F407814

General Info

Members Datasets Scaffolds Average Seq Length
325 245 323 136

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10133495|Ga0105237_101334952
Length 160
Sequence MLRSLRPTQSSGGRLFFARLRSEVSMTTRTATCCCGQLSIEVHGTPRGVGVCHCFACQRRTGSGFAALASFAPPYRVSGRATEYVRVGDQGARFTFRFCPVCGTNLFHTEHGYEDRSVSVAVGAFGDPAFPPPTDSVYDSRRHAWVRLPDDMIAFPKDPD

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.31
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 0.92
Rhizoplane 3.08
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6058718 2162886011 Bacteria 1637
2 JGI24749J21850_1019237 3300002076 Bacteria 965
3 JGI24751J29686_10002265 3300002459 Unclassified 3900
4 rootH1_10011795 3300003316 Bacteria 4282
5 rootH1_10015006 3300003316 Bacteria 2544
6 rootH1_10015006 3300003323 Bacteria 10853
7 rootL2_10128957 3300003322 Bacteria 3420
8 rootH1_10003971 3300003323 Bacteria 7163
9 Ga0055539_1000366 3300003752 Bacteria 19209
10 Ga0055533_1000100 3300003756 Bacteria 111692
11 Ga0055525_1000164 3300003759 Bacteria 85555
12 Ga0055525_1000877 3300003759 Bacteria 8702
13 Ga0055527_1000061 3300003760 Bacteria 91171
14 Ga0055527_1000065 3300003760 Bacteria 88416
15 Ga0055535_1000195 3300003761 Bacteria 64294
16 Ga0055535_1000197 3300003761 Bacteria 64126
17 Ga0055542_1000097 3300003762 Bacteria 118227
18 Ga0055542_1000140 3300003762 Bacteria 90195
19 Ga0055529_1000157 3300003763 Bacteria 93119
20 Ga0055529_1000269 3300003763 Bacteria 61800
21 Ga0065714_10131555 3300005288 Bacteria 1241
22 Ga0065712_10006332 3300005290 Bacteria 3644
23 Ga0065715_10109848 3300005293 Unclassified 2649
24 Ga0065707_10107107 3300005295 Bacteria 2569
25 Ga0070676_10067131 3300005328 Bacteria 2144
26 Ga0070680_100871738 3300005336 Bacteria 776
27 Ga0068868_100539281 3300005338 Bacteria 1027
28 Ga0070660_100770581 3300005339 Archaea 808
29 Ga0070689_101120637 3300005340 Bacteria 704
30 Ga0070689_101228599 3300005340 Bacteria 673
31 Ga0070687_100510630 3300005343 Bacteria 811
32 Ga0070668_100018304 3300005347 Bacteria 5258
33 Ga0070669_100002170 3300005353 Bacteria 14186
34 Ga0070675_100216385 3300005354 Bacteria 1667
35 Ga0070671_100968153 3300005355 Bacteria 745
36 Ga0070673_100382439 3300005364 Bacteria 1255
37 Ga0070688_100663547 3300005365 Bacteria 804
38 Ga0070688_101298967 3300005365 Bacteria 587
39 Ga0070714_100001345 3300005435 Bacteria 17773
40 Ga0070700_100224380 3300005441 Unclassified 1333
41 Ga0070694_100231762 3300005444 Unclassified 1389
42 Ga0070678_100215281 3300005456 Bacteria 1594
43 Ga0070678_100987245 3300005456 Bacteria 773
44 Ga0070662_100009449 3300005457 Bacteria 6376
45 Ga0070681_10020881 3300005458 Bacteria 6558
46 Ga0070681_11221172 3300005458 Bacteria 674
47 Ga0068867_100118910 3300005459 Bacteria 2039
48 Ga0070706_100034608 3300005467 Unclassified 4666
49 Ga0070707_100115519 3300005468 Plasmid 2605
50 Ga0070679_100175051 3300005530 Bacteria 2118
51 Ga0070697_100056997 3300005536 Unclassified 3179
52 Ga0070665_100036795 3300005548 Bacteria 4922
53 Ga0070665_100294068 3300005548 Bacteria 1626
54 Ga0068855_100371098 3300005563 Bacteria 1573
55 Ga0068857_100093722 3300005577 Unclassified 2689
56 Ga0068857_100596396 3300005577 Bacteria 1044
57 Ga0068856_100010471 3300005614 Bacteria 9002
58 Ga0068856_100142358 3300005614 Bacteria 2405
59 Ga0068852_100123351 3300005616 Bacteria 2375
60 Ga0068852_101523418 3300005616 Bacteria 691
61 Ga0068859_100917901 3300005617 Bacteria 960
62 Ga0068864_100294799 3300005618 Bacteria 1517
63 Ga0068866_10379358 3300005718 Archaea 906
64 Ga0068861_100001539 3300005719 Bacteria 14623
65 Ga0068861_100172793 3300005719 Bacteria 1792
66 Ga0068861_100800175 3300005719 Bacteria 885
67 Ga0068870_10002423 3300005840 Bacteria 7762
68 Ga0068870_10068839 3300005840 Bacteria 1924
69 Ga0068863_100040586 3300005841 Bacteria 4425
70 Ga0068863_100669080 3300005841 Bacteria 1030
71 Ga0068863_100808615 3300005841 Bacteria 935
72 Ga0068860_100327398 3300005843 Bacteria 1504
73 Ga0068862_100000292 3300005844 Bacteria 54831
74 Ga0068862_100120450 3300005844 Bacteria 2312
75 Ga0068862_100200082 3300005844 Bacteria 1801
76 Ga0068862_100370173 3300005844 Bacteria 1334
77 Ga0075362_10123151 3300006177 Bacteria 1229
78 Ga0075366_10748072 3300006195 Unclassified 607
79 Ga0097621_100585536 3300006237 Bacteria 1018
80 Ga0075370_10089065 3300006353 Bacteria 1779
81 Ga0075428_100016435 3300006844 Bacteria 8175
82 Ga0075428_100161703 3300006844 Bacteria 2430
83 Ga0075430_100602097 3300006846 Bacteria 907
84 Ga0075434_100325586 3300006871 Unclassified 1557
85 Ga0075429_100000901 3300006880 Bacteria 23511
86 Ga0075429_100543487 3300006880 Bacteria 1018
87 Ga0068865_100044269 3300006881 Bacteria 3046
88 Ga0068865_100268688 3300006881 Unclassified 1353
89 Ga0097620_100917997 3300006931 Bacteria 960
90 Ga0105240_10258484 3300009093 Unclassified 2010
91 Ga0111539_10029717 3300009094 Bacteria 6652
92 Ga0105245_10308459 3300009098 Bacteria 1555
93 Ga0105245_10580238 3300009098 Bacteria 1146
94 Ga0114129_10078504 3300009147 Bacteria 4592
95 Ga0105243_10033528 3300009148 Unclassified 3971
96 Ga0105243_10118645 3300009148 Bacteria 2226
97 Ga0105243_12240502 3300009148 Bacteria 583
98 Ga0105241_10621646 3300009174 Bacteria 978
99 Ga0105242_10031924 3300009176 Unclassified 4210
100 Ga0105242_10362520 3300009176 Bacteria 1342
101 Ga0105242_11725369 3300009176 Bacteria 663
102 Ga0105248_11499650 3300009177 Bacteria 763
103 Ga0105248_12295618 3300009177 Bacteria 614
104 Ga0105237_10133495 3300009545 Bacteria 2477
105 Ga0105237_11822966 3300009545 Bacteria 616
106 Ga0105238_10966103 3300009551 Bacteria 872
107 Ga0105249_10105904 3300009553 Unclassified 2652
108 Ga0105249_10765708 3300009553 Unclassified 1028
109 Ga0105249_12791471 3300009553 Bacteria 560
110 Ga0105239_11033065 3300010375 Bacteria 945
111 Ga0105246_10801123 3300011119 Archaea 836
112 Ga0105246_11482270 3300011119 Bacteria 636
113 Ga0157374_10060337 3300013296 Bacteria 3549
114 Ga0157378_10201718 3300013297 Bacteria 1881
115 Ga0157378_10722124 3300013297 Bacteria 1017
116 Ga0157372_10833456 3300013307 Bacteria 1071
117 Ga0157375_10218434 3300013308 Bacteria 2064
118 Ga0163163_10145877 3300014325 Bacteria 2410
119 Ga0163163_11159775 3300014325 Bacteria 835
120 Ga0163163_12321520 3300014325 Unclassified 595
121 Ga0182008_10006894 3300014497 Bacteria 6313
122 Ga0157377_10000595 3300014745 Bacteria 14992
123 Ga0157379_10286072 3300014968 Bacteria 1500
124 Ga0157376_10246670 3300014969 Bacteria 1666
125 Ga0157376_11897780 3300014969 Unclassified 633
126 Ga0182006_1086180 3300015261 Bacteria 1137
127 Ga0182007_10177451 3300015262 Bacteria 735
128 Ga0163161_11032194 3300017792 Bacteria 703
129 Ga0213876_10174097 3300021384 Bacteria 1145
130 Ga0209674_100003 3300025226 Bacteria 2196646
131 Ga0209672_100049 3300025228 Bacteria 238787
132 Ga0209563_100017 3300025230 Bacteria 796449
133 Ga0209563_100051 3300025230 Bacteria 340545
134 Ga0209258_100087 3300025242 Bacteria 238787
135 Ga0209677_100135 3300025253 Bacteria 69251
136 Ga0209148_1000096 3300025254 Bacteria 238787
137 Ga0209455_1000088 3300025272 Bacteria 238787
138 Ga0207688_10047854 3300025901 Unclassified 2388
139 Ga0207647_10228321 3300025904 Bacteria 1071
140 Ga0207645_10043899 3300025907 Unclassified 2861
141 Ga0207645_10322631 3300025907 Bacteria 1030
142 Ga0207643_10076937 3300025908 Bacteria 1928
143 Ga0207705_10140422 3300025909 Bacteria 1804
144 Ga0207684_10254395 3300025910 Unclassified 1515
145 Ga0207654_11117660 3300025911 Bacteria 574
146 Ga0207707_10426832 3300025912 Bacteria 1136
147 Ga0207660_10167583 3300025917 Bacteria 1699
148 Ga0207662_11042537 3300025918 Bacteria 581
149 Ga0207657_10676832 3300025919 Archaea 802
150 Ga0207652_10219103 3300025921 Bacteria 1715
151 Ga0207646_10047620 3300025922 Unclassified 3845
152 Ga0207681_10054764 3300025923 Bacteria 2714
153 Ga0207681_10544496 3300025923 Bacteria 954
154 Ga0207694_10596828 3300025924 Bacteria 928
155 Ga0207650_10000694 3300025925 Bacteria 26312
156 Ga0207650_10606606 3300025925 Archaea 921
157 Ga0207650_11101680 3300025925 Unclassified 676
158 Ga0207687_10430583 3300025927 Bacteria 1090
159 Ga0207664_10001851 3300025929 Bacteria 13957
160 Ga0207690_10271814 3300025932 Bacteria 1317
161 Ga0207706_10003427 3300025933 Bacteria 15141
162 Ga0207686_10192283 3300025934 Bacteria 1455
163 Ga0207686_10196178 3300025934 Bacteria 1443
164 Ga0207709_10476703 3300025935 Bacteria 969
165 Ga0207670_10045909 3300025936 Unclassified 2899
166 Ga0207670_10768765 3300025936 Bacteria 801
167 Ga0207704_10317842 3300025938 Unclassified 1200
168 Ga0207704_10437064 3300025938 Bacteria 1041
169 Ga0207691_11017473 3300025940 Unclassified 691
170 Ga0207689_10095192 3300025942 Bacteria 2445
171 Ga0207679_10854548 3300025945 Archaea 831
172 Ga0207667_10348525 3300025949 Bacteria 1510
173 Ga0207651_10359902 3300025960 Bacteria 1228
174 Ga0207712_10025598 3300025961 Unclassified 3922
175 Ga0207712_10824888 3300025961 Bacteria 816
176 Ga0207668_10097778 3300025972 Bacteria 2173
177 Ga0207703_10488237 3300026035 Bacteria 1155
178 Ga0207703_10596001 3300026035 Bacteria 1045
179 Ga0207708_10386004 3300026075 Unclassified 1156
180 Ga0207702_10002786 3300026078 Bacteria 16383
181 Ga0207702_10051964 3300026078 Bacteria 3465
182 Ga0207702_12296099 3300026078 Bacteria 527
183 Ga0207641_10040023 3300026088 Bacteria 3921
184 Ga0207641_10831062 3300026088 Unclassified 915
185 Ga0207648_10057742 3300026089 Bacteria 3386
186 Ga0207676_10699341 3300026095 Bacteria 982
187 Ga0207674_10084847 3300026116 Unclassified 3164
188 Ga0207675_100003666 3300026118 Bacteria 14982
189 Ga0207675_100120654 3300026118 Bacteria 2480
190 Ga0207675_100780683 3300026118 Bacteria 968
191 Ga0207683_10188274 3300026121 Bacteria 1873
192 Ga0207683_10262249 3300026121 Bacteria 1578
193 Ga0207683_10269038 3300026121 Bacteria 1557
194 Ga0207698_10095324 3300026142 Bacteria 2449
195 Ga0268266_10040229 3300028379 Bacteria 3984
196 Ga0268265_10040527 3300028380 Unclassified 3440
197 Ga0268265_10352953 3300028380 Bacteria 1343
198 Ga0268264_11063144 3300028381 Bacteria 817
199 Ga0307511_10008761 3300030521 Bacteria 10111
200 Ga0265760_10035692 3300031090 Bacteria 1473
201 Ga0265320_10125409 3300031240 Bacteria 1168
202 Ga0265327_10001223 3300031251 Bacteria 34532
203 Ga0307408_100215963 3300031548 Bacteria 1562
204 Ga0307409_100198529 3300031995 Unclassified 1792
205 Ga0307409_100747854 3300031995 Bacteria 981
206 Ga0307416_100952994 3300032002 Bacteria 960
207 Ga0373948_0039693 3300034817 Bacteria 981
208 Ga0373941_0031312 3300035115 Bacteria 1584
209 Ga0373945_0298856 3300035116 Bacteria 689
210 Ga0373935_0792801 3300035692 Bacteria 699
211 Ga0373927_0078577 3300035695 Bacteria 2137
212 Ga0373927_1188021 3300035695 Bacteria 503
213 Ga0373947_0064458 3300035725 Bacteria 2234
214 Ga0373925_0099386 3300037068 Bacteria 2235
215 Ga0395905_0527290 3300037471 Bacteria 1082
216 Ga0395901_0601564 3300038443 Bacteria 1109
217 Ga0436365_1152120 3300039437 Bacteria 1722
218 Ga0450896_047634 3300042133 Bacteria 678
219 Ga0451577_0361481 3300042876 Unclassified 1317
220 Ga0466969_0030829 3300044656 Bacteria 2731
221 Ga0466966_0071633 3300044684 Unclassified 2171
222 Ga0466959_0464596 3300045049 Bacteria 857
223 Ga0451576_0167888 3300045051 Bacteria 2290
224 Ga0451576_0688665 3300045051 Unclassified 1074
225 Ga0495591_015427 3300046458 Bacteria 2699
226 Ga0495638_0136307 3300046460 Bacteria 1437
227 Ga0495653_0329678 3300046463 Bacteria 987
228 Ga0495650_0018561 3300046471 Bacteria 3451
229 Ga0495580_0326109 3300046472 Unclassified 1043
230 Ga0495580_0837344 3300046472 Bacteria 595
231 Ga0495594_0394418 3300046499 Unclassified 788
232 Ga0495632_0428229 3300046519 Bacteria 576
233 Ga0495644_0004714 3300046523 Bacteria 5360
234 Ga0495663_0108255 3300046525 Unclassified 921
235 Ga0495640_0400957 3300046533 Bacteria 842
236 Ga0495598_0226512 3300046537 Bacteria 684
237 Ga0495621_0000128 3300046539 Bacteria 16189
238 Ga0495621_0549522 3300046539 Bacteria 502
239 Ga0495597_0000987 3300046542 Bacteria 21897
240 Ga0495656_0019197 3300046615 Viruses 2637
241 Ga0495647_0000873 3300046681 Bacteria 9018
242 Ga0495671_0041417 3300046692 Viruses 2319
243 Ga0495671_0319711 3300046692 Bacteria 745
244 Ga0495649_0008742 3300046694 Bacteria 6077
245 Ga0495649_0114128 3300046694 Unclassified 1431
246 Ga0495681_0011330 3300047470 Bacteria 5317
247 Ga0495615_0071766 3300048090 Unclassified 934
248 Ga0496100_0096521 3300048903 Bacteria 2028
249 Ga0496101_0085913 3300048904 Bacteria 2332
250 Ga0496102_0081363 3300048905 Bacteria 2986
251 Ga0496105_0011928 3300048908 Bacteria 6882
252 Ga0496106_0023988 3300048909 Bacteria 4533
253 Ga0496107_0034676 3300048910 Unclassified 3615
254 Ga0496108_0005708 3300048911 Bacteria 10075
255 Ga0496109_0008725 3300048912 Bacteria 8630
256 Ga0496110_0032484 3300048913 Bacteria 4508
257 Ga0496114_0021721 3300048917 Bacteria 5224
258 Ga0496121_0008021 3300048924 Bacteria 12594
259 Ga0501031_0005728 3300049568 Bacteria 8099
260 Ga0501032_0086129 3300049569 Bacteria 2088
261 Ga0501033_0003775 3300049570 Bacteria 12311
262 Ga0501034_0000109 3300049571 Bacteria 151550
263 Ga0501034_0001175 3300049571 Bacteria 36278
264 Ga0501036_0001841 3300049572 Bacteria 16451
265 Ga0501037_0002090 3300049573 Bacteria 14474
266 Ga0501037_0180481 3300049573 Bacteria 1498
267 Ga0501038_0047242 3300049574 Bacteria 3729
268 Ga0501039_0057583 3300049575 Bacteria 3009
269 Ga0501040_0025649 3300049576 Bacteria 3964
270 Ga0501041_0012099 3300049577 Bacteria 5108
271 Ga0501042_0001476 3300049578 Bacteria 13871
272 Ga0501043_0081675 3300049579 Bacteria 2540
273 Ga0501046_0012196 3300049580 Bacteria 7324
274 Ga0501048_0050511 3300049582 Bacteria 2961
275 Ga0501067_0003604 3300049583 Bacteria 8528
276 Ga0501068_0004247 3300049584 Bacteria 7776
277 Ga0501068_0005048 3300049584 Bacteria 7190
278 Ga0501069_0182519 3300049585 Unclassified 1213
279 Ga0501070_0010759 3300049586 Bacteria 7732
280 Ga0501070_0133616 3300049586 Bacteria 2049
281 Ga0501071_0003099 3300049587 Bacteria 10316
282 Ga0501071_0457487 3300049587 Bacteria 977
283 Ga0501072_0056099 3300049588 Bacteria 3104
284 Ga0501073_0004433 3300049589 Bacteria 10545
285 Ga0501074_0002228 3300049590 Bacteria 13449
286 Ga0501075_0004218 3300049591 Bacteria 9710
287 Ga0501076_0081046 3300049592 Bacteria 2605
288 Ga0501076_1046102 3300049592 Bacteria 672
289 Ga0501077_0015074 3300049593 Unclassified 4860
290 Ga0501077_0029680 3300049593 Bacteria 3477
291 Ga0501079_0007982 3300049741 Bacteria 8021
292 Ga0501080_0008278 3300049742 Bacteria 9420
293 Ga0501080_0048868 3300049742 Bacteria 3936
294 Ga0501081_0046358 3300049743 Bacteria 2987
295 Ga0501083_0043215 3300049744 Bacteria 3053
296 Ga0501083_0138140 3300049744 Unclassified 1596
297 Ga0501035_0050352 3300049822 Bacteria 3733
298 Ga0501044_0056488 3300049823 Bacteria 4031
299 Ga0501044_0066505 3300049823 Bacteria 3675
300 Ga0501045_0030644 3300049824 Bacteria 3893
301 nmdc:mga03n38_556419_c1 3300050490 Bacteria 649
302 nmdc:mga0yw44_620891_c1 3300050492 Bacteria 734
303 nmdc:mga07m45_110971_c1 3300050496 Bacteria 1580
304 nmdc:mga07m45_112679_c1 3300050496 Bacteria 1568
305 nmdc:mga05p37_7761_c1 3300050507 Bacteria 12667
306 nmdc:mga09592_328_c1 3300050508 Bacteria 34777
307 nmdc:mga08y16_451579_c1 3300050511 Bacteria 1311
308 nmdc:mga0sz30_327240_c1 3300050516 Bacteria 684
309 Ga0500646_0077437 3300053090 Bacteria 1009
310 Ga0500583_0113606 3300053092 Unclassified 1336
311 Ga0500573_0032085 3300053140 Bacteria 3031
312 Ga0500616_0038427 3300053153 Bacteria 2585
313 Ga0500616_0106060 3300053153 Bacteria 1365
314 Ga0500645_187994 3300053730 Bacteria 560
315 Ga0501084_0057500 3300054114 Bacteria 3254
316 Ga0501084_0063892 3300054114 Unclassified 3082
317 Ga0590074_018774 3300059423 Bacteria 1184
318 Ga0590075_068338 3300059424 Unclassified 917
319 Ga0501082_0005007 3300060353 Bacteria 11564
320 Ga0501082_0013856 3300060353 Bacteria 6932
321 Ga0501082_1483990 3300060353 Bacteria 592
322 Ga0530510_0002505 3300061734 Bacteria 12623
323 Ga0530510_1587878 3300061734 Unclassified 502

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0078577 Ga0373927_0078577_147_476 109
2 3300045051 Ga0451576_0167888 Ga0451576_0167888_831_1160 109
3 3300061734 Ga0530510_1587878 Ga0530510_1587878_75_443 122
4 3300025934 Ga0207686_10196178 Ga0207686_101961782 128
5 3300005435 Ga0070714_100001345 Ga0070714_1000013458 129
6 3300014497 Ga0182008_10006894 Ga0182008_100068944 129
7 3300015261 Ga0182006_1086180 Ga0182006_10861802 129
8 3300015262 Ga0182007_10177451 Ga0182007_101774511 129
9 3300025929 Ga0207664_10001851 Ga0207664_100018518 129
10 3300005467 Ga0070706_100034608 Ga0070706_1000346082 130
11 3300005468 Ga0070707_100115519 Ga0070707_1001155194 130
12 3300005536 Ga0070697_100056997 Ga0070697_1000569973 130
13 3300025910 Ga0207684_10254395 Ga0207684_102543952 130
14 3300025922 Ga0207646_10047620 Ga0207646_100476205 130
15 3300025909 Ga0207705_10140422 Ga0207705_101404222 131
16 3300045051 Ga0451576_0688665 Ga0451576_0688665_337_735 131
17 3300046471 Ga0495650_0018561 Ga0495650_0018561_2254_2649 131
18 3300046519 Ga0495632_0428229 Ga0495632_0428229_51_446 131
19 iso_pu_bacteria 2508501122 2509110861 131
20 iso_pu_bacteria 2585427634 2585999430 131
21 iso_pu_bacteria 8002285264 8002289334 131
22 3300046499 Ga0495594_0394418 Ga0495594_0394418_98_496 132
23 3300049568 Ga0501031_0005728 Ga0501031_0005728_5289_5696 132
24 3300049569 Ga0501032_0086129 Ga0501032_0086129_83_490 132
25 3300049570 Ga0501033_0003775 Ga0501033_0003775_93_500 132
26 3300049572 Ga0501036_0001841 Ga0501036_0001841_2840_3247 132
27 3300049573 Ga0501037_0002090 Ga0501037_0002090_11322_11729 132
28 3300049574 Ga0501038_0047242 Ga0501038_0047242_1026_1433 132
29 3300049575 Ga0501039_0057583 Ga0501039_0057583_1075_1482 132
30 3300049576 Ga0501040_0025649 Ga0501040_0025649_757_1164 132
31 3300049577 Ga0501041_0012099 Ga0501041_0012099_2755_3162 132
32 3300049578 Ga0501042_0001476 Ga0501042_0001476_9923_10330 132
33 3300049579 Ga0501043_0081675 Ga0501043_0081675_1345_1752 132
34 3300049580 Ga0501046_0012196 Ga0501046_0012196_5064_5471 132
35 3300049582 Ga0501048_0050511 Ga0501048_0050511_1411_1818 132
36 3300049584 Ga0501068_0004247 Ga0501068_0004247_4533_4940 132
37 3300049585 Ga0501069_0182519 Ga0501069_0182519_702_1109 132
38 3300049586 Ga0501070_0010759 Ga0501070_0010759_4484_4891 132
39 3300049587 Ga0501071_0003099 Ga0501071_0003099_2722_3129 132
40 3300049588 Ga0501072_0056099 Ga0501072_0056099_1353_1760 132
41 3300049590 Ga0501074_0002228 Ga0501074_0002228_12119_12526 132
42 3300049591 Ga0501075_0004218 Ga0501075_0004218_9100_9507 132
43 3300049592 Ga0501076_0081046 Ga0501076_0081046_2123_2530 132
44 3300049593 Ga0501077_0029680 Ga0501077_0029680_1817_2224 132
45 3300049741 Ga0501079_0007982 Ga0501079_0007982_5697_6104 132
46 3300049742 Ga0501080_0048868 Ga0501080_0048868_2044_2451 132
47 3300049743 Ga0501081_0046358 Ga0501081_0046358_1919_2326 132
48 3300049744 Ga0501083_0043215 Ga0501083_0043215_1006_1413 132
49 3300049822 Ga0501035_0050352 Ga0501035_0050352_2617_3024 132
50 3300049823 Ga0501044_0056488 Ga0501044_0056488_203_610 132
51 3300049824 Ga0501045_0030644 Ga0501045_0030644_2125_2532 132
52 3300054114 Ga0501084_0057500 Ga0501084_0057500_1203_1610 132
53 3300060353 Ga0501082_0013856 Ga0501082_0013856_5433_5840 132
54 3300061734 Ga0530510_0002505 Ga0530510_0002505_9263_9670 132
55 3300032002 Ga0307416_100952994 Ga0307416_1009529941 133
56 3300046472 Ga0495580_0326109 Ga0495580_0326109_163_564 133
57 3300046681 Ga0495647_0000873 Ga0495647_0000873_4444_4845 133
58 3300048924 Ga0496121_0008021 Ga0496121_0008021_3574_3975 133
59 3300059423 Ga0590074_018774 Ga0590074_018774_102_506 133
60 3300059424 Ga0590075_068338 Ga0590075_068338_348_752 133
61 3300003759 Ga0055525_1000164 Ga0055525_100016414 134
62 3300003760 Ga0055527_1000061 Ga0055527_100006138 134
63 3300003760 Ga0055527_1000065 Ga0055527_100006515 134
64 3300003761 Ga0055535_1000195 Ga0055535_100019514 134
65 3300003761 Ga0055535_1000197 Ga0055535_100019712 134
66 3300003762 Ga0055542_1000097 Ga0055542_100009739 134
67 3300003762 Ga0055542_1000140 Ga0055542_100014014 134
68 3300003763 Ga0055529_1000157 Ga0055529_100015739 134
69 3300003763 Ga0055529_1000269 Ga0055529_100026948 134
70 3300005295 Ga0065707_10107107 Ga0065707_101071075 134
71 3300005336 Ga0070680_100871738 Ga0070680_1008717382 134
72 3300005339 Ga0070660_100770581 Ga0070660_1007705812 134
73 3300005340 Ga0070689_101120637 Ga0070689_1011206372 134
74 3300005340 Ga0070689_101228599 Ga0070689_1012285991 134
75 3300005343 Ga0070687_100510630 Ga0070687_1005106302 134
76 3300005347 Ga0070668_100018304 Ga0070668_1000183042 134
77 3300005353 Ga0070669_100002170 Ga0070669_10000217015 134
78 3300005354 Ga0070675_100216385 Ga0070675_1002163853 134
79 3300005441 Ga0070700_100224380 Ga0070700_1002243802 134
80 3300005444 Ga0070694_100231762 Ga0070694_1002317622 134
81 3300005456 Ga0070678_100215281 Ga0070678_1002152812 134
82 3300005457 Ga0070662_100009449 Ga0070662_1000094495 134
83 3300005458 Ga0070681_10020881 Ga0070681_100208814 134
84 3300005458 Ga0070681_11221172 Ga0070681_112211721 134
85 3300005530 Ga0070679_100175051 Ga0070679_1001750512 134
86 3300005577 Ga0068857_100093722 Ga0068857_1000937224 134
87 3300005614 Ga0068856_100010471 Ga0068856_1000104712 134
88 3300005616 Ga0068852_101523418 Ga0068852_1015234181 134
89 3300005718 Ga0068866_10379358 Ga0068866_103793581 134
90 3300005719 Ga0068861_100001539 Ga0068861_10000153918 134
91 3300005844 Ga0068862_100000292 Ga0068862_10000029252 134
92 3300005844 Ga0068862_100200082 Ga0068862_1002000822 134
93 3300006844 Ga0075428_100016435 Ga0075428_10001643510 134
94 3300006844 Ga0075428_100161703 Ga0075428_1001617032 134
95 3300006846 Ga0075430_100602097 Ga0075430_1006020972 134
96 3300006871 Ga0075434_100325586 Ga0075434_1003255863 134
97 3300006880 Ga0075429_100000901 Ga0075429_1000009014 134
98 3300006881 Ga0068865_100268688 Ga0068865_1002686882 134
99 3300009147 Ga0114129_10078504 Ga0114129_100785045 134
100 3300009553 Ga0105249_10765708 Ga0105249_107657082 134
101 3300011119 Ga0105246_10801123 Ga0105246_108011232 134
102 3300021384 Ga0213876_10174097 Ga0213876_101740972 134
103 3300025228 Ga0209672_100049 Ga0209672_100049138 134
104 3300025230 Ga0209563_100051 Ga0209563_100051137 134
105 3300025242 Ga0209258_100087 Ga0209258_100087138 134
106 3300025254 Ga0209148_1000096 Ga0209148_1000096138 134
107 3300025272 Ga0209455_1000088 Ga0209455_1000088138 134
108 3300025901 Ga0207688_10047854 Ga0207688_100478542 134
109 3300025907 Ga0207645_10043899 Ga0207645_100438992 134
110 3300025912 Ga0207707_10426832 Ga0207707_104268322 134
111 3300025917 Ga0207660_10167583 Ga0207660_101675832 134
112 3300025918 Ga0207662_11042537 Ga0207662_110425372 134
113 3300025919 Ga0207657_10676832 Ga0207657_106768322 134
114 3300025921 Ga0207652_10219103 Ga0207652_102191032 134
115 3300025923 Ga0207681_10054764 Ga0207681_100547643 134
116 3300025925 Ga0207650_10606606 Ga0207650_106066062 134
117 3300025925 Ga0207650_11101680 Ga0207650_111016802 134
118 3300025932 Ga0207690_10271814 Ga0207690_102718142 134
119 3300025933 Ga0207706_10003427 Ga0207706_1000342711 134
120 3300025935 Ga0207709_10476703 Ga0207709_104767032 134
121 3300025936 Ga0207670_10768765 Ga0207670_107687652 134
122 3300025938 Ga0207704_10317842 Ga0207704_103178422 134
123 3300025940 Ga0207691_11017473 Ga0207691_110174731 134
124 3300025945 Ga0207679_10854548 Ga0207679_108545482 134
125 3300025961 Ga0207712_10025598 Ga0207712_100255983 134
126 3300025961 Ga0207712_10824888 Ga0207712_108248882 134
127 3300025972 Ga0207668_10097778 Ga0207668_100977782 134
128 3300026075 Ga0207708_10386004 Ga0207708_103860042 134
129 3300026078 Ga0207702_10002786 Ga0207702_1000278611 134
130 3300026088 Ga0207641_10831062 Ga0207641_108310622 134
131 3300026116 Ga0207674_10084847 Ga0207674_100848472 134
132 3300026118 Ga0207675_100003666 Ga0207675_10000366618 134
133 3300026121 Ga0207683_10262249 Ga0207683_102622492 134
134 3300026121 Ga0207683_10269038 Ga0207683_102690382 134
135 3300028380 Ga0268265_10040527 Ga0268265_100405272 134
136 3300030521 Ga0307511_10008761 Ga0307511_100087617 134
137 3300031240 Ga0265320_10125409 Ga0265320_101254092 134
138 3300031548 Ga0307408_100215963 Ga0307408_1002159632 134
139 3300031995 Ga0307409_100198529 Ga0307409_1001985292 134
140 3300031995 Ga0307409_100747854 Ga0307409_1007478541 134
141 3300039437 Ga0436365_1152120 Ga0436365_1152120_855_1259 134
142 3300046458 Ga0495591_015427 Ga0495591_015427_1236_1640 134
143 3300046523 Ga0495644_0004714 Ga0495644_0004714_3284_3688 134
144 3300046525 Ga0495663_0108255 Ga0495663_0108255_89_493 134
145 3300046539 Ga0495621_0000128 Ga0495621_0000128_13766_14170 134
146 3300046542 Ga0495597_0000987 Ga0495597_0000987_18270_18674 134
147 3300046615 Ga0495656_0019197 Ga0495656_0019197_1794_2198 134
148 3300046692 Ga0495671_0041417 Ga0495671_0041417_781_1185 134
149 3300046692 Ga0495671_0319711 Ga0495671_0319711_209_613 134
150 3300046694 Ga0495649_0114128 Ga0495649_0114128_664_1068 134
151 3300047470 Ga0495681_0011330 Ga0495681_0011330_667_1071 134
152 3300048090 Ga0495615_0071766 Ga0495615_0071766_356_760 134
153 3300049587 Ga0501071_0457487 Ga0501071_0457487_113_517 134
154 3300050507 nmdc:mga05p37_7761_c1 nmdc:mga05p37_7761_c1_2141_2545 134
155 3300050508 nmdc:mga09592_328_c1 nmdc:mga09592_328_c1_32212_32616 134
156 3300060353 Ga0501082_1483990 Ga0501082_1483990_35_439 134
157 3300005328 Ga0070676_10067131 Ga0070676_100671312 135
158 3300005355 Ga0070671_100968153 Ga0070671_1009681532 135
159 3300005365 Ga0070688_100663547 Ga0070688_1006635472 135
160 3300005365 Ga0070688_101298967 Ga0070688_1012989671 135
161 3300005456 Ga0070678_100987245 Ga0070678_1009872451 135
162 3300005459 Ga0068867_100118910 Ga0068867_1001189103 135
163 3300005548 Ga0070665_100036795 Ga0070665_1000367954 135
164 3300005577 Ga0068857_100596396 Ga0068857_1005963962 135
165 3300005614 Ga0068856_100142358 Ga0068856_1001423584 135
166 3300005618 Ga0068864_100294799 Ga0068864_1002947992 135
167 3300005719 Ga0068861_100800175 Ga0068861_1008001752 135
168 3300005840 Ga0068870_10068839 Ga0068870_100688392 135
169 3300005841 Ga0068863_100040586 Ga0068863_1000405866 135
170 3300005844 Ga0068862_100370173 Ga0068862_1003701733 135
171 3300006177 Ga0075362_10123151 Ga0075362_101231512 135
172 3300006195 Ga0075366_10748072 Ga0075366_107480722 135
173 3300006353 Ga0075370_10089065 Ga0075370_100890652 135
174 3300009098 Ga0105245_10308459 Ga0105245_103084592 135
175 3300009098 Ga0105245_10580238 Ga0105245_105802381 135
176 3300009148 Ga0105243_10118645 Ga0105243_101186452 135
177 3300009148 Ga0105243_12240502 Ga0105243_122405021 135
178 3300009176 Ga0105242_10362520 Ga0105242_103625201 135
179 3300009176 Ga0105242_11725369 Ga0105242_117253691 135
180 3300014325 Ga0163163_11159775 Ga0163163_111597751 135
181 3300025907 Ga0207645_10322631 Ga0207645_103226311 135
182 3300025908 Ga0207643_10076937 Ga0207643_100769372 135
183 3300025927 Ga0207687_10430583 Ga0207687_104305831 135
184 3300025942 Ga0207689_10095192 Ga0207689_100951922 135
185 3300026035 Ga0207703_10488237 Ga0207703_104882372 135
186 3300026078 Ga0207702_10051964 Ga0207702_100519643 135
187 3300026088 Ga0207641_10040023 Ga0207641_100400236 135
188 3300026089 Ga0207648_10057742 Ga0207648_100577422 135
189 3300026095 Ga0207676_10699341 Ga0207676_106993412 135
190 3300026118 Ga0207675_100780683 Ga0207675_1007806832 135
191 3300028379 Ga0268266_10040229 Ga0268266_100402292 135
192 3300035115 Ga0373941_0031312 Ga0373941_0031312_644_1057 135
193 3300035692 Ga0373935_0792801 Ga0373935_0792801_120_527 135
194 3300035725 Ga0373947_0064458 Ga0373947_0064458_432_839 135
195 3300037471 Ga0395905_0527290 Ga0395905_0527290_75_488 135
196 3300038443 Ga0395901_0601564 Ga0395901_0601564_459_872 135
197 3300042133 Ga0450896_047634 Ga0450896_047634_143_550 135
198 3300042876 Ga0451577_0361481 Ga0451577_0361481_531_938 135
199 3300044656 Ga0466969_0030829 Ga0466969_0030829_2170_2577 135
200 3300044684 Ga0466966_0071633 Ga0466966_0071633_882_1289 135
201 3300045049 Ga0466959_0464596 Ga0466959_0464596_164_571 135
202 3300046460 Ga0495638_0136307 Ga0495638_0136307_1019_1426 135
203 3300046463 Ga0495653_0329678 Ga0495653_0329678_253_660 135
204 3300046533 Ga0495640_0400957 Ga0495640_0400957_301_708 135
205 3300049571 Ga0501034_0000109 Ga0501034_0000109_30580_30993 135
206 3300049571 Ga0501034_0001175 Ga0501034_0001175_19022_19435 135
207 3300049573 Ga0501037_0180481 Ga0501037_0180481_63_476 135
208 3300049584 Ga0501068_0005048 Ga0501068_0005048_1904_2317 135
209 3300049586 Ga0501070_0133616 Ga0501070_0133616_195_608 135
210 3300049823 Ga0501044_0066505 Ga0501044_0066505_485_898 135
211 3300050490 nmdc:mga03n38_556419_c1 nmdc:mga03n38_556419_c1_87_494 135
212 3300050492 nmdc:mga0yw44_620891_c1 nmdc:mga0yw44_620891_c1_216_623 135
213 3300050496 nmdc:mga07m45_110971_c1 nmdc:mga07m45_110971_c1_905_1312 135
214 3300050496 nmdc:mga07m45_112679_c1 nmdc:mga07m45_112679_c1_276_683 135
215 3300050516 nmdc:mga0sz30_327240_c1 nmdc:mga0sz30_327240_c1_264_671 135
216 3300053140 Ga0500573_0032085 Ga0500573_0032085_1137_1544 135
217 3300053153 Ga0500616_0038427 Ga0500616_0038427_1185_1592 135
218 3300053153 Ga0500616_0106060 Ga0500616_0106060_790_1197 135
219 3300053730 Ga0500645_187994 Ga0500645_187994_58_465 135
220 3300002076 JGI24749J21850_1019237 JGI24749J21850_10192372 136
221 3300002459 JGI24751J29686_10002265 JGI24751J29686_100022655 136
222 3300005288 Ga0065714_10131555 Ga0065714_101315552 136
223 3300005290 Ga0065712_10006332 Ga0065712_100063323 136
224 3300005293 Ga0065715_10109848 Ga0065715_101098482 136
225 3300005563 Ga0068855_100371098 Ga0068855_1003710982 136
226 3300005840 Ga0068870_10002423 Ga0068870_1000242316 136
227 3300005841 Ga0068863_100808615 Ga0068863_1008086152 136
228 3300005843 Ga0068860_100327398 Ga0068860_1003273983 136
229 3300005844 Ga0068862_100120450 Ga0068862_1001204502 136
230 3300006880 Ga0075429_100543487 Ga0075429_1005434872 136
231 3300006881 Ga0068865_100044269 Ga0068865_1000442696 136
232 3300025904 Ga0207647_10228321 Ga0207647_102283212 136
233 3300025911 Ga0207654_11117660 Ga0207654_111176601 136
234 3300025924 Ga0207694_10596828 Ga0207694_105968282 136
235 3300025925 Ga0207650_10000694 Ga0207650_100006945 136
236 3300025934 Ga0207686_10192283 Ga0207686_101922832 136
237 3300025949 Ga0207667_10348525 Ga0207667_103485252 136
238 3300026078 Ga0207702_12296099 Ga0207702_122960991 136
239 3300026121 Ga0207683_10188274 Ga0207683_101882742 136
240 3300031090 Ga0265760_10035692 Ga0265760_100356922 136
241 3300005617 Ga0068859_100917901 Ga0068859_1009179012 137
242 3300006931 Ga0097620_100917997 Ga0097620_1009179972 137
243 3300009177 Ga0105248_11499650 Ga0105248_114996501 137
244 3300009177 Ga0105248_12295618 Ga0105248_122956182 137
245 3300011119 Ga0105246_11482270 Ga0105246_114822701 137
246 3300014969 Ga0157376_11897780 Ga0157376_118977801 137
247 3300026035 Ga0207703_10596001 Ga0207703_105960012 137
248 3300031251 Ga0265327_10001223 Ga0265327_1000122325 137
249 3300046694 Ga0495649_0008742 Ga0495649_0008742_5530_5946 138
250 3300003316 rootH1_10011795 rootH1_100117953 139
251 3300003316 rootH1_10015006 rootH1_100150062 139
252 3300003322 rootL2_10128957 rootL2_101289574 139
253 3300003323 rootH1_10003971 rootH1_100039718 139
254 3300003752 Ga0055539_1000366 Ga0055539_100036611 139
255 3300003756 Ga0055533_1000100 Ga0055533_100010013 139
256 3300003759 Ga0055525_1000877 Ga0055525_10008779 139
257 3300005338 Ga0068868_100539281 Ga0068868_1005392812 139
258 3300005364 Ga0070673_100382439 Ga0070673_1003824392 139
259 3300005719 Ga0068861_100172793 Ga0068861_1001727932 139
260 3300009093 Ga0105240_10258484 Ga0105240_102584843 139
261 3300009545 Ga0105237_11822966 Ga0105237_118229662 139
262 3300009553 Ga0105249_12791471 Ga0105249_127914711 139
263 3300013297 Ga0157378_10722124 Ga0157378_107221242 139
264 3300014325 Ga0163163_12321520 Ga0163163_123215202 139
265 3300025226 Ga0209674_100003 Ga0209674_1000031872 139
266 3300025230 Ga0209563_100017 Ga0209563_10001798 139
267 3300025253 Ga0209677_100135 Ga0209677_10013541 139
268 3300025960 Ga0207651_10359902 Ga0207651_103599023 139
269 3300026118 Ga0207675_100120654 Ga0207675_1001206542 139
270 3300028381 Ga0268264_11063144 Ga0268264_110631442 139
271 3300049583 Ga0501067_0003604 Ga0501067_0003604_5855_6274 139
272 3300049589 Ga0501073_0004433 Ga0501073_0004433_2231_2650 139
273 3300049592 Ga0501076_1046102 Ga0501076_1046102_10_429 139
274 3300049593 Ga0501077_0015074 Ga0501077_0015074_2202_2621 139
275 3300049742 Ga0501080_0008278 Ga0501080_0008278_3100_3519 139
276 3300049744 Ga0501083_0138140 Ga0501083_0138140_268_687 139
277 3300054114 Ga0501084_0063892 Ga0501084_0063892_1269_1688 139
278 3300060353 Ga0501082_0005007 Ga0501082_0005007_1253_1672 139
279 3300009545 Ga0105237_10133495 Ga0105237_101334952 140
280 3300053090 Ga0500646_0077437 Ga0500646_0077437_374_799 140
281 3300053092 Ga0500583_0113606 Ga0500583_0113606_771_1196 140
282 2162886011 MRS1b_contig_6058718 MRS1b_0669.00002520 141
283 3300005548 Ga0070665_100294068 Ga0070665_1002940682 141
284 3300005616 Ga0068852_100123351 Ga0068852_1001233512 141
285 3300005841 Ga0068863_100669080 Ga0068863_1006690802 141
286 3300006237 Ga0097621_100585536 Ga0097621_1005855362 141
287 3300009094 Ga0111539_10029717 Ga0111539_1002971710 141
288 3300009148 Ga0105243_10033528 Ga0105243_100335286 141
289 3300009174 Ga0105241_10621646 Ga0105241_106216462 141
290 3300009176 Ga0105242_10031924 Ga0105242_100319247 141
291 3300009551 Ga0105238_10966103 Ga0105238_109661032 141
292 3300009553 Ga0105249_10105904 Ga0105249_101059043 141
293 3300010375 Ga0105239_11033065 Ga0105239_110330651 141
294 3300013296 Ga0157374_10060337 Ga0157374_100603377 141
295 3300013297 Ga0157378_10201718 Ga0157378_102017182 141
296 3300013307 Ga0157372_10833456 Ga0157372_108334562 141
297 3300013308 Ga0157375_10218434 Ga0157375_102184342 141
298 3300014325 Ga0163163_10145877 Ga0163163_101458775 141
299 3300014745 Ga0157377_10000595 Ga0157377_100005952 141
300 3300014968 Ga0157379_10286072 Ga0157379_102860722 141
301 3300014969 Ga0157376_10246670 Ga0157376_102466703 141
302 3300017792 Ga0163161_11032194 Ga0163161_110321942 141
303 3300025923 Ga0207681_10544496 Ga0207681_105444962 141
304 3300025936 Ga0207670_10045909 Ga0207670_100459093 141
305 3300025938 Ga0207704_10437064 Ga0207704_104370641 141
306 3300026142 Ga0207698_10095324 Ga0207698_100953243 141
307 3300028380 Ga0268265_10352953 Ga0268265_103529532 141
308 3300034817 Ga0373948_0039693 Ga0373948_0039693_31_456 141
309 3300035116 Ga0373945_0298856 Ga0373945_0298856_58_483 141
310 3300035695 Ga0373927_1188021 Ga0373927_1188021_61_486 141
311 3300037068 Ga0373925_0099386 Ga0373925_0099386_233_658 141
312 3300046472 Ga0495580_0837344 Ga0495580_0837344_57_482 141
313 3300046537 Ga0495598_0226512 Ga0495598_0226512_94_519 141
314 3300046539 Ga0495621_0549522 Ga0495621_0549522_37_462 141
315 3300048903 Ga0496100_0096521 Ga0496100_0096521_1192_1617 141
316 3300048904 Ga0496101_0085913 Ga0496101_0085913_1186_1611 141
317 3300048905 Ga0496102_0081363 Ga0496102_0081363_613_1038 141
318 3300048908 Ga0496105_0011928 Ga0496105_0011928_427_852 141
319 3300048909 Ga0496106_0023988 Ga0496106_0023988_2274_2699 141
320 3300048910 Ga0496107_0034676 Ga0496107_0034676_642_1067 141
321 3300048911 Ga0496108_0005708 Ga0496108_0005708_8535_8960 141
322 3300048912 Ga0496109_0008725 Ga0496109_0008725_6963_7388 141
323 3300048913 Ga0496110_0032484 Ga0496110_0032484_2557_2982 141
324 3300048917 Ga0496114_0021721 Ga0496114_0021721_4412_4837 141
325 3300050511 nmdc:mga08y16_451579_c1 nmdc:mga08y16_451579_c1_268_693 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

50

147

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.9158 6 141
4hr6-assembly1.cif.gz_B crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips 0.8704 59 92
5y42-assembly2.cif.gz_E native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina 0.8631 59 92
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8565 6 141
1bry-assembly2.cif.gz_Z bryodin type i rip 0.8408 59 89
ID Description Score Start End Superfamily
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8704 59 92 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8384 61 91 3.40.420.10
af_A0A1D8PM79_595_670_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8177 61 91 3.30.160.20
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8136 7 135 3.90.1590.10
af_C7IYE5_70_121_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.7993 61 86 3.30.160.60
ID Description Score Start End GO Terms
AF-A0A1G7TU73-F1-model_v4 Uncharacterized conserved protein 0.9942 6 140 GO:0016846
GO:0046872
AF-A0A1G7TU73-F1-model_v4 Uncharacterized conserved protein 0.9868 6 140 GO:0016846
GO:0046872
AF-A0A4U0GAE5-F1-model_v4 GFA family protein 0.9624 7 135 GO:0016846
GO:0046872
AF-A0A5J6N1S8-F1-model_v4 Aldehyde-activating protein 0.9591 7 140 GO:0016846
GO:0046872
AF-A0A3S0EWC4-F1-model_v4 deleted 0.9566 7 140

Feature Viewer

pLDDT pTM Quality
93.31 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map