F407675

General Info

Members Datasets Scaffolds Average Seq Length
325 190 650 256

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100001292|Ga0070682_1000012924
Length 283
Sequence VTGVPPTPTLLDPGGRFDTVGGMGVPGNFADRAPAGLADTELFAVDAYRTEFDARVVEVDREGGRLRLDRTAFYPTGGGQPHDTGTLAGPSGTLEVTGVRREGGVIWHSVVSAASTAGDALPDVGAEMGGQVDWARRFALMRTHTALHILCGVIWADHGIPVTGGNMEPLKGRLDFPFPAMSADLGAQVERRINDEIERAHEIVVDFLPRDVADADPALIRTAANLIPAVIDPLRIIDIVGLDRQADGGTHVLSTAEVGRVRVTGTESKGKDNKRIRLEVVDA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
123 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
124 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
125 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
126 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
190 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 8
Rhizosphere 84
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100001292 3300005337 Bacteria 14194
2 JGI24739J22299_10108226 3300001989 Bacteria 835
3 JGI24738J21930_10009476 3300002075 Bacteria 2191
4 JGI24744J21845_10002322 3300002077 Bacteria 3880
5 Ga0070683_100049424 3300005329 Bacteria 3890
6 Ga0070683_100488587 3300005329 Bacteria 1176
7 Ga0070682_100007988 3300005337 Bacteria 5954
8 Ga0070682_100195309 3300005337 Bacteria 1424
9 Ga0070682_100380869 3300005337 Bacteria 1061
10 Ga0070660_100125813 3300005339 Bacteria 2048
11 Ga0070660_100197534 3300005339 Bacteria 1631
12 Ga0070687_100020982 3300005343 Bacteria 3064
13 Ga0070687_100112174 3300005343 Bacteria 1545
14 Ga0070692_10001239 3300005345 Bacteria 9105
15 Ga0070668_100148157 3300005347 Bacteria 1896
16 Ga0070668_100497785 3300005347 Bacteria 1054
17 Ga0070668_100592306 3300005347 Bacteria 969
18 Ga0070674_100007435 3300005356 Bacteria 6462
19 Ga0070673_100145127 3300005364 Bacteria 2006
20 Ga0070688_100052744 3300005365 Bacteria 2541
21 Ga0070659_100053575 3300005366 Bacteria 3175
22 Ga0070659_100208390 3300005366 Bacteria 1610
23 Ga0070667_100414218 3300005367 Bacteria 1228
24 Ga0070714_100005644 3300005435 Bacteria 9573
25 Ga0070701_10003762 3300005438 Bacteria 6063
26 Ga0070700_100003680 3300005441 Bacteria 7925
27 Ga0070662_100032654 3300005457 Bacteria 3659
28 Ga0068867_100008968 3300005459 Bacteria 7056
29 Ga0068867_100156248 3300005459 Bacteria 1795
30 Ga0070684_100006642 3300005535 Bacteria 8961
31 Ga0070684_100273765 3300005535 Bacteria 1546
32 Ga0070684_100305376 3300005535 Bacteria 1460
33 Ga0070684_100612667 3300005535 Bacteria 1012
34 Ga0070672_100078749 3300005543 Bacteria 2637
35 Ga0070686_100186021 3300005544 Bacteria 1479
36 Ga0070693_100152331 3300005547 Bacteria 1466
37 Ga0070665_100686309 3300005548 Bacteria 1037
38 Ga0070664_100012248 3300005564 Bacteria 6969
39 Ga0070664_100062541 3300005564 Bacteria 3173
40 Ga0070664_100256131 3300005564 Bacteria 1574
41 Ga0068857_100303655 3300005577 Bacteria 1472
42 Ga0068854_100024025 3300005578 Bacteria 4168
43 Ga0070702_100011338 3300005615 Bacteria 4430
44 Ga0068852_100019163 3300005616 Bacteria 5408
45 Ga0068852_100465854 3300005616 Bacteria 1253
46 Ga0068861_100007046 3300005719 Bacteria 7686
47 Ga0068861_100314391 3300005719 Bacteria 1362
48 Ga0068870_10250300 3300005840 Bacteria 1098
49 Ga0068863_100085503 3300005841 Bacteria 2989
50 Ga0068858_100581258 3300005842 Bacteria 1086
51 Ga0068860_100009506 3300005843 Bacteria 9654
52 Ga0068860_100041956 3300005843 Bacteria 4372
53 Ga0068862_100200118 3300005844 Bacteria 1801
54 Ga0068862_100490813 3300005844 Bacteria 1164
55 Ga0070717_10297497 3300006028 Bacteria 1434
56 Ga0075365_10016987 3300006038 Bacteria 4443
57 Ga0075365_10065706 3300006038 Bacteria 2432
58 Ga0075365_10081440 3300006038 Bacteria 2193
59 Ga0075365_10081485 3300006038 Bacteria 2193
60 Ga0075365_10273815 3300006038 Bacteria 1187
61 Ga0075363_100024320 3300006048 Bacteria 3078
62 Ga0075364_10062778 3300006051 Bacteria 2438
63 Ga0075370_10007218 3300006353 Bacteria 5648
64 Ga0075370_10013420 3300006353 Bacteria 4354
65 Ga0075370_10320121 3300006353 Bacteria 924
66 Ga0075428_100318764 3300006844 Bacteria 1670
67 Ga0075428_100478109 3300006844 Bacteria 1333
68 Ga0075429_100045668 3300006880 Bacteria 3811
69 Ga0068865_100084533 3300006881 Bacteria 2287
70 Ga0111539_10208365 3300009094 Bacteria 2278
71 Ga0111539_10723390 3300009094 Bacteria 1159
72 Ga0105245_10008485 3300009098 Bacteria 8968
73 Ga0105245_10072522 3300009098 Bacteria 3128
74 Ga0105245_10288108 3300009098 Bacteria 1607
75 Ga0105245_10402279 3300009098 Bacteria 1369
76 Ga0105247_10359363 3300009101 Bacteria 1026
77 Ga0114129_10004945 3300009147 Bacteria 18794
78 Ga0105243_10004475 3300009148 Bacteria 11049
79 Ga0105242_10245280 3300009176 Bacteria 1612
80 Ga0105248_10048332 3300009177 Bacteria 4773
81 Ga0105248_10170962 3300009177 Bacteria 2449
82 Ga0105248_10218647 3300009177 Bacteria 2145
83 Ga0105248_10875207 3300009177 Unclassified 1014
84 Ga0105237_10071877 3300009545 Bacteria 3453
85 Ga0105238_10138331 3300009551 Bacteria 2413
86 Ga0105239_10004360 3300010375 Bacteria 16954
87 Ga0105239_10543625 3300010375 Bacteria 1323
88 Ga0105246_10002433 3300011119 Bacteria 11229
89 Ga0105246_10256813 3300011119 Bacteria 1390
90 Ga0157370_10162118 3300013104 Bacteria 2080
91 Ga0157370_10579656 3300013104 Bacteria 1028
92 Ga0157369_10046739 3300013105 Bacteria 4704
93 Ga0157374_10478239 3300013296 Bacteria 1249
94 Ga0163162_10322383 3300013306 Bacteria 1677
95 Ga0163162_10789733 3300013306 Bacteria 1067
96 Ga0157372_10001336 3300013307 Bacteria 26658
97 Ga0157372_10174380 3300013307 Bacteria 2489
98 Ga0157375_10040534 3300013308 Bacteria 4489
99 Ga0157375_10433483 3300013308 Bacteria 1480
100 Ga0163163_10052534 3300014325 Bacteria 4021
101 Ga0163163_10111500 3300014325 Bacteria 2764
102 Ga0163163_10145703 3300014325 Bacteria 2412
103 Ga0157380_10007502 3300014326 Bacteria 7745
104 Ga0157380_10335729 3300014326 Bacteria 1407
105 Ga0157377_10037985 3300014745 Bacteria 2656
106 Ga0157377_10187105 3300014745 Bacteria 1306
107 Ga0157377_10219530 3300014745 Bacteria 1216
108 Ga0157376_10597701 3300014969 Unclassified 1098
109 Ga0163161_10172328 3300017792 Bacteria 1655
110 Ga0163161_10203995 3300017792 Bacteria 1525
111 Ga0224712_10038899 3300022467 Bacteria 1780
112 Ga0207710_10213042 3300025900 Bacteria 957
113 Ga0207688_10013318 3300025901 Bacteria 4468
114 Ga0207643_10093564 3300025908 Bacteria 1755
115 Ga0207662_10008888 3300025918 Bacteria 5511
116 Ga0207649_10121619 3300025920 Bacteria 1761
117 Ga0207694_10091743 3300025924 Bacteria 2397
118 Ga0207687_10023607 3300025927 Bacteria 4102
119 Ga0207664_10021228 3300025929 Bacteria 4824
120 Ga0207664_10029616 3300025929 Bacteria 4172
121 Ga0207644_10394872 3300025931 Bacteria 1130
122 Ga0207690_10070305 3300025932 Bacteria 2411
123 Ga0207690_10361901 3300025932 Bacteria 1149
124 Ga0207706_10234222 3300025933 Bacteria 1606
125 Ga0207686_10208497 3300025934 Bacteria 1404
126 Ga0207709_10080855 3300025935 Bacteria 2094
127 Ga0207709_10231056 3300025935 Bacteria 1340
128 Ga0207669_10004334 3300025937 Bacteria 6236
129 Ga0207669_10454481 3300025937 Unclassified 1016
130 Ga0207704_10016996 3300025938 Bacteria 3758
131 Ga0207704_10053597 3300025938 Bacteria 2453
132 Ga0207691_10028816 3300025940 Bacteria 5196
133 Ga0207691_10418626 3300025940 Bacteria 1142
134 Ga0207711_10031479 3300025941 Bacteria 4479
135 Ga0207711_10283251 3300025941 Bacteria 1526
136 Ga0207661_10020871 3300025944 Bacteria 4903
137 Ga0207661_10088797 3300025944 Bacteria 2570
138 Ga0207661_10122144 3300025944 Bacteria 2219
139 Ga0207661_10233840 3300025944 Bacteria 1628
140 Ga0207679_10025357 3300025945 Bacteria 4075
141 Ga0207679_10171921 3300025945 Bacteria 1785
142 Ga0207651_10108453 3300025960 Bacteria 2078
143 Ga0207712_10180306 3300025961 Bacteria 1658
144 Ga0207668_10360072 3300025972 Archaea 1219
145 Ga0207640_10009422 3300025981 Bacteria 5469
146 Ga0207658_10061102 3300025986 Bacteria 2814
147 Ga0207703_10017237 3300026035 Bacteria 5637
148 Ga0207703_10069994 3300026035 Bacteria 2895
149 Ga0207678_10030276 3300026067 Bacteria 4725
150 Ga0207678_10127431 3300026067 Bacteria 2171
151 Ga0207708_10000448 3300026075 Bacteria 32061
152 Ga0207708_10266425 3300026075 Bacteria 1384
153 Ga0207702_10509546 3300026078 Bacteria 1174
154 Ga0207648_10000550 3300026089 Bacteria 42009
155 Ga0207674_10190791 3300026116 Bacteria 1999
156 Ga0207675_100003907 3300026118 Bacteria 14489
157 Ga0207675_100577061 3300026118 Bacteria 1126
158 Ga0207683_10120699 3300026121 Bacteria 2353
159 Ga0207698_10047182 3300026142 Bacteria 3260
160 Ga0207698_10487720 3300026142 Bacteria 1197
161 Ga0207428_10090413 3300027907 Bacteria 2378
162 Ga0268266_10523649 3300028379 Unclassified 1134
163 Ga0268266_10666561 3300028379 Bacteria 1002
164 Ga0268265_10054368 3300028380 Bacteria 3038
165 Ga0268265_10160304 3300028380 Bacteria 1910
166 Ga0268264_10000354 3300028381 Bacteria 69023
167 Ga0307513_10037960 3300031456 Bacteria 5354
168 Ga0316575_10010770 3300031665 Bacteria 3369
169 Ga0316579_10097267 3300031691 Bacteria 1408
170 Ga0316579_10174371 3300031691 Bacteria 1039
171 Ga0316576_10013400 3300031727 Bacteria 5449
172 Ga0307405_10533366 3300031731 Bacteria 947
173 Ga0316577_10010560 3300031733 Bacteria 4987
174 Ga0316577_10022274 3300031733 Bacteria 3518
175 Ga0326468_10002414 3300031889 Bacteria 1556
176 Ga0307407_10312508 3300031903 Bacteria 1100
177 Ga0307409_100096581 3300031995 Bacteria 2438
178 Ga0307409_100115805 3300031995 Bacteria 2258
179 Ga0307409_100272604 3300031995 Bacteria 1559
180 Ga0307409_100399071 3300031995 Bacteria 1313
181 Ga0307416_100211408 3300032002 Bacteria 1851
182 Ga0307414_10445242 3300032004 Bacteria 1135
183 Ga0307411_10089531 3300032005 Bacteria 2144
184 Ga0307411_10193202 3300032005 Bacteria 1556
185 Ga0316585_10024836 3300032137 Bacteria 1856
186 Ga0373931_0171552 3300035691 Bacteria 1279
187 Ga0373935_0380110 3300035692 Bacteria 1011
188 Ga0316582_0000966 3300036647 Bacteria 11945
189 Ga0316582_0074599 3300036647 Bacteria 2203
190 Ga0316582_0158079 3300036647 Bacteria 1534
191 Ga0316584_0002147 3300036712 Bacteria 12348
192 Ga0316584_0019671 3300036712 Bacteria 4882
193 Ga0316584_0036472 3300036712 Bacteria 3649
194 Ga0316584_0150193 3300036712 Bacteria 1734
195 Ga0316584_0221036 3300036712 Bacteria 1392
196 Ga0316584_0356344 3300036712 Bacteria 1049
197 Ga0395898_0237886 3300037466 Bacteria 1737
198 Ga0395898_0719399 3300037466 Bacteria 940
199 Ga0316581_0045390 3300037588 Bacteria 1342
200 Ga0400485_09679 3300038735 Bacteria 3561
201 Ga0400483_145542 3300039062 Bacteria 31079
202 Ga0400483_197576 3300039062 Bacteria 42315
203 Ga0451789_0112890 3300041443 Bacteria 1221
204 Ga0439459_0017728 3300042438 Bacteria 1331
205 Ga0466972_0004603 3300044658 Bacteria 6911
206 Ga0466972_0053008 3300044658 Bacteria 1954
207 Ga0466963_0066593 3300044694 Bacteria 2416
208 Ga0466963_0139012 3300044694 Bacteria 1682
209 Ga0466964_0049185 3300044706 Bacteria 1726
210 Ga0466964_0165374 3300044706 Bacteria 1037
211 Ga0453684_0163640 3300044712 Bacteria 2629
212 Ga0466970_0040584 3300044765 Bacteria 2472
213 Ga0466960_0002030 3300044901 Bacteria 7514
214 Ga0466960_0041776 3300044901 Bacteria 2174
215 Ga0466967_0035471 3300045976 Bacteria 4246
216 Ga0466967_0297322 3300045976 Bacteria 1552
217 Ga0466967_0536624 3300045976 Bacteria 1150
218 Ga0495603_0095605 3300046455 Bacteria 1736
219 Ga0495664_0021222 3300046477 Bacteria 3751
220 Ga0495634_0392384 3300046642 Bacteria 826
221 Ga0495658_0149055 3300046683 Bacteria 1436
222 Ga0495658_0330800 3300046683 Bacteria 967
223 Ga0496102_0025035 3300048905 Bacteria 5308
224 Ga0496102_0253730 3300048905 Bacteria 1658
225 Ga0496104_0003251 3300048907 Bacteria 14008
226 Ga0496105_0002223 3300048908 Bacteria 14062
227 Ga0496106_0020651 3300048909 Bacteria 4890
228 Ga0496108_0035525 3300048911 Bacteria 4144
229 Ga0496108_0082119 3300048911 Bacteria 2732
230 Ga0496109_0005106 3300048912 Bacteria 10961
231 Ga0496109_0076618 3300048912 Bacteria 3076
232 Ga0496109_0208889 3300048912 Bacteria 1836
233 Ga0496109_0504915 3300048912 Bacteria 1141
234 Ga0496110_0128649 3300048913 Bacteria 2286
235 Ga0496110_0189662 3300048913 Bacteria 1867
236 Ga0496110_0205554 3300048913 Bacteria 1790
237 Ga0496110_0217700 3300048913 Bacteria 1737
238 Ga0496110_0250122 3300048913 Bacteria 1613
239 Ga0496111_0003601 3300048914 Bacteria 9603
240 Ga0496111_0279026 3300048914 Bacteria 1239
241 Ga0496112_0251456 3300048915 Bacteria 1718
242 Ga0496113_0070248 3300048916 Bacteria 2661
243 Ga0496114_0030601 3300048917 Bacteria 4429
244 Ga0496114_0055459 3300048917 Bacteria 3305
245 Ga0496114_0217704 3300048917 Bacteria 1676
246 Ga0496114_0277998 3300048917 Bacteria 1476
247 Ga0496115_0001622 3300048918 Bacteria 16193
248 Ga0501031_0164508 3300049568 Bacteria 1450
249 Ga0501031_0171951 3300049568 Bacteria 1416
250 Ga0501031_0318918 3300049568 Bacteria 1007
251 Ga0501034_0078311 3300049571 Bacteria 3310
252 Ga0501036_0066565 3300049572 Bacteria 3048
253 Ga0501037_0041607 3300049573 Bacteria 3379
254 Ga0501037_0153626 3300049573 Bacteria 1644
255 Ga0501038_0111514 3300049574 Bacteria 2266
256 Ga0501039_0002492 3300049575 Bacteria 13705
257 Ga0501040_0121118 3300049576 Bacteria 1836
258 Ga0501041_0112302 3300049577 Bacteria 1691
259 Ga0501042_0504487 3300049578 Bacteria 878
260 Ga0501046_0320905 3300049580 Bacteria 1129
261 Ga0501047_0072663 3300049581 Bacteria 3311
262 Ga0501048_0202400 3300049582 Bacteria 1408
263 Ga0501048_0393607 3300049582 Bacteria 990
264 Ga0501067_0001782 3300049583 Bacteria 11828
265 Ga0501067_0014993 3300049583 Bacteria 4288
266 Ga0501067_0071505 3300049583 Bacteria 1921
267 Ga0501068_0002440 3300049584 Bacteria 9867
268 Ga0501068_0270377 3300049584 Bacteria 1085
269 Ga0501069_0008499 3300049585 Bacteria 5400
270 Ga0501069_0088618 3300049585 Bacteria 1749
271 Ga0501069_0241388 3300049585 Bacteria 1053
272 Ga0501070_0005015 3300049586 Bacteria 11295
273 Ga0501070_0076651 3300049586 Bacteria 2768
274 Ga0501070_0099293 3300049586 Bacteria 2408
275 Ga0501071_0013205 3300049587 Bacteria 5625
276 Ga0501071_0048336 3300049587 Bacteria 3059
277 Ga0501071_0170766 3300049587 Bacteria 1628
278 Ga0501072_0073677 3300049588 Bacteria 2699
279 Ga0501072_0158737 3300049588 Bacteria 1804
280 Ga0501072_0226770 3300049588 Bacteria 1488
281 Ga0501073_0001660 3300049589 Bacteria 16502
282 Ga0501074_0002313 3300049590 Bacteria 13252
283 Ga0501074_0105098 3300049590 Bacteria 2022
284 Ga0501075_0134350 3300049591 Bacteria 1884
285 Ga0501076_0065172 3300049592 Bacteria 2904
286 Ga0501076_0154106 3300049592 Bacteria 1870
287 Ga0501077_0042512 3300049593 Bacteria 2889
288 Ga0501077_0208961 3300049593 Bacteria 1240
289 Ga0501080_0366451 3300049742 Bacteria 1299
290 Ga0501081_0114462 3300049743 Bacteria 1917
291 Ga0501081_0252500 3300049743 Bacteria 1288
292 Ga0501083_0136784 3300049744 Bacteria 1605
293 Ga0501045_0046172 3300049824 Bacteria 3172
294 Ga0501045_0082245 3300049824 Bacteria 2375
295 Ga0501045_0096312 3300049824 Bacteria 2190
296 nmdc:mga00v17_76328_c1 3300050491 Bacteria 2085
297 nmdc:mga0yw44_159266_c1 3300050492 Bacteria 1477
298 nmdc:mga0yw44_171798_c1 3300050492 Bacteria 1423
299 nmdc:mga0yw44_237316_c1 3300050492 Bacteria 1211
300 nmdc:mga0yw44_329711_c1 3300050492 Bacteria 1026
301 nmdc:mga0yw44_54307_c1 3300050492 Bacteria 2434
302 nmdc:mga06z11_26987_c1 3300050494 Bacteria 2741
303 nmdc:mga07m45_10332_c1 3300050496 Bacteria 4871
304 nmdc:mga07m45_26256_c1 3300050496 Bacteria 3200
305 nmdc:mga07m45_298363_c1 3300050496 Bacteria 937
306 nmdc:mga05p37_89742_c1 3300050507 Bacteria 3788
307 nmdc:mga0qj67_182875_c1 3300050509 Bacteria 1703
308 nmdc:mga08y16_152029_c1 3300050511 Bacteria 2406
309 nmdc:mga08y16_597649_c1 3300050511 Bacteria 1112
310 Ga0495601_0074667 3300053077 Bacteria 2169
311 Ga0500641_0084774 3300053096 Bacteria 1348
312 Ga0501084_0065072 3300054114 Bacteria 3050
313 Ga0501082_0102634 3300060353 Bacteria 2474
314 Ga0501082_0314462 3300060353 Bacteria 1364
315 Ga0501082_0335025 3300060353 Bacteria 1318
316 Ga0501082_0469430 3300060353 Bacteria 1100
317 Ga0530510_0038157 3300061734 Bacteria 3468
318 Ga0530510_0061544 3300061734 Bacteria 2718
319 Ga0530510_0104063 3300061734 Bacteria 2077
320 Ga0530510_0111313 3300061734 Bacteria 2006
321 Ga0530510_0124177 3300061734 Bacteria 1896
322 Ga0530510_0213758 3300061734 Bacteria 1433
323 Ga0530510_0256651 3300061734 Bacteria 1303
324 2816426532 2816332119 Bacteria 8120218
325 2816504135 2816332139 Bacteria 9138787
326 Ga0070682_100001292
327 JGI24739J22299_10108226
328 JGI24738J21930_10009476
329 JGI24744J21845_10002322
330 Ga0070683_100049424
331 Ga0070683_100488587
332 Ga0070682_100007988
333 Ga0070682_100195309
334 Ga0070682_100380869
335 Ga0070660_100125813
336 Ga0070660_100197534
337 Ga0070687_100020982
338 Ga0070687_100112174
339 Ga0070692_10001239
340 Ga0070668_100148157
341 Ga0070668_100497785
342 Ga0070668_100592306
343 Ga0070674_100007435
344 Ga0070673_100145127
345 Ga0070688_100052744
346 Ga0070659_100053575
347 Ga0070659_100208390
348 Ga0070667_100414218
349 Ga0070714_100005644
350 Ga0070701_10003762
351 Ga0070700_100003680
352 Ga0070662_100032654
353 Ga0068867_100008968
354 Ga0068867_100156248
355 Ga0070684_100006642
356 Ga0070684_100273765
357 Ga0070684_100305376
358 Ga0070684_100612667
359 Ga0070672_100078749
360 Ga0070686_100186021
361 Ga0070693_100152331
362 Ga0070665_100686309
363 Ga0070664_100012248
364 Ga0070664_100062541
365 Ga0070664_100256131
366 Ga0068857_100303655
367 Ga0068854_100024025
368 Ga0070702_100011338
369 Ga0068852_100019163
370 Ga0068852_100465854
371 Ga0068861_100007046
372 Ga0068861_100314391
373 Ga0068870_10250300
374 Ga0068863_100085503
375 Ga0068858_100581258
376 Ga0068860_100009506
377 Ga0068860_100041956
378 Ga0068862_100200118
379 Ga0068862_100490813
380 Ga0070717_10297497
381 Ga0075365_10016987
382 Ga0075365_10065706
383 Ga0075365_10081440
384 Ga0075365_10081485
385 Ga0075365_10273815
386 Ga0075363_100024320
387 Ga0075364_10062778
388 Ga0075370_10007218
389 Ga0075370_10013420
390 Ga0075370_10320121
391 Ga0075428_100318764
392 Ga0075428_100478109
393 Ga0075429_100045668
394 Ga0068865_100084533
395 Ga0111539_10208365
396 Ga0111539_10723390
397 Ga0105245_10008485
398 Ga0105245_10072522
399 Ga0105245_10288108
400 Ga0105245_10402279
401 Ga0105247_10359363
402 Ga0114129_10004945
403 Ga0105243_10004475
404 Ga0105242_10245280
405 Ga0105248_10048332
406 Ga0105248_10170962
407 Ga0105248_10218647
408 Ga0105248_10875207
409 Ga0105237_10071877
410 Ga0105238_10138331
411 Ga0105239_10004360
412 Ga0105239_10543625
413 Ga0105246_10002433
414 Ga0105246_10256813
415 Ga0157370_10162118
416 Ga0157370_10579656
417 Ga0157369_10046739
418 Ga0157374_10478239
419 Ga0163162_10322383
420 Ga0163162_10789733
421 Ga0157372_10001336
422 Ga0157372_10174380
423 Ga0157375_10040534
424 Ga0157375_10433483
425 Ga0163163_10052534
426 Ga0163163_10111500
427 Ga0163163_10145703
428 Ga0157380_10007502
429 Ga0157380_10335729
430 Ga0157377_10037985
431 Ga0157377_10187105
432 Ga0157377_10219530
433 Ga0157376_10597701
434 Ga0163161_10172328
435 Ga0163161_10203995
436 Ga0224712_10038899
437 Ga0207710_10213042
438 Ga0207688_10013318
439 Ga0207643_10093564
440 Ga0207662_10008888
441 Ga0207649_10121619
442 Ga0207694_10091743
443 Ga0207687_10023607
444 Ga0207664_10021228
445 Ga0207664_10029616
446 Ga0207644_10394872
447 Ga0207690_10070305
448 Ga0207690_10361901
449 Ga0207706_10234222
450 Ga0207686_10208497
451 Ga0207709_10080855
452 Ga0207709_10231056
453 Ga0207669_10004334
454 Ga0207669_10454481
455 Ga0207704_10016996
456 Ga0207704_10053597
457 Ga0207691_10028816
458 Ga0207691_10418626
459 Ga0207711_10031479
460 Ga0207711_10283251
461 Ga0207661_10020871
462 Ga0207661_10088797
463 Ga0207661_10122144
464 Ga0207661_10233840
465 Ga0207679_10025357
466 Ga0207679_10171921
467 Ga0207651_10108453
468 Ga0207712_10180306
469 Ga0207668_10360072
470 Ga0207640_10009422
471 Ga0207658_10061102
472 Ga0207703_10017237
473 Ga0207703_10069994
474 Ga0207678_10030276
475 Ga0207678_10127431
476 Ga0207708_10000448
477 Ga0207708_10266425
478 Ga0207702_10509546
479 Ga0207648_10000550
480 Ga0207674_10190791
481 Ga0207675_100003907
482 Ga0207675_100577061
483 Ga0207683_10120699
484 Ga0207698_10047182
485 Ga0207698_10487720
486 Ga0207428_10090413
487 Ga0268266_10523649
488 Ga0268266_10666561
489 Ga0268265_10054368
490 Ga0268265_10160304
491 Ga0268264_10000354
492 Ga0307513_10037960
493 Ga0316575_10010770
494 Ga0316579_10097267
495 Ga0316579_10174371
496 Ga0316576_10013400
497 Ga0307405_10533366
498 Ga0316577_10010560
499 Ga0316577_10022274
500 Ga0326468_10002414
501 Ga0307407_10312508
502 Ga0307409_100096581
503 Ga0307409_100115805
504 Ga0307409_100272604
505 Ga0307409_100399071
506 Ga0307416_100211408
507 Ga0307414_10445242
508 Ga0307411_10089531
509 Ga0307411_10193202
510 Ga0316585_10024836
511 Ga0373931_0171552
512 Ga0373935_0380110
513 Ga0316582_0000966
514 Ga0316582_0074599
515 Ga0316582_0158079
516 Ga0316584_0002147
517 Ga0316584_0019671
518 Ga0316584_0036472
519 Ga0316584_0150193
520 Ga0316584_0221036
521 Ga0316584_0356344
522 Ga0395898_0237886
523 Ga0395898_0719399
524 Ga0316581_0045390
525 Ga0400485_09679
526 Ga0400483_145542
527 Ga0400483_197576
528 Ga0451789_0112890
529 Ga0439459_0017728
530 Ga0466972_0004603
531 Ga0466972_0053008
532 Ga0466963_0066593
533 Ga0466963_0139012
534 Ga0466964_0049185
535 Ga0466964_0165374
536 Ga0453684_0163640
537 Ga0466970_0040584
538 Ga0466960_0002030
539 Ga0466960_0041776
540 Ga0466967_0035471
541 Ga0466967_0297322
542 Ga0466967_0536624
543 Ga0495603_0095605
544 Ga0495664_0021222
545 Ga0495634_0392384
546 Ga0495658_0149055
547 Ga0495658_0330800
548 Ga0496102_0025035
549 Ga0496102_0253730
550 Ga0496104_0003251
551 Ga0496105_0002223
552 Ga0496106_0020651
553 Ga0496108_0035525
554 Ga0496108_0082119
555 Ga0496109_0005106
556 Ga0496109_0076618
557 Ga0496109_0208889
558 Ga0496109_0504915
559 Ga0496110_0128649
560 Ga0496110_0189662
561 Ga0496110_0205554
562 Ga0496110_0217700
563 Ga0496110_0250122
564 Ga0496111_0003601
565 Ga0496111_0279026
566 Ga0496112_0251456
567 Ga0496113_0070248
568 Ga0496114_0030601
569 Ga0496114_0055459
570 Ga0496114_0217704
571 Ga0496114_0277998
572 Ga0496115_0001622
573 Ga0501031_0164508
574 Ga0501031_0171951
575 Ga0501031_0318918
576 Ga0501034_0078311
577 Ga0501036_0066565
578 Ga0501037_0041607
579 Ga0501037_0153626
580 Ga0501038_0111514
581 Ga0501039_0002492
582 Ga0501040_0121118
583 Ga0501041_0112302
584 Ga0501042_0504487
585 Ga0501046_0320905
586 Ga0501047_0072663
587 Ga0501048_0202400
588 Ga0501048_0393607
589 Ga0501067_0001782
590 Ga0501067_0014993
591 Ga0501067_0071505
592 Ga0501068_0002440
593 Ga0501068_0270377
594 Ga0501069_0008499
595 Ga0501069_0088618
596 Ga0501069_0241388
597 Ga0501070_0005015
598 Ga0501070_0076651
599 Ga0501070_0099293
600 Ga0501071_0013205
601 Ga0501071_0048336
602 Ga0501071_0170766
603 Ga0501072_0073677
604 Ga0501072_0158737
605 Ga0501072_0226770
606 Ga0501073_0001660
607 Ga0501074_0002313
608 Ga0501074_0105098
609 Ga0501075_0134350
610 Ga0501076_0065172
611 Ga0501076_0154106
612 Ga0501077_0042512
613 Ga0501077_0208961
614 Ga0501080_0366451
615 Ga0501081_0114462
616 Ga0501081_0252500
617 Ga0501083_0136784
618 Ga0501045_0046172
619 Ga0501045_0082245
620 Ga0501045_0096312
621 nmdc:mga00v17_76328_c1
622 nmdc:mga0yw44_159266_c1
623 nmdc:mga0yw44_171798_c1
624 nmdc:mga0yw44_237316_c1
625 nmdc:mga0yw44_329711_c1
626 nmdc:mga0yw44_54307_c1
627 nmdc:mga06z11_26987_c1
628 nmdc:mga07m45_10332_c1
629 nmdc:mga07m45_26256_c1
630 nmdc:mga07m45_298363_c1
631 nmdc:mga05p37_89742_c1
632 nmdc:mga0qj67_182875_c1
633 nmdc:mga08y16_152029_c1
634 nmdc:mga08y16_597649_c1
635 Ga0495601_0074667
636 Ga0500641_0084774
637 Ga0501084_0065072
638 Ga0501082_0102634
639 Ga0501082_0314462
640 Ga0501082_0335025
641 Ga0501082_0469430
642 Ga0530510_0038157
643 Ga0530510_0061544
644 Ga0530510_0104063
645 Ga0530510_0111313
646 Ga0530510_0124177
647 Ga0530510_0213758
648 Ga0530510_0256651
649 2816426532
650 2816504135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

234

277

0.95

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

38

136

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.9187 17 247
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.91 17 247
2zze-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form 0.9006 17 247
3kew-assembly2.cif.gz_B crystal structure of probable alanyl-trna-synthase from clostridium perfringens 0.8731 18 247
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.8696 17 247
ID Description Score Start End Superfamily
2zzeB03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9135 17 102 2.40.30.130
af_Q9VRJ1_645_810_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8981 104 247 3.30.980.10
af_Q559E5_5_168_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8893 112 247 3.30.980.10
af_Q23122_583_750_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8889 104 247 3.30.980.10
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8813 9 102 2.40.30.130
ID Description Score Start End GO Terms
AF-A0A7Y1XSI1-F1-model_v4 Alanyl-tRNA editing protein 0.9757 18 247 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A1W9Q347-F1-model_v4 Alanyl-tRNA synthetase class IIc N-terminal domain-containing protein 0.974 18 113 GO:0002161
GO:0004813
GO:0005524
GO:0006419
GO:0046872
AF-A0A2N2LYK6-F1-model_v4 Ala-tRNA(Pro) hydrolase 0.9731 18 112 GO:0002161
GO:0004813
GO:0005524
GO:0006419
GO:0046872
AF-A0A1F8Q2P8-F1-model_v4 Ala-tRNA(Pro) hydrolase 0.9702 18 247 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A543DXF8-F1-model_v4 Misacylated tRNA(Ala) deacylase 0.9642 18 247 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872

Map