F407669

General Info

Members Datasets Scaffolds Average Seq Length
325 163 323 277

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100009577|Ga0068869_1000095774
Length 304
Sequence MQTGKMAGDLRHLSGQRKVKHSFILKLPGMANFNLTSQQVSDYNSDGYIIIRNFLQKEEVDKLYHIAIEDDTMQKHSFDLNDQTGKKTKLALWYTPGNDAYGLLTKSRRMIDAVDKLMEGDSAVCHFHSKLMQKEPKVGGAWEWHQDYGYWYKNEFLLPNQMMSVMIAITAANKQNGCLQVIKGTHKMGRIEHGFAGEQVGASQHYVDLALKTMELVYVELMPGDALFFHSNLLHRSAANLSDNSRWSLISCYNRSANIPYNEPSASSTIPLEAVPDEALLQWETKGLGDSANFLEKEKDEALK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 0
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002630 3300001979 Bacteria 8086
2 JGI24739J22299_10010586 3300001989 Bacteria 3422
3 JGI25154J39366_1000007 3300002738 Bacteria 335932
4 JGI25153J46596_10000504 3300003215 Bacteria 24851
5 rootH2_10000086 3300003320 Bacteria 48758
6 rootH2_10011701 3300003320 Bacteria 9654
7 rootH2_10012061 3300003320 Bacteria 49051
8 rootH2_10130711 3300003320 Bacteria 4291
9 rootL2_10058418 3300003322 Bacteria 21138
10 JGI25160J50197_1005566 3300003354 Bacteria 5225
11 Ga0065712_10068858 3300005290 Bacteria 8735
12 Ga0065712_10140653 3300005290 Bacteria 1453
13 Ga0070658_10038567 3300005327 Bacteria 3852
14 Ga0070658_10130421 3300005327 Bacteria 2095
15 Ga0070676_10091106 3300005328 Bacteria 1868
16 Ga0070683_100023035 3300005329 Bacteria 5569
17 Ga0068869_100009577 3300005334 Bacteria 6291
18 Ga0068869_100423281 3300005334 Unclassified 1099
19 Ga0070666_10000156 3300005335 Bacteria 47136
20 Ga0070680_100002502 3300005336 Bacteria 13614
21 Ga0068868_100130119 3300005338 Bacteria 2059
22 Ga0070660_100002765 3300005339 Bacteria 12054
23 Ga0070660_100063058 3300005339 Bacteria 2880
24 Ga0070660_100165811 3300005339 Bacteria 1782
25 Ga0070660_100257896 3300005339 Unclassified 1423
26 Ga0070689_100074210 3300005340 Bacteria 2661
27 Ga0070689_100160676 3300005340 Bacteria 1816
28 Ga0070691_10026315 3300005341 Bacteria 2711
29 Ga0070691_10032087 3300005341 Unclassified 2466
30 Ga0070668_100132745 3300005347 Bacteria 2000
31 Ga0070668_100525832 3300005347 Bacteria 1027
32 Ga0070669_100114341 3300005353 Unclassified 2052
33 Ga0070675_100450576 3300005354 Bacteria 1154
34 Ga0070671_100039395 3300005355 Bacteria 3922
35 Ga0070659_100008306 3300005366 Bacteria 7580
36 Ga0070659_100024655 3300005366 Unclassified 4613
37 Ga0070659_100480482 3300005366 Bacteria 1057
38 Ga0070667_100103146 3300005367 Bacteria 2465
39 Ga0070667_100138852 3300005367 Bacteria 2126
40 Ga0070663_100005240 3300005455 Bacteria 7682
41 Ga0070663_100007631 3300005455 Bacteria 6599
42 Ga0070663_100122385 3300005455 Bacteria 1967
43 Ga0070681_10005612 3300005458 Bacteria 12126
44 Ga0070681_10043871 3300005458 Unclassified 4476
45 Ga0068867_100062659 3300005459 Bacteria 2763
46 Ga0070685_10006615 3300005466 Bacteria 5913
47 Ga0070679_100076781 3300005530 Bacteria 3329
48 Ga0070679_100081152 3300005530 Bacteria 3232
49 Ga0070679_100325299 3300005530 Bacteria 1486
50 Ga0070684_100083955 3300005535 Bacteria 2823
51 Ga0070684_100396569 3300005535 Bacteria 1272
52 Ga0068853_100008359 3300005539 Bacteria 8310
53 Ga0068853_100108434 3300005539 Bacteria 2463
54 Ga0068855_100011365 3300005563 Bacteria 10748
55 Ga0068855_100045137 3300005563 Bacteria 5212
56 Ga0068855_100059205 3300005563 Bacteria 4482
57 Ga0068855_100114823 3300005563 Bacteria 3087
58 Ga0068855_100370342 3300005563 Bacteria 1575
59 Ga0068855_100390567 3300005563 Bacteria 1526
60 Ga0068855_100731917 3300005563 Bacteria 1056
61 Ga0068857_100194065 3300005577 Bacteria 1850
62 Ga0068857_100480919 3300005577 Bacteria 1164
63 Ga0068854_100103631 3300005578 Unclassified 2136
64 Ga0068856_100011272 3300005614 Bacteria 8676
65 Ga0068856_100046985 3300005614 Bacteria 4252
66 Ga0068852_100006114 3300005616 Bacteria 8681
67 Ga0068852_100135577 3300005616 Bacteria 2272
68 Ga0068852_100213697 3300005616 Bacteria 1831
69 Ga0068852_100350768 3300005616 Bacteria 1441
70 Ga0068852_100816483 3300005616 Bacteria 947
71 Ga0068852_100865497 3300005616 Bacteria 920
72 Ga0068859_100000024 3300005617 Bacteria 217931
73 Ga0068859_100009051 3300005617 Bacteria 10060
74 Ga0068859_100813144 3300005617 Bacteria 1022
75 Ga0068864_100112016 3300005618 Bacteria 2432
76 Ga0068864_100207604 3300005618 Bacteria 1802
77 Ga0068851_10014050 3300005834 Bacteria 3796
78 Ga0068863_100005289 3300005841 Bacteria 12745
79 Ga0068863_100013768 3300005841 Bacteria 7795
80 Ga0068863_100021533 3300005841 Bacteria 6152
81 Ga0068863_100027954 3300005841 Bacteria 5383
82 Ga0068858_100001337 3300005842 Bacteria 25427
83 Ga0068858_100024689 3300005842 Bacteria 5598
84 Ga0068860_100063456 3300005843 Bacteria 3509
85 Ga0081540_1002517 3300005983 Bacteria 14879
86 Ga0070715_10101088 3300006163 Bacteria 1345
87 Ga0075366_10259975 3300006195 Bacteria 1059
88 Ga0097621_100011501 3300006237 Bacteria 6520
89 Ga0097621_100012295 3300006237 Bacteria 6335
90 Ga0097621_100070799 3300006237 Bacteria 2880
91 Ga0097621_100320578 3300006237 Bacteria 1373
92 Ga0097621_100463759 3300006237 Bacteria 1143
93 Ga0068871_100008693 3300006358 Bacteria 7306
94 Ga0068871_100162650 3300006358 Bacteria 1910
95 Ga0075428_100282979 3300006844 Unclassified 1784
96 Ga0075431_100070989 3300006847 Unclassified 3592
97 Ga0075429_100005482 3300006880 Bacteria 10930
98 Ga0068865_100337333 3300006881 Bacteria 1217
99 Ga0068865_100646166 3300006881 Bacteria 899
100 Ga0097620_100000024 3300006931 Bacteria 217931
101 Ga0097620_100009051 3300006931 Bacteria 10060
102 Ga0097620_100813248 3300006931 Bacteria 1022
103 Ga0105240_10001825 3300009093 Bacteria 35720
104 Ga0105240_10003650 3300009093 Bacteria 23830
105 Ga0105240_10049758 3300009093 Bacteria 5287
106 Ga0105240_10061512 3300009093 Bacteria 4679
107 Ga0111539_10030420 3300009094 Bacteria 6562
108 Ga0111539_10112304 3300009094 Bacteria 3197
109 Ga0105245_10297901 3300009098 Bacteria 1581
110 Ga0105247_10010217 3300009101 Bacteria 5681
111 Ga0114129_10036265 3300009147 Bacteria 6964
112 Ga0105241_10007297 3300009174 Bacteria 8133
113 Ga0105241_10013321 3300009174 Bacteria 6027
114 Ga0105241_10084575 3300009174 Bacteria 2491
115 Ga0105242_10002120 3300009176 Bacteria 15650
116 Ga0105242_10038926 3300009176 Bacteria 3827
117 Ga0105237_10000125 3300009545 Bacteria 107351
118 Ga0105237_10012826 3300009545 Bacteria 8813
119 Ga0105237_10069910 3300009545 Bacteria 3506
120 Ga0105237_10091138 3300009545 Bacteria 3038
121 Ga0105249_10016397 3300009553 Bacteria 6573
122 Ga0105249_10040087 3300009553 Bacteria 4253
123 Ga0105239_10000129 3300010375 Bacteria 106549
124 Ga0105239_10001203 3300010375 Bacteria 35394
125 Ga0105239_10040062 3300010375 Bacteria 5132
126 Ga0105239_10160582 3300010375 Bacteria 2510
127 Ga0105246_10070677 3300011119 Bacteria 2455
128 Ga0105246_10280364 3300011119 Bacteria 1337
129 Ga0157373_10000156 3300013100 Bacteria 55108
130 Ga0157373_10014809 3300013100 Bacteria 5714
131 Ga0157373_10016368 3300013100 Bacteria 5411
132 Ga0157373_10025671 3300013100 Bacteria 4260
133 Ga0157373_10093757 3300013100 Bacteria 2114
134 Ga0157371_10003016 3300013102 Bacteria 15632
135 Ga0157371_10003214 3300013102 Bacteria 15001
136 Ga0157371_10011577 3300013102 Bacteria 6782
137 Ga0157371_10017182 3300013102 Bacteria 5379
138 Ga0157371_10026941 3300013102 Bacteria 4173
139 Ga0157371_10032075 3300013102 Bacteria 3781
140 Ga0157371_10064314 3300013102 Bacteria 2599
141 Ga0157371_10119583 3300013102 Bacteria 1873
142 Ga0157370_10005048 3300013104 Bacteria 14906
143 Ga0157370_10054419 3300013104 Bacteria 3814
144 Ga0157370_10070378 3300013104 Bacteria 3302
145 Ga0157370_10097135 3300013104 Bacteria 2763
146 Ga0157370_10207226 3300013104 Bacteria 1818
147 Ga0157370_10341306 3300013104 Bacteria 1381
148 Ga0157370_10475597 3300013104 Bacteria 1148
149 Ga0157369_10000039 3300013105 Bacteria 188947
150 Ga0157369_10031302 3300013105 Bacteria 5859
151 Ga0157369_10039431 3300013105 Bacteria 5162
152 Ga0157369_10239864 3300013105 Bacteria 1894
153 Ga0157369_10297476 3300013105 Bacteria 1679
154 Ga0157369_10309744 3300013105 Bacteria 1642
155 Ga0157369_10570242 3300013105 Bacteria 1169
156 Ga0157369_10777611 3300013105 Bacteria 984
157 Ga0157374_10000013 3300013296 Bacteria 461240
158 Ga0157374_10320132 3300013296 Bacteria 1537
159 Ga0157378_10005987 3300013297 Bacteria 10661
160 Ga0157378_10020798 3300013297 Bacteria 5770
161 Ga0157378_10139349 3300013297 Bacteria 2251
162 Ga0163162_10000153 3300013306 Bacteria 63805
163 Ga0163162_10060112 3300013306 Bacteria 3834
164 Ga0163162_10986333 3300013306 Bacteria 952
165 Ga0157372_10000001 3300013307 Bacteria 791349
166 Ga0157372_10000965 3300013307 Bacteria 31343
167 Ga0157372_10017690 3300013307 Bacteria 7651
168 Ga0157372_10046379 3300013307 Bacteria 4824
169 Ga0157372_10062076 3300013307 Bacteria 4185
170 Ga0157372_10082444 3300013307 Bacteria 3641
171 Ga0157372_10145062 3300013307 Bacteria 2737
172 Ga0157372_10395632 3300013307 Bacteria 1610
173 Ga0157375_10058343 3300013308 Bacteria 3818
174 Ga0157375_10071152 3300013308 Bacteria 3490
175 Ga0157375_10245304 3300013308 Bacteria 1951
176 Ga0157380_10014743 3300014326 Bacteria 5723
177 Ga0157380_10329202 3300014326 Bacteria 1420
178 Ga0157379_10154700 3300014968 Bacteria 2068
179 Ga0157376_10001450 3300014969 Bacteria 15619
180 Ga0157376_10005592 3300014969 Bacteria 8795
181 Ga0157376_10028632 3300014969 Bacteria 4430
182 Ga0163161_10033483 3300017792 Bacteria 3672
183 Ga0209646_1000002 3300025246 Bacteria 1425781
184 Ga0209026_1000086 3300025250 Bacteria 185551
185 Ga0209758_1001590 3300025297 Bacteria 25985
186 Ga0207426_1000419 3300025302 Bacteria 69963
187 Ga0207656_10022735 3300025321 Bacteria 2519
188 Ga0207710_10023473 3300025900 Bacteria 2650
189 Ga0207680_10000523 3300025903 Bacteria 18355
190 Ga0207647_10001709 3300025904 Bacteria 16864
191 Ga0207685_10149596 3300025905 Unclassified 1055
192 Ga0207705_10010201 3300025909 Bacteria 6834
193 Ga0207705_10108956 3300025909 Bacteria 2044
194 Ga0207705_10125994 3300025909 Bacteria 1904
195 Ga0207705_10187841 3300025909 Bacteria 1561
196 Ga0207654_10000412 3300025911 Bacteria 24701
197 Ga0207654_10010522 3300025911 Bacteria 4711
198 Ga0207707_10285613 3300025912 Unclassified 1428
199 Ga0207695_10000209 3300025913 Bacteria 157802
200 Ga0207695_10000300 3300025913 Bacteria 122104
201 Ga0207695_10000483 3300025913 Bacteria 85395
202 Ga0207695_10034657 3300025913 Bacteria 5486
203 Ga0207695_10261022 3300025913 Bacteria 1630
204 Ga0207671_10000112 3300025914 Bacteria 125310
205 Ga0207671_10002294 3300025914 Bacteria 20672
206 Ga0207671_10056692 3300025914 Bacteria 2903
207 Ga0207660_10021915 3300025917 Bacteria 4301
208 Ga0207657_10006445 3300025919 Bacteria 12161
209 Ga0207657_10073115 3300025919 Bacteria 2899
210 Ga0207657_10154695 3300025919 Unclassified 1866
211 Ga0207652_10001292 3300025921 Bacteria 22268
212 Ga0207652_10012635 3300025921 Bacteria 6826
213 Ga0207652_10312998 3300025921 Bacteria 1417
214 Ga0207694_10173308 3300025924 Bacteria 1747
215 Ga0207659_10092342 3300025926 Bacteria 2263
216 Ga0207659_10105747 3300025926 Bacteria 2130
217 Ga0207690_10138822 3300025932 Bacteria 1788
218 Ga0207686_10001888 3300025934 Bacteria 11604
219 Ga0207686_10261744 3300025934 Bacteria 1268
220 Ga0207670_10168815 3300025936 Bacteria 1639
221 Ga0207670_10231190 3300025936 Bacteria 1420
222 Ga0207704_10251775 3300025938 Bacteria 1326
223 Ga0207704_10378215 3300025938 Bacteria 1111
224 Ga0207689_10003921 3300025942 Bacteria 13543
225 Ga0207661_10005362 3300025944 Bacteria 9034
226 Ga0207667_10000323 3300025949 Bacteria 66327
227 Ga0207667_10010902 3300025949 Bacteria 10596
228 Ga0207667_10099521 3300025949 Bacteria 3000
229 Ga0207667_10185382 3300025949 Bacteria 2136
230 Ga0207667_10367008 3300025949 Bacteria 1468
231 Ga0207667_10670765 3300025949 Bacteria 1041
232 Ga0207651_10200506 3300025960 Bacteria 1599
233 Ga0207712_10005522 3300025961 Bacteria 7976
234 Ga0207712_10106214 3300025961 Bacteria 2097
235 Ga0207668_10236442 3300025972 Bacteria 1476
236 Ga0207668_10257639 3300025972 Bacteria 1420
237 Ga0207640_10039554 3300025981 Bacteria 2985
238 Ga0207640_10429811 3300025981 Unclassified 1083
239 Ga0207658_10014562 3300025986 Bacteria 5385
240 Ga0207658_10054609 3300025986 Bacteria 2956
241 Ga0207677_10603507 3300026023 Bacteria 963
242 Ga0207703_10000764 3300026035 Bacteria 31691
243 Ga0207703_10024583 3300026035 Bacteria 4738
244 Ga0207639_10028574 3300026041 Bacteria 4073
245 Ga0207639_10038870 3300026041 Bacteria 3542
246 Ga0207678_10006605 3300026067 Bacteria 10283
247 Ga0207678_10085694 3300026067 Bacteria 2693
248 Ga0207708_10182631 3300026075 Bacteria 1666
249 Ga0207702_10057884 3300026078 Bacteria 3296
250 Ga0207702_10472655 3300026078 Unclassified 1219
251 Ga0207641_10000087 3300026088 Bacteria 132202
252 Ga0207641_10000850 3300026088 Bacteria 32370
253 Ga0207641_10012023 3300026088 Bacteria 7101
254 Ga0207641_10050774 3300026088 Bacteria 3510
255 Ga0207648_10005920 3300026089 Bacteria 12235
256 Ga0207676_10104379 3300026095 Bacteria 2357
257 Ga0207676_10817496 3300026095 Bacteria 910
258 Ga0207674_10129058 3300026116 Bacteria 2492
259 Ga0207674_10207843 3300026116 Bacteria 1907
260 Ga0207698_10187805 3300026142 Bacteria 1837
261 Ga0207428_10150681 3300027907 Bacteria 1770
262 Ga0268264_10048188 3300028381 Bacteria 3544
263 Ga0307515_10000059 3300028794 Bacteria 257520
264 Ga0316181_1176071 3300030744 Bacteria 2668
265 Ga0307408_100002709 3300031548 Bacteria 12292
266 Ga0307408_100011289 3300031548 Bacteria 5901
267 Ga0307408_100011639 3300031548 Bacteria 5816
268 Ga0307412_10008671 3300031911 Bacteria 5813
269 Ga0307416_100469213 3300032002 Bacteria 1316
270 Ga0373925_0235819 3300037068 Bacteria 1464
271 Ga0395899_0000342 3300037312 Bacteria 57838
272 Ga0395899_0020659 3300037312 Bacteria 4992
273 Ga0395899_0043493 3300037312 Bacteria 3350
274 Ga0395899_0103888 3300037312 Bacteria 2048
275 Ga0395900_0032765 3300037418 Bacteria 5344
276 Ga0395900_0049936 3300037418 Bacteria 4310
277 Ga0395900_0157095 3300037418 Unclassified 2322
278 Ga0395900_0206825 3300037418 Bacteria 1983
279 Ga0395900_0234988 3300037418 Bacteria 1841
280 Ga0395900_0320418 3300037418 Bacteria 1531
281 Ga0395898_0055068 3300037466 Bacteria 3879
282 Ga0395898_0713511 3300037466 Bacteria 944
283 Ga0395905_0004874 3300037471 Bacteria 13829
284 Ga0395905_0625541 3300037471 Bacteria 978
285 Ga0395901_0296705 3300038443 Unclassified 1676
286 Ga0395901_0299486 3300038443 Bacteria 1667
287 Ga0395901_0469585 3300038443 Bacteria 1284
288 Ga0395901_0770592 3300038443 Bacteria 953
289 Ga0439449_0022930 3300042007 Bacteria 2336
290 Ga0450898_005089 3300042134 Unclassified 1970
291 Ga0450918_036033 3300042531 Bacteria 881
292 Ga0466969_0086013 3300044656 Bacteria 1494
293 Ga0466966_0012472 3300044684 Bacteria 5630
294 Ga0466961_0018534 3300044693 Bacteria 4479
295 Ga0466961_0057520 3300044693 Bacteria 2475
296 Ga0453684_0254600 3300044712 Bacteria 2014
297 Ga0466971_0041572 3300044719 Bacteria 2065
298 Ga0466970_0039776 3300044765 Bacteria 2496
299 Ga0466957_0079479 3300044842 Bacteria 2041
300 Ga0466959_0008177 3300045049 Bacteria 7383
301 Ga0466958_0077770 3300045836 Bacteria 2038
302 Ga0466958_0080477 3300045836 Bacteria 2004
303 Ga0495611_0000244 3300046648 Bacteria 37825
304 Ga0495649_0044918 3300046694 Bacteria 2411
305 Ga0495672_0076089 3300047320 Bacteria 1886
306 Ga0501033_0204280 3300049570 Bacteria 1410
307 Ga0501034_0058568 3300049571 Bacteria 3871
308 Ga0501034_0360199 3300049571 Unclassified 1382
309 Ga0501043_0026995 3300049579 Bacteria 4506
310 Ga0501070_0048805 3300049586 Unclassified 3516
311 Ga0501223_000634 3300049663 Bacteria 8431
312 Ga0501259_003308 3300049688 Bacteria 2574
313 Ga0501044_0077668 3300049823 Bacteria 3367
314 Ga0501044_0161003 3300049823 Bacteria 2221
315 nmdc:mga0k408_286197_c1 3300050493 Bacteria 984
316 nmdc:mga05p37_47394_c1 3300050507 Bacteria 5285
317 nmdc:mga09592_23381_c1 3300050508 Bacteria 5105
318 nmdc:mga06r32_38123_c1 3300050510 Unclassified 4551
319 nmdc:mga08y16_862729_c1 3300050511 Bacteria 894
320 Ga0500583_0000073 3300053092 Bacteria 60111
321 Ga0500583_0105255 3300053092 Bacteria 1385
322 Ga0500568_0001011 3300053139 Bacteria 19249
323 Ga0466962_0069268 3300061719 Bacteria 1685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100165811 Ga0070660_1001658112 247
2 3300005530 Ga0070679_100325299 Ga0070679_1003252992 247
3 3300005616 Ga0068852_100135577 Ga0068852_1001355772 247
4 3300042531 Ga0450918_036033 Ga0450918_036033_27_791 254
5 3300005353 Ga0070669_100114341 Ga0070669_1001143412 257
6 3300003320 rootH2_10130711 rootH2_101307112 260
7 3300013105 Ga0157369_10309744 Ga0157369_103097442 266
8 3300013307 Ga0157372_10145062 Ga0157372_101450623 266
9 iso_pu_bacteria 2522125168 2522551359 268
10 3300044712 Ga0453684_0254600 Ga0453684_0254600_259_1074 271
11 iso_pu_bacteria 8003151029 8003154361 271
12 3300005366 Ga0070659_100480482 Ga0070659_1004804821 272
13 3300005530 Ga0070679_100076781 Ga0070679_1000767812 272
14 3300005563 Ga0068855_100390567 Ga0068855_1003905671 272
15 3300013102 Ga0157371_10017182 Ga0157371_100171826 272
16 3300013104 Ga0157370_10005048 Ga0157370_100050481 272
17 3300013307 Ga0157372_10082444 Ga0157372_100824441 272
18 3300005334 Ga0068869_100423281 Ga0068869_1004232811 274
19 3300005455 Ga0070663_100007631 Ga0070663_1000076315 274
20 3300006844 Ga0075428_100282979 Ga0075428_1002829792 274
21 3300006847 Ga0075431_100070989 Ga0075431_1000709896 274
22 3300006880 Ga0075429_100005482 Ga0075429_1000054822 274
23 3300009094 Ga0111539_10030420 Ga0111539_100304201 274
24 3300009147 Ga0114129_10036265 Ga0114129_100362656 274
25 3300009174 Ga0105241_10013321 Ga0105241_100133212 274
26 3300009545 Ga0105237_10000125 Ga0105237_1000012558 274
27 3300013102 Ga0157371_10003214 Ga0157371_100032149 274
28 3300013102 Ga0157371_10026941 Ga0157371_100269411 274
29 3300013104 Ga0157370_10097135 Ga0157370_100971352 274
30 3300013105 Ga0157369_10000039 Ga0157369_10000039117 274
31 3300013306 Ga0163162_10060112 Ga0163162_100601122 274
32 3300013307 Ga0157372_10000001 Ga0157372_10000001248 274
33 3300025911 Ga0207654_10010522 Ga0207654_100105222 274
34 3300025914 Ga0207671_10000112 Ga0207671_1000011273 274
35 3300025926 Ga0207659_10092342 Ga0207659_100923423 274
36 3300025960 Ga0207651_10200506 Ga0207651_102005062 274
37 3300027907 Ga0207428_10150681 Ga0207428_101506811 274
38 3300030744 Ga0316181_1176071 Ga0316181_11760712 274
39 3300031548 Ga0307408_100002709 Ga0307408_1000027094 274
40 3300031548 Ga0307408_100011289 Ga0307408_1000112892 274
41 3300031548 Ga0307408_100011639 Ga0307408_1000116395 274
42 3300031911 Ga0307412_10008671 Ga0307412_100086713 274
43 3300032002 Ga0307416_100469213 Ga0307416_1004692132 274
44 3300037312 Ga0395899_0000342 Ga0395899_0000342_8514_9344 274
45 3300044684 Ga0466966_0012472 Ga0466966_0012472_481_1311 274
46 3300044693 Ga0466961_0057520 Ga0466961_0057520_1516_2346 274
47 3300045836 Ga0466958_0080477 Ga0466958_0080477_1071_1901 274
48 3300047320 Ga0495672_0076089 Ga0495672_0076089_114_944 274
49 3300049570 Ga0501033_0204280 Ga0501033_0204280_91_915 274
50 3300049571 Ga0501034_0360199 Ga0501034_0360199_378_1208 274
51 3300049579 Ga0501043_0026995 Ga0501043_0026995_2874_3704 274
52 3300049663 Ga0501223_000634 Ga0501223_000634_7295_8125 274
53 3300049823 Ga0501044_0077668 Ga0501044_0077668_2423_3247 274
54 3300050507 nmdc:mga05p37_47394_c1 nmdc:mga05p37_47394_c1_2426_3256 274
55 3300050508 nmdc:mga09592_23381_c1 nmdc:mga09592_23381_c1_743_1573 274
56 3300050510 nmdc:mga06r32_38123_c1 nmdc:mga06r32_38123_c1_3711_4541 274
57 3300053092 Ga0500583_0000073 Ga0500583_0000073_47208_48041 274
58 3300001979 JGI24740J21852_10002630 JGI24740J21852_100026306 275
59 3300001989 JGI24739J22299_10010586 JGI24739J22299_100105864 275
60 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007200 275
61 3300003215 JGI25153J46596_10000504 JGI25153J46596_1000050420 275
62 3300003320 rootH2_10000086 rootH2_1000008637 275
63 3300003320 rootH2_10011701 rootH2_100117013 275
64 3300003320 rootH2_10012061 rootH2_1001206110 275
65 3300003322 rootL2_10058418 rootL2_100584182 275
66 3300003354 JGI25160J50197_1005566 JGI25160J50197_10055665 275
67 3300005290 Ga0065712_10068858 Ga0065712_100688585 275
68 3300005290 Ga0065712_10140653 Ga0065712_101406532 275
69 3300005327 Ga0070658_10038567 Ga0070658_100385672 275
70 3300005327 Ga0070658_10130421 Ga0070658_101304212 275
71 3300005328 Ga0070676_10091106 Ga0070676_100911063 275
72 3300005329 Ga0070683_100023035 Ga0070683_1000230352 275
73 3300005334 Ga0068869_100009577 Ga0068869_1000095774 275
74 3300005335 Ga0070666_10000156 Ga0070666_100001563 275
75 3300005336 Ga0070680_100002502 Ga0070680_1000025026 275
76 3300005338 Ga0068868_100130119 Ga0068868_1001301191 275
77 3300005339 Ga0070660_100002765 Ga0070660_1000027658 275
78 3300005339 Ga0070660_100063058 Ga0070660_1000630582 275
79 3300005339 Ga0070660_100257896 Ga0070660_1002578962 275
80 3300005340 Ga0070689_100074210 Ga0070689_1000742102 275
81 3300005340 Ga0070689_100160676 Ga0070689_1001606761 275
82 3300005341 Ga0070691_10026315 Ga0070691_100263152 275
83 3300005341 Ga0070691_10032087 Ga0070691_100320872 275
84 3300005347 Ga0070668_100132745 Ga0070668_1001327453 275
85 3300005347 Ga0070668_100525832 Ga0070668_1005258322 275
86 3300005354 Ga0070675_100450576 Ga0070675_1004505761 275
87 3300005355 Ga0070671_100039395 Ga0070671_1000393954 275
88 3300005366 Ga0070659_100008306 Ga0070659_1000083062 275
89 3300005366 Ga0070659_100024655 Ga0070659_1000246553 275
90 3300005367 Ga0070667_100103146 Ga0070667_1001031463 275
91 3300005367 Ga0070667_100138852 Ga0070667_1001388521 275
92 3300005455 Ga0070663_100005240 Ga0070663_1000052404 275
93 3300005455 Ga0070663_100122385 Ga0070663_1001223852 275
94 3300005458 Ga0070681_10005612 Ga0070681_100056128 275
95 3300005458 Ga0070681_10043871 Ga0070681_100438714 275
96 3300005459 Ga0068867_100062659 Ga0068867_1000626592 275
97 3300005466 Ga0070685_10006615 Ga0070685_100066155 275
98 3300005530 Ga0070679_100081152 Ga0070679_1000811523 275
99 3300005535 Ga0070684_100083955 Ga0070684_1000839552 275
100 3300005535 Ga0070684_100396569 Ga0070684_1003965691 275
101 3300005539 Ga0068853_100008359 Ga0068853_1000083593 275
102 3300005539 Ga0068853_100108434 Ga0068853_1001084342 275
103 3300005563 Ga0068855_100011365 Ga0068855_1000113657 275
104 3300005563 Ga0068855_100045137 Ga0068855_1000451373 275
105 3300005563 Ga0068855_100059205 Ga0068855_1000592052 275
106 3300005563 Ga0068855_100114823 Ga0068855_1001148232 275
107 3300005563 Ga0068855_100370342 Ga0068855_1003703422 275
108 3300005563 Ga0068855_100731917 Ga0068855_1007319172 275
109 3300005577 Ga0068857_100194065 Ga0068857_1001940652 275
110 3300005577 Ga0068857_100480919 Ga0068857_1004809192 275
111 3300005578 Ga0068854_100103631 Ga0068854_1001036313 275
112 3300005614 Ga0068856_100011272 Ga0068856_1000112725 275
113 3300005614 Ga0068856_100046985 Ga0068856_1000469852 275
114 3300005616 Ga0068852_100006114 Ga0068852_1000061144 275
115 3300005616 Ga0068852_100213697 Ga0068852_1002136972 275
116 3300005616 Ga0068852_100350768 Ga0068852_1003507682 275
117 3300005616 Ga0068852_100816483 Ga0068852_1008164832 275
118 3300005616 Ga0068852_100865497 Ga0068852_1008654971 275
119 3300005617 Ga0068859_100000024 Ga0068859_100000024151 275
120 3300005617 Ga0068859_100009051 Ga0068859_1000090517 275
121 3300005617 Ga0068859_100813144 Ga0068859_1008131442 275
122 3300005618 Ga0068864_100112016 Ga0068864_1001120163 275
123 3300005618 Ga0068864_100207604 Ga0068864_1002076042 275
124 3300005834 Ga0068851_10014050 Ga0068851_100140503 275
125 3300005841 Ga0068863_100005289 Ga0068863_10000528912 275
126 3300005841 Ga0068863_100013768 Ga0068863_1000137683 275
127 3300005841 Ga0068863_100021533 Ga0068863_1000215332 275
128 3300005841 Ga0068863_100027954 Ga0068863_1000279542 275
129 3300005842 Ga0068858_100001337 Ga0068858_1000013377 275
130 3300005842 Ga0068858_100024689 Ga0068858_1000246893 275
131 3300005843 Ga0068860_100063456 Ga0068860_1000634562 275
132 3300005983 Ga0081540_1002517 Ga0081540_10025173 275
133 3300006163 Ga0070715_10101088 Ga0070715_101010882 275
134 3300006195 Ga0075366_10259975 Ga0075366_102599751 275
135 3300006237 Ga0097621_100011501 Ga0097621_1000115014 275
136 3300006237 Ga0097621_100012295 Ga0097621_1000122955 275
137 3300006237 Ga0097621_100070799 Ga0097621_1000707992 275
138 3300006237 Ga0097621_100320578 Ga0097621_1003205782 275
139 3300006237 Ga0097621_100463759 Ga0097621_1004637591 275
140 3300006358 Ga0068871_100008693 Ga0068871_1000086935 275
141 3300006358 Ga0068871_100162650 Ga0068871_1001626502 275
142 3300006881 Ga0068865_100337333 Ga0068865_1003373332 275
143 3300006881 Ga0068865_100646166 Ga0068865_1006461661 275
144 3300006931 Ga0097620_100000024 Ga0097620_100000024151 275
145 3300006931 Ga0097620_100009051 Ga0097620_1000090517 275
146 3300006931 Ga0097620_100813248 Ga0097620_1008132481 275
147 3300009093 Ga0105240_10001825 Ga0105240_1000182520 275
148 3300009093 Ga0105240_10003650 Ga0105240_100036509 275
149 3300009093 Ga0105240_10049758 Ga0105240_100497582 275
150 3300009093 Ga0105240_10061512 Ga0105240_100615123 275
151 3300009094 Ga0111539_10112304 Ga0111539_101123042 275
152 3300009098 Ga0105245_10297901 Ga0105245_102979012 275
153 3300009101 Ga0105247_10010217 Ga0105247_100102174 275
154 3300009174 Ga0105241_10007297 Ga0105241_100072974 275
155 3300009174 Ga0105241_10084575 Ga0105241_100845751 275
156 3300009176 Ga0105242_10002120 Ga0105242_100021207 275
157 3300009176 Ga0105242_10038926 Ga0105242_100389262 275
158 3300009545 Ga0105237_10012826 Ga0105237_100128263 275
159 3300009545 Ga0105237_10069910 Ga0105237_100699102 275
160 3300009545 Ga0105237_10091138 Ga0105237_100911382 275
161 3300009553 Ga0105249_10016397 Ga0105249_100163973 275
162 3300009553 Ga0105249_10040087 Ga0105249_100400872 275
163 3300010375 Ga0105239_10000129 Ga0105239_1000012914 275
164 3300010375 Ga0105239_10001203 Ga0105239_1000120316 275
165 3300010375 Ga0105239_10040062 Ga0105239_100400623 275
166 3300010375 Ga0105239_10160582 Ga0105239_101605822 275
167 3300011119 Ga0105246_10070677 Ga0105246_100706772 275
168 3300011119 Ga0105246_10280364 Ga0105246_102803641 275
169 3300013100 Ga0157373_10000156 Ga0157373_1000015649 275
170 3300013100 Ga0157373_10014809 Ga0157373_100148093 275
171 3300013100 Ga0157373_10016368 Ga0157373_100163683 275
172 3300013100 Ga0157373_10025671 Ga0157373_100256712 275
173 3300013100 Ga0157373_10093757 Ga0157373_100937572 275
174 3300013102 Ga0157371_10003016 Ga0157371_100030162 275
175 3300013102 Ga0157371_10011577 Ga0157371_100115774 275
176 3300013102 Ga0157371_10032075 Ga0157371_100320753 275
177 3300013102 Ga0157371_10064314 Ga0157371_100643141 275
178 3300013102 Ga0157371_10119583 Ga0157371_101195832 275
179 3300013104 Ga0157370_10054419 Ga0157370_100544195 275
180 3300013104 Ga0157370_10070378 Ga0157370_100703782 275
181 3300013104 Ga0157370_10207226 Ga0157370_102072262 275
182 3300013104 Ga0157370_10341306 Ga0157370_103413062 275
183 3300013104 Ga0157370_10475597 Ga0157370_104755971 275
184 3300013105 Ga0157369_10031302 Ga0157369_100313025 275
185 3300013105 Ga0157369_10039431 Ga0157369_100394313 275
186 3300013105 Ga0157369_10239864 Ga0157369_102398641 275
187 3300013105 Ga0157369_10297476 Ga0157369_102974762 275
188 3300013105 Ga0157369_10570242 Ga0157369_105702422 275
189 3300013105 Ga0157369_10777611 Ga0157369_107776111 275
190 3300013296 Ga0157374_10000013 Ga0157374_10000013401 275
191 3300013296 Ga0157374_10320132 Ga0157374_103201322 275
192 3300013297 Ga0157378_10005987 Ga0157378_100059877 275
193 3300013297 Ga0157378_10020798 Ga0157378_100207985 275
194 3300013297 Ga0157378_10139349 Ga0157378_101393493 275
195 3300013306 Ga0163162_10000153 Ga0163162_100001538 275
196 3300013306 Ga0163162_10986333 Ga0163162_109863331 275
197 3300013307 Ga0157372_10000965 Ga0157372_1000096529 275
198 3300013307 Ga0157372_10017690 Ga0157372_100176903 275
199 3300013307 Ga0157372_10046379 Ga0157372_100463792 275
200 3300013307 Ga0157372_10062076 Ga0157372_100620765 275
201 3300013307 Ga0157372_10395632 Ga0157372_103956322 275
202 3300013308 Ga0157375_10058343 Ga0157375_100583431 275
203 3300013308 Ga0157375_10071152 Ga0157375_100711523 275
204 3300013308 Ga0157375_10245304 Ga0157375_102453042 275
205 3300014326 Ga0157380_10014743 Ga0157380_100147433 275
206 3300014326 Ga0157380_10329202 Ga0157380_103292022 275
207 3300014968 Ga0157379_10154700 Ga0157379_101547002 275
208 3300014969 Ga0157376_10001450 Ga0157376_100014504 275
209 3300014969 Ga0157376_10005592 Ga0157376_100055925 275
210 3300014969 Ga0157376_10028632 Ga0157376_100286322 275
211 3300017792 Ga0163161_10033483 Ga0163161_100334833 275
212 3300025246 Ga0209646_1000002 Ga0209646_1000002805 275
213 3300025250 Ga0209026_1000086 Ga0209026_100008669 275
214 3300025297 Ga0209758_1001590 Ga0209758_100159020 275
215 3300025302 Ga0207426_1000419 Ga0207426_100041936 275
216 3300025321 Ga0207656_10022735 Ga0207656_100227352 275
217 3300025900 Ga0207710_10023473 Ga0207710_100234731 275
218 3300025903 Ga0207680_10000523 Ga0207680_1000052312 275
219 3300025904 Ga0207647_10001709 Ga0207647_100017099 275
220 3300025905 Ga0207685_10149596 Ga0207685_101495962 275
221 3300025909 Ga0207705_10010201 Ga0207705_100102016 275
222 3300025909 Ga0207705_10108956 Ga0207705_101089563 275
223 3300025909 Ga0207705_10125994 Ga0207705_101259942 275
224 3300025909 Ga0207705_10187841 Ga0207705_101878412 275
225 3300025911 Ga0207654_10000412 Ga0207654_1000041212 275
226 3300025912 Ga0207707_10285613 Ga0207707_102856132 275
227 3300025913 Ga0207695_10000209 Ga0207695_1000020989 275
228 3300025913 Ga0207695_10000300 Ga0207695_1000030095 275
229 3300025913 Ga0207695_10000483 Ga0207695_100004833 275
230 3300025913 Ga0207695_10034657 Ga0207695_100346572 275
231 3300025913 Ga0207695_10261022 Ga0207695_102610221 275
232 3300025914 Ga0207671_10002294 Ga0207671_100022945 275
233 3300025914 Ga0207671_10056692 Ga0207671_100566923 275
234 3300025917 Ga0207660_10021915 Ga0207660_100219152 275
235 3300025919 Ga0207657_10006445 Ga0207657_100064458 275
236 3300025919 Ga0207657_10073115 Ga0207657_100731152 275
237 3300025919 Ga0207657_10154695 Ga0207657_101546952 275
238 3300025921 Ga0207652_10001292 Ga0207652_100012929 275
239 3300025921 Ga0207652_10012635 Ga0207652_100126355 275
240 3300025921 Ga0207652_10312998 Ga0207652_103129982 275
241 3300025924 Ga0207694_10173308 Ga0207694_101733082 275
242 3300025926 Ga0207659_10105747 Ga0207659_101057473 275
243 3300025932 Ga0207690_10138822 Ga0207690_101388222 275
244 3300025934 Ga0207686_10001888 Ga0207686_100018883 275
245 3300025934 Ga0207686_10261744 Ga0207686_102617442 275
246 3300025936 Ga0207670_10168815 Ga0207670_101688152 275
247 3300025936 Ga0207670_10231190 Ga0207670_102311902 275
248 3300025938 Ga0207704_10251775 Ga0207704_102517752 275
249 3300025938 Ga0207704_10378215 Ga0207704_103782152 275
250 3300025942 Ga0207689_10003921 Ga0207689_100039211 275
251 3300025944 Ga0207661_10005362 Ga0207661_100053623 275
252 3300025949 Ga0207667_10000323 Ga0207667_100003238 275
253 3300025949 Ga0207667_10010902 Ga0207667_100109026 275
254 3300025949 Ga0207667_10099521 Ga0207667_100995212 275
255 3300025949 Ga0207667_10185382 Ga0207667_101853823 275
256 3300025949 Ga0207667_10367008 Ga0207667_103670082 275
257 3300025949 Ga0207667_10670765 Ga0207667_106707652 275
258 3300025961 Ga0207712_10005522 Ga0207712_100055224 275
259 3300025961 Ga0207712_10106214 Ga0207712_101062142 275
260 3300025972 Ga0207668_10236442 Ga0207668_102364421 275
261 3300025972 Ga0207668_10257639 Ga0207668_102576392 275
262 3300025981 Ga0207640_10039554 Ga0207640_100395542 275
263 3300025981 Ga0207640_10429811 Ga0207640_104298111 275
264 3300025986 Ga0207658_10014562 Ga0207658_100145624 275
265 3300025986 Ga0207658_10054609 Ga0207658_100546092 275
266 3300026023 Ga0207677_10603507 Ga0207677_106035071 275
267 3300026035 Ga0207703_10000764 Ga0207703_1000076411 275
268 3300026035 Ga0207703_10024583 Ga0207703_100245832 275
269 3300026041 Ga0207639_10028574 Ga0207639_100285742 275
270 3300026041 Ga0207639_10038870 Ga0207639_100388704 275
271 3300026067 Ga0207678_10006605 Ga0207678_100066055 275
272 3300026067 Ga0207678_10085694 Ga0207678_100856943 275
273 3300026075 Ga0207708_10182631 Ga0207708_101826311 275
274 3300026078 Ga0207702_10057884 Ga0207702_100578843 275
275 3300026078 Ga0207702_10472655 Ga0207702_104726552 275
276 3300026088 Ga0207641_10000087 Ga0207641_10000087101 275
277 3300026088 Ga0207641_10000850 Ga0207641_1000085012 275
278 3300026088 Ga0207641_10012023 Ga0207641_100120235 275
279 3300026088 Ga0207641_10050774 Ga0207641_100507743 275
280 3300026089 Ga0207648_10005920 Ga0207648_100059202 275
281 3300026095 Ga0207676_10104379 Ga0207676_101043793 275
282 3300026095 Ga0207676_10817496 Ga0207676_108174961 275
283 3300026116 Ga0207674_10129058 Ga0207674_101290582 275
284 3300026116 Ga0207674_10207843 Ga0207674_102078432 275
285 3300026142 Ga0207698_10187805 Ga0207698_101878052 275
286 3300028381 Ga0268264_10048188 Ga0268264_100481884 275
287 3300028794 Ga0307515_10000059 Ga0307515_100000594 275
288 3300037068 Ga0373925_0235819 Ga0373925_0235819_116_943 275
289 3300037312 Ga0395899_0020659 Ga0395899_0020659_3087_3914 275
290 3300037312 Ga0395899_0043493 Ga0395899_0043493_154_981 275
291 3300037312 Ga0395899_0103888 Ga0395899_0103888_1177_2004 275
292 3300037418 Ga0395900_0032765 Ga0395900_0032765_2147_2974 275
293 3300037418 Ga0395900_0049936 Ga0395900_0049936_1574_2401 275
294 3300037418 Ga0395900_0157095 Ga0395900_0157095_642_1469 275
295 3300037418 Ga0395900_0206825 Ga0395900_0206825_116_943 275
296 3300037418 Ga0395900_0234988 Ga0395900_0234988_419_1246 275
297 3300037418 Ga0395900_0320418 Ga0395900_0320418_267_1094 275
298 3300037466 Ga0395898_0055068 Ga0395898_0055068_41_868 275
299 3300037466 Ga0395898_0713511 Ga0395898_0713511_40_867 275
300 3300037471 Ga0395905_0004874 Ga0395905_0004874_9375_10202 275
301 3300037471 Ga0395905_0625541 Ga0395905_0625541_119_946 275
302 3300038443 Ga0395901_0296705 Ga0395901_0296705_169_996 275
303 3300038443 Ga0395901_0299486 Ga0395901_0299486_78_905 275
304 3300038443 Ga0395901_0469585 Ga0395901_0469585_141_968 275
305 3300038443 Ga0395901_0770592 Ga0395901_0770592_49_876 275
306 3300042007 Ga0439449_0022930 Ga0439449_0022930_1498_2325 275
307 3300042134 Ga0450898_005089 Ga0450898_005089_320_1147 275
308 3300044656 Ga0466969_0086013 Ga0466969_0086013_358_1185 275
309 3300044693 Ga0466961_0018534 Ga0466961_0018534_1064_1891 275
310 3300044719 Ga0466971_0041572 Ga0466971_0041572_1150_1977 275
311 3300044765 Ga0466970_0039776 Ga0466970_0039776_1617_2444 275
312 3300044842 Ga0466957_0079479 Ga0466957_0079479_920_1747 275
313 3300045049 Ga0466959_0008177 Ga0466959_0008177_6534_7361 275
314 3300045836 Ga0466958_0077770 Ga0466958_0077770_980_1807 275
315 3300046648 Ga0495611_0000244 Ga0495611_0000244_16971_17798 275
316 3300046694 Ga0495649_0044918 Ga0495649_0044918_1282_2109 275
317 3300049571 Ga0501034_0058568 Ga0501034_0058568_2431_3258 275
318 3300049586 Ga0501070_0048805 Ga0501070_0048805_1037_1864 275
319 3300049688 Ga0501259_003308 Ga0501259_003308_464_1291 275
320 3300049823 Ga0501044_0161003 Ga0501044_0161003_1242_2069 275
321 3300050493 nmdc:mga0k408_286197_c1 nmdc:mga0k408_286197_c1_98_925 275
322 3300050511 nmdc:mga08y16_862729_c1 nmdc:mga08y16_862729_c1_45_872 275
323 3300053092 Ga0500583_0105255 Ga0500583_0105255_445_1272 275
324 3300053139 Ga0500568_0001011 Ga0500568_0001011_2269_3099 275
325 3300061719 Ga0466962_0069268 Ga0466962_0069268_328_1155 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

43

248

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dt0-assembly3.cif.gz_D proline hydroxylase h11-n101i mutant 0.8612 5 246
8h7y-assembly1.cif.gz_A trans-3/4-proline-hydroxylase h11 with akg and l-proline 0.851 6 246
8h81-assembly1.cif.gz_A trans-3/4-proline-hydroxylase h11 with 4-hydroxyl-proline 0.8488 1 246
7e09-assembly1.cif.gz_A-2 trans-3/4-proline-hydroxylase h11 with 3-hydroxyl-proline 0.8488 1 246
5ep9-assembly2.cif.gz_B crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8439 9 227
ID Description Score Start End Superfamily
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8225 113 235 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7816 9 247 2.60.120.620
af_A4HS32_63_336_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7738 7 228 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7716 95 226 2.60.120.620
2a1xA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7707 4 228 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A1M7NW12-F1-model_v4 Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family 0.9731 2 275 GO:0005506
GO:0016706
AF-A0A2Z4G9F2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9689 5 275 GO:0005506
GO:0016706
AF-A0A4Q3SDZ0-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9663 1 225 GO:0005506
GO:0016706
AF-A0A2Z4G9F2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9654 5 275 GO:0005506
GO:0016706
AF-A0A7W1W231-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9644 1 235 GO:0005506
GO:0016706

Feature Viewer

pLDDT pTM Quality
87.83 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map