 | 3300014969 | Unclassified | 633 |
| 126 | Ga0182006_1086180 | 3300015261 | Bacteria | 1137 |
| 127 | Ga0182007_10177451 | 3300015262 | Bacteria | 735 |
| 128 | Ga0163161_11032194 | 3300017792 | Bacteria | 703 |
| 129 | Ga0213876_10174097 | 3300021384 | Bacteria | 1145 |
| 130 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 131 | Ga0209672_100049 | 3300025228 | Bacteria | 238787 |
| 132 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 133 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 134 | Ga0209258_100087 | 3300025242 | Bacteria | 238787 |
| 135 | Ga0209677_100135 | 3300025253 | Bacteria | 69251 |
| 136 | Ga0209148_1000096 | 3300025254 | Bacteria | 238787 |
| 137 | Ga0209455_1000088 | 3300025272 | Bacteria | 238787 |
| 138 | Ga0207688_10047854 | 3300025901 | Unclassified | 2388 |
| 139 | Ga0207647_10228321 | 3300025904 | Bacteria | 1071 |
| 140 | Ga0207645_10043899 | 3300025907 | Unclassified | 2861 |
| 141 | Ga0207645_10322631 | 3300025907 | Bacteria | 1030 |
| 142 | Ga0207643_10076937 | 3300025908 | Bacteria | 1928 |
| 143 | Ga0207705_10140422 | 3300025909 | Bacteria | 1804 |
| 144 | Ga0207684_10254395 | 3300025910 | Unclassified | 1515 |
| 145 | Ga0207654_11117660 | 3300025911 | Bacteria | 574 |
| 146 | Ga0207707_10426832 | 3300025912 | Bacteria | 1136 |
| 147 | Ga0207660_10167583 | 3300025917 | Bacteria | 1699 |
| 148 | Ga0207662_11042537 | 3300025918 | Bacteria | 581 |
| 149 | Ga0207657_10676832 | 3300025919 | Archaea | 802 |
| 150 | Ga0207652_10219103 | 3300025921 | Bacteria | 1715 |
| 151 | Ga0207646_10047620 | 3300025922 | Unclassified | 3845 |
| 152 | Ga0207681_10054764 | 3300025923 | Bacteria | 2714 |
| 153 | Ga0207681_10544496 | 3300025923 | Bacteria | 954 |
| 154 | Ga0207694_10596828 | 3300025924 | Bacteria | 928 |
| 155 | Ga0207650_10000694 | 3300025925 | Bacteria | 26312 |
| 156 | Ga0207650_10606606 | 3300025925 | Archaea | 921 |
| 157 | Ga0207650_11101680 | 3300025925 | Unclassified | 676 |
| 158 | Ga0207687_10430583 | 3300025927 | Bacteria | 1090 |
| 159 | Ga0207664_10001851 | 3300025929 | Bacteria | 13957 |
| 160 | Ga0207690_10271814 | 3300025932 | Bacteria | 1317 |
| 161 | Ga0207706_10003427 | 3300025933 | Bacteria | 15141 |
| 162 | Ga0207686_10192283 | 3300025934 | Bacteria | 1455 |
| 163 | Ga0207686_10196178 | 3300025934 | Bacteria | 1443 |
| 164 | Ga0207709_10476703 | 3300025935 | Bacteria | 969 |
| 165 | Ga0207670_10045909 | 3300025936 | Unclassified | 2899 |
| 166 | Ga0207670_10768765 | 3300025936 | Bacteria | 801 |
| 167 | Ga0207704_10317842 | 3300025938 | Unclassified | 1200 |
| 168 | Ga0207704_10437064 | 3300025938 | Bacteria | 1041 |
| 169 | Ga0207691_11017473 | 3300025940 | Unclassified | 691 |
| 170 | Ga0207689_10095192 | 3300025942 | Bacteria | 2445 |
| 171 | Ga0207679_10854548 | 3300025945 | Archaea | 831 |
| 172 | Ga0207667_10348525 | 3300025949 | Bacteria | 1510 |
| 173 | Ga0207651_10359902 | 3300025960 | Bacteria | 1228 |
| 174 | Ga0207712_10025598 | 3300025961 | Unclassified | 3922 |
| 175 | Ga0207712_10824888 | 3300025961 | Bacteria | 816 |
| 176 | Ga0207668_10097778 | 3300025972 | Bacteria | 2173 |
| 177 | Ga0207703_10488237 | 3300026035 | Bacteria | 1155 |
| 178 | Ga0207703_10596001 | 3300026035 | Bacteria | 1045 |
| 179 | Ga0207708_10386004 | 3300026075 | Unclassified | 1156 |
| 180 | Ga0207702_10002786 | 3300026078 | Bacteria | 16383 |
| 181 | Ga0207702_10051964 | 3300026078 | Bacteria | 3465 |
| 182 | Ga0207702_12296099 | 3300026078 | Bacteria | 527 |
| 183 | Ga0207641_10040023 | 3300026088 | Bacteria | 3921 |
| 184 | Ga0207641_10831062 | 3300026088 | Unclassified | 915 |
| 185 | Ga0207648_10057742 | 3300026089 | Bacteria | 3386 |
| 186 | Ga0207676_10699341 | 3300026095 | Bacteria | 982 |
| 187 | Ga0207674_10084847 | 3300026116 | Unclassified | 3164 |
| 188 | Ga0207675_100003666 | 3300026118 | Bacteria | 14982 |
| 189 | Ga0207675_100120654 | 3300026118 | Bacteria | 2480 |
| 190 | Ga0207675_100780683 | 3300026118 | Bacteria | 968 |
| 191 | Ga0207683_10188274 | 3300026121 | Bacteria | 1873 |
| 192 | Ga0207683_10262249 | 3300026121 | Bacteria | 1578 |
| 193 | Ga0207683_10269038 | 3300026121 | Bacteria | 1557 |
| 194 | Ga0207698_10095324 | 3300026142 | Bacteria | 2449 |
| 195 | Ga0268266_10040229 | 3300028379 | Bacteria | 3984 |
| 196 | Ga0268265_10040527 | 3300028380 | Unclassified | 3440 |
| 197 | Ga0268265_10352953 | 3300028380 | Bacteria | 1343 |
| 198 | Ga0268264_11063144 | 3300028381 | Bacteria | 817 |
| 199 | Ga0307511_10008761 | 3300030521 | Bacteria | 10111 |
| 200 | Ga0265760_10035692 | 3300031090 | Bacteria | 1473 |
| 201 | Ga0265320_10125409 | 3300031240 | Bacteria | 1168 |
| 202 | Ga0265327_10001223 | 3300031251 | Bacteria | 34532 |
| 203 | Ga0307408_100215963 | 3300031548 | Bacteria | 1562 |
| 204 | Ga0307409_100198529 | 3300031995 | Unclassified | 1792 |
| 205 | Ga0307409_100747854 | 3300031995 | Bacteria | 981 |
| 206 | Ga0307416_100952994 | 3300032002 | Bacteria | 960 |
| 207 | Ga0373948_0039693 | 3300034817 | Bacteria | 981 |
| 208 | Ga0373941_0031312 | 3300035115 | Bacteria | 1584 |
| 209 | Ga0373945_0298856 | 3300035116 | Bacteria | 689 |
| 210 | Ga0373935_0792801 | 3300035692 | Bacteria | 699 |
| 211 | Ga0373927_0078577 | 3300035695 | Bacteria | 2137 |
| 212 | Ga0373927_1188021 | 3300035695 | Bacteria | 503 |
| 213 | Ga0373947_0064458 | 3300035725 | Bacteria | 2234 |
| 214 | Ga0373925_0099386 | 3300037068 | Bacteria | 2235 |
| 215 | Ga0395905_0527290 | 3300037471 | Bacteria | 1082 |
| 216 | Ga0395901_0601564 | 3300038443 | Bacteria | 1109 |
| 217 | Ga0436365_1152120 | 3300039437 | Bacteria | 1722 |
| 218 | Ga0450896_047634 | 3300042133 | Bacteria | 678 |
| 219 | Ga0451577_0361481 | 3300042876 | Unclassified | 1317 |
| 220 | Ga0466969_0030829 | 3300044656 | Bacteria | 2731 |
| 221 | Ga0466966_0071633 | 3300044684 | Unclassified | 2171 |
| 222 | Ga0466959_0464596 | 3300045049 | Bacteria | 857 |
| 223 | Ga0451576_0167888 | 3300045051 | Bacteria | 2290 |
| 224 | Ga0451576_0688665 | 3300045051 | Unclassified | 1074 |
| 225 | Ga0495591_015427 | 3300046458 | Bacteria | 2699 |
| 226 | Ga0495638_0136307 | 3300046460 | Bacteria | 1437 |
| 227 | Ga0495653_0329678 | 3300046463 | Bacteria | 987 |
| 228 | Ga0495650_0018561 | 3300046471 | Bacteria | 3451 |
| 229 | Ga0495580_0326109 | 3300046472 | Unclassified | 1043 |
| 230 | Ga0495580_0837344 | 3300046472 | Bacteria | 595 |
| 231 | Ga0495594_0394418 | 3300046499 | Unclassified | 788 |
| 232 | Ga0495632_0428229 | 3300046519 | Bacteria | 576 |
| 233 | Ga0495644_0004714 | 3300046523 | Bacteria | 5360 |
| 234 | Ga0495663_0108255 | 3300046525 | Unclassified | 921 |
| 235 | Ga0495640_0400957 | 3300046533 | Bacteria | 842 |
| 236 | Ga0495598_0226512 | 3300046537 | Bacteria | 684 |
| 237 | Ga0495621_0000128 | 3300046539 | Bacteria | 16189 |
| 238 | Ga0495621_0549522 | 3300046539 | Bacteria | 502 |
| 239 | Ga0495597_0000987 | 3300046542 | Bacteria | 21897 |
| 240 | Ga0495656_0019197 | 3300046615 | Viruses | 2637 |
| 241 | Ga0495647_0000873 | 3300046681 | Bacteria | 9018 |
| 242 | Ga0495671_0041417 | 3300046692 | Viruses | 2319 |
| 243 | Ga0495671_0319711 | 3300046692 | Bacteria | 745 |
| 244 | Ga0495649_0008742 | 3300046694 | Bacteria | 6077 |
| 245 | Ga0495649_0114128 | 3300046694 | Unclassified | 1431 |
| 246 | Ga0495681_0011330 | 3300047470 | Bacteria | 5317 |
| 247 | Ga0495615_0071766 | 3300048090 | Unclassified | 934 |
| 248 | Ga0496100_0096521 | 3300048903 | Bacteria | 2028 |
| 249 | Ga0496101_0085913 | 3300048904 | Bacteria | 2332 |
| 250 | Ga0496102_0081363 | 3300048905 | Bacteria | 2986 |
| 251 | Ga0496105_0011928 | 3300048908 | Bacteria | 6882 |
| 252 | Ga0496106_0023988 | 3300048909 | Bacteria | 4533 |
| 253 | Ga0496107_0034676 | 3300048910 | Unclassified | 3615 |
| 254 | Ga0496108_0005708 | 3300048911 | Bacteria | 10075 |
| 255 | Ga0496109_0008725 | 3300048912 | Bacteria | 8630 |
| 256 | Ga0496110_0032484 | 3300048913 | Bacteria | 4508 |
| 257 | Ga0496114_0021721 | 3300048917 | Bacteria | 5224 |
| 258 | Ga0496121_0008021 | 3300048924 | Bacteria | 12594 |
| 259 | Ga0501031_0005728 | 3300049568 | Bacteria | 8099 |
| 260 | Ga0501032_0086129 | 3300049569 | Bacteria | 2088 |
| 261 | Ga0501033_0003775 | 3300049570 | Bacteria | 12311 |
| 262 | Ga0501034_0000109 | 3300049571 | Bacteria | 151550 |
| 263 | Ga0501034_0001175 | 3300049571 | Bacteria | 36278 |
| 264 | Ga0501036_0001841 | 3300049572 | Bacteria | 16451 |
| 265 | Ga0501037_0002090 | 3300049573 | Bacteria | 14474 |
| 266 | Ga0501037_0180481 | 3300049573 | Bacteria | 1498 |
| 267 | Ga0501038_0047242 | 3300049574 | Bacteria | 3729 |
| 268 | Ga0501039_0057583 | 3300049575 | Bacteria | 3009 |
| 269 | Ga0501040_0025649 | 3300049576 | Bacteria | 3964 |
| 270 | Ga0501041_0012099 | 3300049577 | Bacteria | 5108 |
| 271 | Ga0501042_0001476 | 3300049578 | Bacteria | 13871 |
| 272 | Ga0501043_0081675 | 3300049579 | Bacteria | 2540 |
| 273 | Ga0501046_0012196 | 3300049580 | Bacteria | 7324 |
| 274 | Ga0501048_0050511 | 3300049582 | Bacteria | 2961 |
| 275 | Ga0501067_0003604 | 3300049583 | Bacteria | 8528 |
| 276 | Ga0501068_0004247 | 3300049584 | Bacteria | 7776 |
| 277 | Ga0501068_0005048 | 3300049584 | Bacteria | 7190 |
| 278 | Ga0501069_0182519 | 3300049585 | Unclassified | 1213 |
| 279 | Ga0501070_0010759 | 3300049586 | Bacteria | 7732 |
| 280 | Ga0501070_0133616 | 3300049586 | Bacteria | 2049 |
| 281 | Ga0501071_0003099 | 3300049587 | Bacteria | 10316 |
| 282 | Ga0501071_0457487 | 3300049587 | Bacteria | 977 |
| 283 | Ga0501072_0056099 | 3300049588 | Bacteria | 3104 |
| 284 | Ga0501073_0004433 | 3300049589 | Bacteria | 10545 |
| 285 | Ga0501074_0002228 | 3300049590 | Bacteria | 13449 |
| 286 | Ga0501075_0004218 | 3300049591 | Bacteria | 9710 |
| 287 | Ga0501076_0081046 | 3300049592 | Bacteria | 2605 |
| 288 | Ga0501076_1046102 | 3300049592 | Bacteria | 672 |
| 289 | Ga0501077_0015074 | 3300049593 | Unclassified | 4860 |
| 290 | Ga0501077_0029680 | 3300049593 | Bacteria | 3477 |
| 291 | Ga0501079_0007982 | 3300049741 | Bacteria | 8021 |
| 292 | Ga0501080_0008278 | 3300049742 | Bacteria | 9420 |
| 293 | Ga0501080_0048868 | 3300049742 | Bacteria | 3936 |
| 294 | Ga0501081_0046358 | 3300049743 | Bacteria | 2987 |
| 295 | Ga0501083_0043215 | 3300049744 | Bacteria | 3053 |
| 296 | Ga0501083_0138140 | 3300049744 | Unclassified | 1596 |
| 297 | Ga0501035_0050352 | 3300049822 | Bacteria | 3733 |
| 298 | Ga0501044_0056488 | 3300049823 | Bacteria | 4031 |
| 299 | Ga0501044_0066505 | 3300049823 | Bacteria | 3675 |
| 300 | Ga0501045_0030644 | 3300049824 | Bacteria | 3893 |
| 301 | nmdc:mga03n38_556419_c1 | 3300050490 | Bacteria | 649 |
| 302 | nmdc:mga0yw44_620891_c1 | 3300050492 | Bacteria | 734 |
| 303 | nmdc:mga07m45_110971_c1 | 3300050496 | Bacteria | 1580 |
| 304 | nmdc:mga07m45_112679_c1 | 3300050496 | Bacteria | 1568 |
| 305 | nmdc:mga05p37_7761_c1 | 3300050507 | Bacteria | 12667 |
| 306 | nmdc:mga09592_328_c1 | 3300050508 | Bacteria | 34777 |
| 307 | nmdc:mga08y16_451579_c1 | 3300050511 | Bacteria | 1311 |
| 308 | nmdc:mga0sz30_327240_c1 | 3300050516 | Bacteria | 684 |
| 309 | Ga0500646_0077437 | 3300053090 | Bacteria | 1009 |
| 310 | Ga0500583_0113606 | 3300053092 | Unclassified | 1336 |
| 311 | Ga0500573_0032085 | 3300053140 | Bacteria | 3031 |
| 312 | Ga0500616_0038427 | 3300053153 | Bacteria | 2585 |
| 313 | Ga0500616_0106060 | 3300053153 | Bacteria | 1365 |
| 314 | Ga0500645_187994 | 3300053730 | Bacteria | 560 |
| 315 | Ga0501084_0057500 | 3300054114 | Bacteria | 3254 |
| 316 | Ga0501084_0063892 | 3300054114 | Unclassified | 3082 |
| 317 | Ga0590074_018774 | 3300059423 | Bacteria | 1184 |
| 318 | Ga0590075_068338 | 3300059424 | Unclassified | 917 |
| 319 | Ga0501082_0005007 | 3300060353 | Bacteria | 11564 |
| 320 | Ga0501082_0013856 | 3300060353 | Bacteria | 6932 |
| 321 | Ga0501082_1483990 | 3300060353 | Bacteria | 592 |
| 322 | Ga0530510_0002505 | 3300061734 | Bacteria | 12623 |
| 323 | Ga0530510_1587878 | 3300061734 | Unclassified | 502 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0078577 | Ga0373927_0078577_147_476 | 109 |
| 2 | 3300045051 | Ga0451576_0167888 | Ga0451576_0167888_831_1160 | 109 |
| 3 | 3300061734 | Ga0530510_1587878 | Ga0530510_1587878_75_443 | 122 |
| 4 | 3300025934 | Ga0207686_10196178 | Ga0207686_101961782 | 128 |
| 5 | 3300005435 | Ga0070714_100001345 | Ga0070714_1000013458 | 129 |
| 6 | 3300014497 | Ga0182008_10006894 | Ga0182008_100068944 | 129 |
| 7 | 3300015261 | Ga0182006_1086180 | Ga0182006_10861802 | 129 |
| 8 | 3300015262 | Ga0182007_10177451 | Ga0182007_101774511 | 129 |
| 9 | 3300025929 | Ga0207664_10001851 | Ga0207664_100018518 | 129 |
| 10 | 3300005467 | Ga0070706_100034608 | Ga0070706_1000346082 | 130 |
| 11 | 3300005468 | Ga0070707_100115519 | Ga0070707_1001155194 | 130 |
| 12 | 3300005536 | Ga0070697_100056997 | Ga0070697_1000569973 | 130 |
| 13 | 3300025910 | Ga0207684_10254395 | Ga0207684_102543952 | 130 |
| 14 | 3300025922 | Ga0207646_10047620 | Ga0207646_100476205 | 130 |
| 15 | 3300025909 | Ga0207705_10140422 | Ga0207705_101404222 | 131 |
| 16 | 3300045051 | Ga0451576_0688665 | Ga0451576_0688665_337_735 | 131 |
| 17 | 3300046471 | Ga0495650_0018561 | Ga0495650_0018561_2254_2649 | 131 |
| 18 | 3300046519 | Ga0495632_0428229 | Ga0495632_0428229_51_446 | 131 |
| 19 | iso_pu_bacteria | 2508501122 | 2509110861 | 131 |
| 20 | iso_pu_bacteria | 2585427634 | 2585999430 | 131 |
| 21 | iso_pu_bacteria | 8002285264 | 8002289334 | 131 |
| 22 | 3300046499 | Ga0495594_0394418 | Ga0495594_0394418_98_496 | 132 |
| 23 | 3300049568 | Ga0501031_0005728 | Ga0501031_0005728_5289_5696 | 132 |
| 24 | 3300049569 | Ga0501032_0086129 | Ga0501032_0086129_83_490 | 132 |
| 25 | 3300049570 | Ga0501033_0003775 | Ga0501033_0003775_93_500 | 132 |
| 26 | 3300049572 | Ga0501036_0001841 | Ga0501036_0001841_2840_3247 | 132 |
| 27 | 3300049573 | Ga0501037_0002090 | Ga0501037_0002090_11322_11729 | 132 |
| 28 | 3300049574 | Ga0501038_0047242 | Ga0501038_0047242_1026_1433 | 132 |
| 29 | 3300049575 | Ga0501039_0057583 | Ga0501039_0057583_1075_1482 | 132 |
| 30 | 3300049576 | Ga0501040_0025649 | Ga0501040_0025649_757_1164 | 132 |
| 31 | 3300049577 | Ga0501041_0012099 | Ga0501041_0012099_2755_3162 | 132 |
| 32 | 3300049578 | Ga0501042_0001476 | Ga0501042_0001476_9923_10330 | 132 |
| 33 | 3300049579 | Ga0501043_0081675 | Ga0501043_0081675_1345_1752 | 132 |
| 34 | 3300049580 | Ga0501046_0012196 | Ga0501046_0012196_5064_5471 | 132 |
| 35 | 3300049582 | Ga0501048_0050511 | Ga0501048_0050511_1411_1818 | 132 |
| 36 | 3300049584 | Ga0501068_0004247 | Ga0501068_0004247_4533_4940 | 132 |
| 37 | 3300049585 | Ga0501069_0182519 | Ga0501069_0182519_702_1109 | 132 |
| 38 | 3300049586 | Ga0501070_0010759 | Ga0501070_0010759_4484_4891 | 132 |
| 39 | 3300049587 | Ga0501071_0003099 | Ga0501071_0003099_2722_3129 | 132 |
| 40 | 3300049588 | Ga0501072_0056099 | Ga0501072_0056099_1353_1760 | 132 |
| 41 | 3300049590 | Ga0501074_0002228 | Ga0501074_0002228_12119_12526 | 132 |
| 42 | 3300049591 | Ga0501075_0004218 | Ga0501075_0004218_9100_9507 | 132 |
| 43 | 3300049592 | Ga0501076_0081046 | Ga0501076_0081046_2123_2530 | 132 |
| 44 | 3300049593 | Ga0501077_0029680 | Ga0501077_0029680_1817_2224 | 132 |
| 45 | 3300049741 | Ga0501079_0007982 | Ga0501079_0007982_5697_6104 | 132 |
| 46 | 3300049742 | Ga0501080_0048868 | Ga0501080_0048868_2044_2451 | 132 |
| 47 | 3300049743 | Ga0501081_0046358 | Ga0501081_0046358_1919_2326 | 132 |
| 48 | 3300049744 | Ga0501083_0043215 | Ga0501083_0043215_1006_1413 | 132 |
| 49 | 3300049822 | Ga0501035_0050352 | Ga0501035_0050352_2617_3024 | 132 |
| 50 | 3300049823 | Ga0501044_0056488 | Ga0501044_0056488_203_610 | 132 |
| 51 | 3300049824 | Ga0501045_0030644 | Ga0501045_0030644_2125_2532 | 132 |
| 52 | 3300054114 | Ga0501084_0057500 | Ga0501084_0057500_1203_1610 | 132 |
| 53 | 3300060353 | Ga0501082_0013856 | Ga0501082_0013856_5433_5840 | 132 |
| 54 | 3300061734 | Ga0530510_0002505 | Ga0530510_0002505_9263_9670 | 132 |
| 55 | 3300032002 | Ga0307416_100952994 | Ga0307416_1009529941 | 133 |
| 56 | 3300046472 | Ga0495580_0326109 | Ga0495580_0326109_163_564 | 133 |
| 57 | 3300046681 | Ga0495647_0000873 | Ga0495647_0000873_4444_4845 | 133 |
| 58 | 3300048924 | Ga0496121_0008021 | Ga0496121_0008021_3574_3975 | 133 |
| 59 | 3300059423 | Ga0590074_018774 | Ga0590074_018774_102_506 | 133 |
| 60 | 3300059424 | Ga0590075_068338 | Ga0590075_068338_348_752 | 133 |
| 61 | 3300003759 | Ga0055525_1000164 | Ga0055525_100016414 | 134 |
| 62 | 3300003760 | Ga0055527_1000061 | Ga0055527_100006138 | 134 |
| 63 | 3300003760 | Ga0055527_1000065 | Ga0055527_100006515 | 134 |
| 64 | 3300003761 | Ga0055535_1000195 | Ga0055535_100019514 | 134 |
| 65 | 3300003761 | Ga0055535_1000197 | Ga0055535_100019712 | 134 |
| 66 | 3300003762 | Ga0055542_1000097 | Ga0055542_100009739 | 134 |
| 67 | 3300003762 | Ga0055542_1000140 | Ga0055542_100014014 | 134 |
| 68 | 3300003763 | Ga0055529_1000157 | Ga0055529_100015739 | 134 |
| 69 | 3300003763 | Ga0055529_1000269 | Ga0055529_100026948 | 134 |
| 70 | 3300005295 | Ga0065707_10107107 | Ga0065707_101071075 | 134 |
| 71 | 3300005336 | Ga0070680_100871738 | Ga0070680_1008717382 | 134 |
| 72 | 3300005339 | Ga0070660_100770581 | Ga0070660_1007705812 | 134 |
| 73 | 3300005340 | Ga0070689_101120637 | Ga0070689_1011206372 | 134 |
| 74 | 3300005340 | Ga0070689_101228599 | Ga0070689_1012285991 | 134 |
| 75 | 3300005343 | Ga0070687_100510630 | Ga0070687_1005106302 | 134 |
| 76 | 3300005347 | Ga0070668_100018304 | Ga0070668_1000183042 | 134 |
| 77 | 3300005353 | Ga0070669_100002170 | Ga0070669_10000217015 | 134 |
| 78 | 3300005354 | Ga0070675_100216385 | Ga0070675_1002163853 | 134 |
| 79 | 3300005441 | Ga0070700_100224380 | Ga0070700_1002243802 | 134 |
| 80 | 3300005444 | Ga0070694_100231762 | Ga0070694_1002317622 | 134 |
| 81 | 3300005456 | Ga0070678_100215281 | Ga0070678_1002152812 | 134 |
| 82 | 3300005457 | Ga0070662_100009449 | Ga0070662_1000094495 | 134 |
| 83 | 3300005458 | Ga0070681_10020881 | Ga0070681_100208814 | 134 |
| 84 | 3300005458 | Ga0070681_11221172 | Ga0070681_112211721 | 134 |
| 85 | 3300005530 | Ga0070679_100175051 | Ga0070679_1001750512 | 134 |
| 86 | 3300005577 | Ga0068857_100093722 | Ga0068857_1000937224 | 134 |
| 87 | 3300005614 | Ga0068856_100010471 | Ga0068856_1000104712 | 134 |
| 88 | 3300005616 | Ga0068852_101523418 | Ga0068852_1015234181 | 134 |
| 89 | 3300005718 | Ga0068866_10379358 | Ga0068866_103793581 | 134 |
| 90 | 3300005719 | Ga0068861_100001539 | Ga0068861_10000153918 | 134 |
| 91 | 3300005844 | Ga0068862_100000292 | Ga0068862_10000029252 | 134 |
| 92 | 3300005844 | Ga0068862_100200082 | Ga0068862_1002000822 | 134 |
| 93 | 3300006844 | Ga0075428_100016435 | Ga0075428_10001643510 | 134 |
| 94 | 3300006844 | Ga0075428_100161703 | Ga0075428_1001617032 | 134 |
| 95 | 3300006846 | Ga0075430_100602097 | Ga0075430_1006020972 | 134 |
| 96 | 3300006871 | Ga0075434_100325586 | Ga0075434_1003255863 | 134 |
| 97 | 3300006880 | Ga0075429_100000901 | Ga0075429_1000009014 | 134 |
| 98 | 3300006881 | Ga0068865_100268688 | Ga0068865_1002686882 | 134 |
| 99 | 3300009147 | Ga0114129_10078504 | Ga0114129_100785045 | 134 |
| 100 | 3300009553 | Ga0105249_10765708 | Ga0105249_107657082 | 134 |
| 101 | 3300011119 | Ga0105246_10801123 | Ga0105246_108011232 | 134 |
| 102 | 3300021384 | Ga0213876_10174097 | Ga0213876_101740972 | 134 |
| 103 | 3300025228 | Ga0209672_100049 | Ga0209672_100049138 | 134 |
| 104 | 3300025230 | Ga0209563_100051 | Ga0209563_100051137 | 134 |
| 105 | 3300025242 | Ga0209258_100087 | Ga0209258_100087138 | 134 |
| 106 | 3300025254 | Ga0209148_1000096 | Ga0209148_1000096138 | 134 |
| 107 | 3300025272 | Ga0209455_1000088 | Ga0209455_1000088138 | 134 |
| 108 | 3300025901 | Ga0207688_10047854 | Ga0207688_100478542 | 134 |
| 109 | 3300025907 | Ga0207645_10043899 | Ga0207645_100438992 | 134 |
| 110 | 3300025912 | Ga0207707_10426832 | Ga0207707_104268322 | 134 |
| 111 | 3300025917 | Ga0207660_10167583 | Ga0207660_101675832 | 134 |
| 112 | 3300025918 | Ga0207662_11042537 | Ga0207662_110425372 | 134 |
| 113 | 3300025919 | Ga0207657_10676832 | Ga0207657_106768322 | 134 |
| 114 | 3300025921 | Ga0207652_10219103 | Ga0207652_102191032 | 134 |
| 115 | 3300025923 | Ga0207681_10054764 | Ga0207681_100547643 | 134 |
| 116 | 3300025925 | Ga0207650_10606606 | Ga0207650_106066062 | 134 |
| 117 | 3300025925 | Ga0207650_11101680 | Ga0207650_111016802 | 134 |
| 118 | 3300025932 | Ga0207690_10271814 | Ga0207690_102718142 | 134 |
| 119 | 3300025933 | Ga0207706_10003427 | Ga0207706_1000342711 | 134 |
| 120 | 3300025935 | Ga0207709_10476703 | Ga0207709_104767032 | 134 |
| 121 | 3300025936 | Ga0207670_10768765 | Ga0207670_107687652 | 134 |
| 122 | 3300025938 | Ga0207704_10317842 | Ga0207704_103178422 | 134 |
| 123 | 3300025940 | Ga0207691_11017473 | Ga0207691_110174731 | 134 |
| 124 | 3300025945 | Ga0207679_10854548 | Ga0207679_108545482 | 134 |
| 125 | 3300025961 | Ga0207712_10025598 | Ga0207712_100255983 | 134 |
| 126 | 3300025961 | Ga0207712_10824888 | Ga0207712_108248882 | 134 |
| 127 | 3300025972 | Ga0207668_10097778 | Ga0207668_100977782 | 134 |
| 128 | 3300026075 | Ga0207708_10386004 | Ga0207708_103860042 | 134 |
| 129 | 3300026078 | Ga0207702_10002786 | Ga0207702_1000278611 | 134 |
| 130 | 3300026088 | Ga0207641_10831062 | Ga0207641_108310622 | 134 |
| 131 | 3300026116 | Ga0207674_10084847 | Ga0207674_100848472 | 134 |
| 132 | 3300026118 | Ga0207675_100003666 | Ga0207675_10000366618 | 134 |
| 133 | 3300026121 | Ga0207683_10262249 | Ga0207683_102622492 | 134 |
| 134 | 3300026121 | Ga0207683_10269038 | Ga0207683_102690382 | 134 |
| 135 | 3300028380 | Ga0268265_10040527 | Ga0268265_100405272 | 134 |
| 136 | 3300030521 | Ga0307511_10008761 | Ga0307511_100087617 | 134 |
| 137 | 3300031240 | Ga0265320_10125409 | Ga0265320_101254092 | 134 |
| 138 | 3300031548 | Ga0307408_100215963 | Ga0307408_1002159632 | 134 |
| 139 | 3300031995 | Ga0307409_100198529 | Ga0307409_1001985292 | 134 |
| 140 | 3300031995 | Ga0307409_100747854 | Ga0307409_1007478541 | 134 |
| 141 | 3300039437 | Ga0436365_1152120 | Ga0436365_1152120_855_1259 | 134 |
| 142 | 3300046458 | Ga0495591_015427 | Ga0495591_015427_1236_1640 | 134 |
| 143 | 3300046523 | Ga0495644_0004714 | Ga0495644_0004714_3284_3688 | 134 |
| 144 | 3300046525 | Ga0495663_0108255 | Ga0495663_0108255_89_493 | 134 |
| 145 | 3300046539 | Ga0495621_0000128 | Ga0495621_0000128_13766_14170 | 134 |
| 146 | 3300046542 | Ga0495597_0000987 | Ga0495597_0000987_18270_18674 | 134 |
| 147 | 3300046615 | Ga0495656_0019197 | Ga0495656_0019197_1794_2198 | 134 |
| 148 | 3300046692 | Ga0495671_0041417 | Ga0495671_0041417_781_1185 | 134 |
| 149 | 3300046692 | Ga0495671_0319711 | Ga0495671_0319711_209_613 | 134 |
| 150 | 3300046694 | Ga0495649_0114128 | Ga0495649_0114128_664_1068 | 134 |
| 151 | 3300047470 | Ga0495681_0011330 | Ga0495681_0011330_667_1071 | 134 |
| 152 | 3300048090 | Ga0495615_0071766 | Ga0495615_0071766_356_760 | 134 |
| 153 | 3300049587 | Ga0501071_0457487 | Ga0501071_0457487_113_517 | 134 |
| 154 | 3300050507 | nmdc:mga05p37_7761_c1 | nmdc:mga05p37_7761_c1_2141_2545 | 134 |
| 155 | 3300050508 | nmdc:mga09592_328_c1 | nmdc:mga09592_328_c1_32212_32616 | 134 |
| 156 | 3300060353 | Ga0501082_1483990 | Ga0501082_1483990_35_439 | 134 |
| 157 | 3300005328 | Ga0070676_10067131 | Ga0070676_100671312 | 135 |
| 158 | 3300005355 | Ga0070671_100968153 | Ga0070671_1009681532 | 135 |
| 159 | 3300005365 | Ga0070688_100663547 | Ga0070688_1006635472 | 135 |
| 160 | 3300005365 | Ga0070688_101298967 | Ga0070688_1012989671 | 135 |
| 161 | 3300005456 | Ga0070678_100987245 | Ga0070678_1009872451 | 135 |
| 162 | 3300005459 | Ga0068867_100118910 | Ga0068867_1001189103 | 135 |
| 163 | 3300005548 | Ga0070665_100036795 | Ga0070665_1000367954 | 135 |
| 164 | 3300005577 | Ga0068857_100596396 | Ga0068857_1005963962 | 135 |
| 165 | 3300005614 | Ga0068856_100142358 | Ga0068856_1001423584 | 135 |
| 166 | 3300005618 | Ga0068864_100294799 | Ga0068864_1002947992 | 135 |
| 167 | 3300005719 | Ga0068861_100800175 | Ga0068861_1008001752 | 135 |
| 168 | 3300005840 | Ga0068870_10068839 | Ga0068870_100688392 | 135 |
| 169 | 3300005841 | Ga0068863_100040586 | Ga0068863_1000405866 | 135 |
| 170 | 3300005844 | Ga0068862_100370173 | Ga0068862_1003701733 | 135 |
| 171 | 3300006177 | Ga0075362_10123151 | Ga0075362_101231512 | 135 |
| 172 | 3300006195 | Ga0075366_10748072 | Ga0075366_107480722 | 135 |
| 173 | 3300006353 | Ga0075370_10089065 | Ga0075370_100890652 | 135 |
| 174 | 3300009098 | Ga0105245_10308459 | Ga0105245_103084592 | 135 |
| 175 | 3300009098 | Ga0105245_10580238 | Ga0105245_105802381 | 135 |
| 176 | 3300009148 | Ga0105243_10118645 | Ga0105243_101186452 | 135 |
| 177 | 3300009148 | Ga0105243_12240502 | Ga0105243_122405021 | 135 |
| 178 | 3300009176 | Ga0105242_10362520 | Ga0105242_103625201 | 135 |
| 179 | 3300009176 | Ga0105242_11725369 | Ga0105242_117253691 | 135 |
| 180 | 3300014325 | Ga0163163_11159775 | Ga0163163_111597751 | 135 |
| 181 | 3300025907 | Ga0207645_10322631 | Ga0207645_103226311 | 135 |
| 182 | 3300025908 | Ga0207643_10076937 | Ga0207643_100769372 | 135 |
| 183 | 3300025927 | Ga0207687_10430583 | Ga0207687_104305831 | 135 |
| 184 | 3300025942 | Ga0207689_10095192 | Ga0207689_100951922 | 135 |
| 185 | 3300026035 | Ga0207703_10488237 | Ga0207703_104882372 | 135 |
| 186 | 3300026078 | Ga0207702_10051964 | Ga0207702_100519643 | 135 |
| 187 | 3300026088 | Ga0207641_10040023 | Ga0207641_100400236 | 135 |
| 188 | 3300026089 | Ga0207648_10057742 | Ga0207648_100577422 | 135 |
| 189 | 3300026095 | Ga0207676_10699341 | Ga0207676_106993412 | 135 |
| 190 | 3300026118 | Ga0207675_100780683 | Ga0207675_1007806832 | 135 |
| 191 | 3300028379 | Ga0268266_10040229 | Ga0268266_100402292 | 135 |
| 192 | 3300035115 | Ga0373941_0031312 | Ga0373941_0031312_644_1057 | 135 |
| 193 | 3300035692 | Ga0373935_0792801 | Ga0373935_0792801_120_527 | 135 |
| 194 | 3300035725 | Ga0373947_0064458 | Ga0373947_0064458_432_839 | 135 |
| 195 | 3300037471 | Ga0395905_0527290 | Ga0395905_0527290_75_488 | 135 |
| 196 | 3300038443 | Ga0395901_0601564 | Ga0395901_0601564_459_872 | 135 |
| 197 | 3300042133 | Ga0450896_047634 | Ga0450896_047634_143_550 | 135 |
| 198 | 3300042876 | Ga0451577_0361481 | Ga0451577_0361481_531_938 | 135 |
| 199 | 3300044656 | Ga0466969_0030829 | Ga0466969_0030829_2170_2577 | 135 |
| 200 | 3300044684 | Ga0466966_0071633 | Ga0466966_0071633_882_1289 | 135 |
| 201 | 3300045049 | Ga0466959_0464596 | Ga0466959_0464596_164_571 | 135 |
| 202 | 3300046460 | Ga0495638_0136307 | Ga0495638_0136307_1019_1426 | 135 |
| 203 | 3300046463 | Ga0495653_0329678 | Ga0495653_0329678_253_660 | 135 |
| 204 | 3300046533 | Ga0495640_0400957 | Ga0495640_0400957_301_708 | 135 |
| 205 | 3300049571 | Ga0501034_0000109 | Ga0501034_0000109_30580_30993 | 135 |
| 206 | 3300049571 | Ga0501034_0001175 | Ga0501034_0001175_19022_19435 | 135 |
| 207 | 3300049573 | Ga0501037_0180481 | Ga0501037_0180481_63_476 | 135 |
| 208 | 3300049584 | Ga0501068_0005048 | Ga0501068_0005048_1904_2317 | 135 |
| 209 | 3300049586 | Ga0501070_0133616 | Ga0501070_0133616_195_608 | 135 |
| 210 | 3300049823 | Ga0501044_0066505 | Ga0501044_0066505_485_898 | 135 |
| 211 | 3300050490 | nmdc:mga03n38_556419_c1 | nmdc:mga03n38_556419_c1_87_494 | 135 |
| 212 | 3300050492 | nmdc:mga0yw44_620891_c1 | nmdc:mga0yw44_620891_c1_216_623 | 135 |
| 213 | 3300050496 | nmdc:mga07m45_110971_c1 | nmdc:mga07m45_110971_c1_905_1312 | 135 |
| 214 | 3300050496 | nmdc:mga07m45_112679_c1 | nmdc:mga07m45_112679_c1_276_683 | 135 |
| 215 | 3300050516 | nmdc:mga0sz30_327240_c1 | nmdc:mga0sz30_327240_c1_264_671 | 135 |
| 216 | 3300053140 | Ga0500573_0032085 | Ga0500573_0032085_1137_1544 | 135 |
| 217 | 3300053153 | Ga0500616_0038427 | Ga0500616_0038427_1185_1592 | 135 |
| 218 | 3300053153 | Ga0500616_0106060 | Ga0500616_0106060_790_1197 | 135 |
| 219 | 3300053730 | Ga0500645_187994 | Ga0500645_187994_58_465 | 135 |
| 220 | 3300002076 | JGI24749J21850_1019237 | JGI24749J21850_10192372 | 136 |
| 221 | 3300002459 | JGI24751J29686_10002265 | JGI24751J29686_100022655 | 136 |
| 222 | 3300005288 | Ga0065714_10131555 | Ga0065714_101315552 | 136 |
| 223 | 3300005290 | Ga0065712_10006332 | Ga0065712_100063323 | 136 |
| 224 | 3300005293 | Ga0065715_10109848 | Ga0065715_101098482 | 136 |
| 225 | 3300005563 | Ga0068855_100371098 | Ga0068855_1003710982 | 136 |
| 226 | 3300005840 | Ga0068870_10002423 | Ga0068870_1000242316 | 136 |
| 227 | 3300005841 | Ga0068863_100808615 | Ga0068863_1008086152 | 136 |
| 228 | 3300005843 | Ga0068860_100327398 | Ga0068860_1003273983 | 136 |
| 229 | 3300005844 | Ga0068862_100120450 | Ga0068862_1001204502 | 136 |
| 230 | 3300006880 | Ga0075429_100543487 | Ga0075429_1005434872 | 136 |
| 231 | 3300006881 | Ga0068865_100044269 | Ga0068865_1000442696 | 136 |
| 232 | 3300025904 | Ga0207647_10228321 | Ga0207647_102283212 | 136 |
| 233 | 3300025911 | Ga0207654_11117660 | Ga0207654_111176601 | 136 |
| 234 | 3300025924 | Ga0207694_10596828 | Ga0207694_105968282 | 136 |
| 235 | 3300025925 | Ga0207650_10000694 | Ga0207650_100006945 | 136 |
| 236 | 3300025934 | Ga0207686_10192283 | Ga0207686_101922832 | 136 |
| 237 | 3300025949 | Ga0207667_10348525 | Ga0207667_103485252 | 136 |
| 238 | 3300026078 | Ga0207702_12296099 | Ga0207702_122960991 | 136 |
| 239 | 3300026121 | Ga0207683_10188274 | Ga0207683_101882742 | 136 |
| 240 | 3300031090 | Ga0265760_10035692 | Ga0265760_100356922 | 136 |
| 241 | 3300005617 | Ga0068859_100917901 | Ga0068859_1009179012 | 137 |
| 242 | 3300006931 | Ga0097620_100917997 | Ga0097620_1009179972 | 137 |
| 243 | 3300009177 | Ga0105248_11499650 | Ga0105248_114996501 | 137 |
| 244 | 3300009177 | Ga0105248_12295618 | Ga0105248_122956182 | 137 |
| 245 | 3300011119 | Ga0105246_11482270 | Ga0105246_114822701 | 137 |
| 246 | 3300014969 | Ga0157376_11897780 | Ga0157376_118977801 | 137 |
| 247 | 3300026035 | Ga0207703_10596001 | Ga0207703_105960012 | 137 |
| 248 | 3300031251 | Ga0265327_10001223 | Ga0265327_1000122325 | 137 |
| 249 | 3300046694 | Ga0495649_0008742 | Ga0495649_0008742_5530_5946 | 138 |
| 250 | 3300003316 | rootH1_10011795 | rootH1_100117953 | 139 |
| 251 | 3300003316 | rootH1_10015006 | rootH1_100150062 | 139 |
| 252 | 3300003322 | rootL2_10128957 | rootL2_101289574 | 139 |
| 253 | 3300003323 | rootH1_10003971 | rootH1_100039718 | 139 |
| 254 | 3300003752 | Ga0055539_1000366 | Ga0055539_100036611 | 139 |
| 255 | 3300003756 | Ga0055533_1000100 | Ga0055533_100010013 | 139 |
| 256 | 3300003759 | Ga0055525_1000877 | Ga0055525_10008779 | 139 |
| 257 | 3300005338 | Ga0068868_100539281 | Ga0068868_1005392812 | 139 |
| 258 | 3300005364 | Ga0070673_100382439 | Ga0070673_1003824392 | 139 |
| 259 | 3300005719 | Ga0068861_100172793 | Ga0068861_1001727932 | 139 |
| 260 | 3300009093 | Ga0105240_10258484 | Ga0105240_102584843 | 139 |
| 261 | 3300009545 | Ga0105237_11822966 | Ga0105237_118229662 | 139 |
| 262 | 3300009553 | Ga0105249_12791471 | Ga0105249_127914711 | 139 |
| 263 | 3300013297 | Ga0157378_10722124 | Ga0157378_107221242 | 139 |
| 264 | 3300014325 | Ga0163163_12321520 | Ga0163163_123215202 | 139 |
| 265 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031872 | 139 |
| 266 | 3300025230 | Ga0209563_100017 | Ga0209563_10001798 | 139 |
| 267 | 3300025253 | Ga0209677_100135 | Ga0209677_10013541 | 139 |
| 268 | 3300025960 | Ga0207651_10359902 | Ga0207651_103599023 | 139 |
| 269 | 3300026118 | Ga0207675_100120654 | Ga0207675_1001206542 | 139 |
| 270 | 3300028381 | Ga0268264_11063144 | Ga0268264_110631442 | 139 |
| 271 | 3300049583 | Ga0501067_0003604 | Ga0501067_0003604_5855_6274 | 139 |
| 272 | 3300049589 | Ga0501073_0004433 | Ga0501073_0004433_2231_2650 | 139 |
| 273 | 3300049592 | Ga0501076_1046102 | Ga0501076_1046102_10_429 | 139 |
| 274 | 3300049593 | Ga0501077_0015074 | Ga0501077_0015074_2202_2621 | 139 |
| 275 | 3300049742 | Ga0501080_0008278 | Ga0501080_0008278_3100_3519 | 139 |
| 276 | 3300049744 | Ga0501083_0138140 | Ga0501083_0138140_268_687 | 139 |
| 277 | 3300054114 | Ga0501084_0063892 | Ga0501084_0063892_1269_1688 | 139 |
| 278 | 3300060353 | Ga0501082_0005007 | Ga0501082_0005007_1253_1672 | 139 |
| 279 | 3300009545 | Ga0105237_10133495 | Ga0105237_101334952 | 140 |
| 280 | 3300053090 | Ga0500646_0077437 | Ga0500646_0077437_374_799 | 140 |
| 281 | 3300053092 | Ga0500583_0113606 | Ga0500583_0113606_771_1196 | 140 |
| 282 | 2162886011 | MRS1b_contig_6058718 | MRS1b_0669.00002520 | 141 |
| 283 | 3300005548 | Ga0070665_100294068 | Ga0070665_1002940682 | 141 |
| 284 | 3300005616 | Ga0068852_100123351 | Ga0068852_1001233512 | 141 |
| 285 | 3300005841 | Ga0068863_100669080 | Ga0068863_1006690802 | 141 |
| 286 | 3300006237 | Ga0097621_100585536 | Ga0097621_1005855362 | 141 |
| 287 | 3300009094 | Ga0111539_10029717 | Ga0111539_1002971710 | 141 |
| 288 | 3300009148 | Ga0105243_10033528 | Ga0105243_100335286 | 141 |
| 289 | 3300009174 | Ga0105241_10621646 | Ga0105241_106216462 | 141 |
| 290 | 3300009176 | Ga0105242_10031924 | Ga0105242_100319247 | 141 |
| 291 | 3300009551 | Ga0105238_10966103 | Ga0105238_109661032 | 141 |
| 292 | 3300009553 | Ga0105249_10105904 | Ga0105249_101059043 | 141 |
| 293 | 3300010375 | Ga0105239_11033065 | Ga0105239_110330651 | 141 |
| 294 | 3300013296 | Ga0157374_10060337 | Ga0157374_100603377 | 141 |
| 295 | 3300013297 | Ga0157378_10201718 | Ga0157378_102017182 | 141 |
| 296 | 3300013307 | Ga0157372_10833456 | Ga0157372_108334562 | 141 |
| 297 | 3300013308 | Ga0157375_10218434 | Ga0157375_102184342 | 141 |
| 298 | 3300014325 | Ga0163163_10145877 | Ga0163163_101458775 | 141 |
| 299 | 3300014745 | Ga0157377_10000595 | Ga0157377_100005952 | 141 |
| 300 | 3300014968 | Ga0157379_10286072 | Ga0157379_102860722 | 141 |
| 301 | 3300014969 | Ga0157376_10246670 | Ga0157376_102466703 | 141 |
| 302 | 3300017792 | Ga0163161_11032194 | Ga0163161_110321942 | 141 |
| 303 | 3300025923 | Ga0207681_10544496 | Ga0207681_105444962 | 141 |
| 304 | 3300025936 | Ga0207670_10045909 | Ga0207670_100459093 | 141 |
| 305 | 3300025938 | Ga0207704_10437064 | Ga0207704_104370641 | 141 |
| 306 | 3300026142 | Ga0207698_10095324 | Ga0207698_100953243 | 141 |
| 307 | 3300028380 | Ga0268265_10352953 | Ga0268265_103529532 | 141 |
| 308 | 3300034817 | Ga0373948_0039693 | Ga0373948_0039693_31_456 | 141 |
| 309 | 3300035116 | Ga0373945_0298856 | Ga0373945_0298856_58_483 | 141 |
| 310 | 3300035695 | Ga0373927_1188021 | Ga0373927_1188021_61_486 | 141 |
| 311 | 3300037068 | Ga0373925_0099386 | Ga0373925_0099386_233_658 | 141 |
| 312 | 3300046472 | Ga0495580_0837344 | Ga0495580_0837344_57_482 | 141 |
| 313 | 3300046537 | Ga0495598_0226512 | Ga0495598_0226512_94_519 | 141 |
| 314 | 3300046539 | Ga0495621_0549522 | Ga0495621_0549522_37_462 | 141 |
| 315 | 3300048903 | Ga0496100_0096521 | Ga0496100_0096521_1192_1617 | 141 |
| 316 | 3300048904 | Ga0496101_0085913 | Ga0496101_0085913_1186_1611 | 141 |
| 317 | 3300048905 | Ga0496102_0081363 | Ga0496102_0081363_613_1038 | 141 |
| 318 | 3300048908 | Ga0496105_0011928 | Ga0496105_0011928_427_852 | 141 |
| 319 | 3300048909 | Ga0496106_0023988 | Ga0496106_0023988_2274_2699 | 141 |
| 320 | 3300048910 | Ga0496107_0034676 | Ga0496107_0034676_642_1067 | 141 |
| 321 | 3300048911 | Ga0496108_0005708 | Ga0496108_0005708_8535_8960 | 141 |
| 322 | 3300048912 | Ga0496109_0008725 | Ga0496109_0008725_6963_7388 | 141 |
| 323 | 3300048913 | Ga0496110_0032484 | Ga0496110_0032484_2557_2982 | 141 |
| 324 | 3300048917 | Ga0496114_0021721 | Ga0496114_0021721_4412_4837 | 141 |
| 325 | 3300050511 | nmdc:mga08y16_451579_c1 | nmdc:mga08y16_451579_c1_268_693 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.9158 | 6 | 141 |
| 4hr6-assembly1.cif.gz_B | crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips | 0.8704 | 59 | 92 |
| 5y42-assembly2.cif.gz_E | native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina | 0.8631 | 59 | 92 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8565 | 6 | 141 |
| 1bry-assembly2.cif.gz_Z | bryodin type i rip | 0.8408 | 59 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hr6B01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8704 | 59 | 92 | 3.40.420.10 |
| 3ku0B01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8384 | 61 | 91 | 3.40.420.10 |
| af_A0A1D8PM79_595_670_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8177 | 61 | 91 | 3.30.160.20 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.8136 | 7 | 135 | 3.90.1590.10 |
| af_C7IYE5_70_121_3.30.160.60 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.7993 | 61 | 86 | 3.30.160.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7TU73-F1-model_v4 | Uncharacterized conserved protein | 0.9942 | 6 | 140 |
GO:0016846
GO:0046872 |
| AF-A0A1G7TU73-F1-model_v4 | Uncharacterized conserved protein | 0.9868 | 6 | 140 |
GO:0016846
GO:0046872 |
| AF-A0A4U0GAE5-F1-model_v4 | GFA family protein | 0.9624 | 7 | 135 |
GO:0016846
GO:0046872 |
| AF-A0A5J6N1S8-F1-model_v4 | Aldehyde-activating protein | 0.9591 | 7 | 140 |
GO:0016846
GO:0046872 |
| AF-A0A3S0EWC4-F1-model_v4 | deleted | 0.9566 | 7 | 140 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar