F407556

General Info

Members Datasets Scaffolds Average Seq Length
324 131 324 102

Family's Representative Sequence

Representative Sequence 3300049521|Ga0501298_093398|Ga0501298_093398_100_378
Length 92
Sequence MADRKFNLHSGQKGSALAVRVTLEDGTIKVRIAAAPSDEESNVALIEFLAEILGIPKSQLDIVAGEAGRDKLVAVVDMDVDTAHQRILAHLG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
105 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
106 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.38
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1913544 2162886007 Bacteria 3661
2 JGI25406J46586_10000640 3300003203 Bacteria 16373
3 Ga0058859_10504959 3300004798 Bacteria 509
4 Ga0065704_10070377 3300005289 Bacteria 28140
5 Ga0065712_10287334 3300005290 Unclassified 884
6 Ga0065715_10353880 3300005293 Unclassified 938
7 Ga0065707_10000768 3300005295 Bacteria 12443
8 Ga0065707_10003492 3300005295 Bacteria 5962
9 Ga0065707_10081987 3300005295 Bacteria 26103
10 Ga0065707_10083293 3300005295 Bacteria 9627
11 Ga0065707_10129709 3300005295 Bacteria 1942
12 Ga0065707_10256245 3300005295 Bacteria 1110
13 Ga0065707_10258812 3300005295 Unclassified 1103
14 Ga0070689_100369551 3300005340 Unclassified 1207
15 Ga0070689_100649794 3300005340 Bacteria 917
16 Ga0070669_100237304 3300005353 Unclassified 1447
17 Ga0070673_101464505 3300005364 Unclassified 643
18 Ga0070688_101447556 3300005365 Unclassified 558
19 Ga0070703_10074679 3300005406 Unclassified 1140
20 Ga0070705_100447362 3300005440 Unclassified 968
21 Ga0070705_100538587 3300005440 Bacteria 893
22 Ga0070705_101023023 3300005440 Bacteria 672
23 Ga0070700_100558164 3300005441 Unclassified 891
24 Ga0070700_100671632 3300005441 Unclassified 820
25 Ga0070694_100062091 3300005444 Unclassified 2552
26 Ga0070694_100602171 3300005444 Bacteria 885
27 Ga0070694_101029320 3300005444 Bacteria 684
28 Ga0070662_100479667 3300005457 Unclassified 1035
29 Ga0070706_100224416 3300005467 Unclassified 1754
30 Ga0070706_100286578 3300005467 Bacteria 1537
31 Ga0070706_100963314 3300005467 Unclassified 787
32 Ga0070706_101309195 3300005467 Unclassified 664
33 Ga0070707_100480039 3300005468 Bacteria 1205
34 Ga0070698_100050908 3300005471 Unclassified 4219
35 Ga0070698_100232025 3300005471 Bacteria 1779
36 Ga0070698_100247260 3300005471 Bacteria 1716
37 Ga0070698_100256959 3300005471 Bacteria 1679
38 Ga0070698_100269182 3300005471 Bacteria 1635
39 Ga0070698_100359052 3300005471 Bacteria 1388
40 Ga0070698_102173566 3300005471 Unclassified 508
41 Ga0070699_100001469 3300005518 Bacteria 21556
42 Ga0070699_100026066 3300005518 Bacteria 5042
43 Ga0070699_100132223 3300005518 Bacteria 2200
44 Ga0070699_100146658 3300005518 Bacteria 2085
45 Ga0070697_100364856 3300005536 Bacteria 1249
46 Ga0070697_100688993 3300005536 Unclassified 901
47 Ga0070695_100215707 3300005545 Unclassified 1380
48 Ga0070695_100410073 3300005545 Unclassified 1029
49 Ga0070695_100803435 3300005545 Unclassified 754
50 Ga0070696_100220512 3300005546 Bacteria 1423
51 Ga0070696_100288193 3300005546 Unclassified 1254
52 Ga0070704_100026110 3300005549 Unclassified 3854
53 Ga0070704_100117097 3300005549 Bacteria 2038
54 Ga0070704_100260954 3300005549 Bacteria 1427
55 Ga0070704_101617048 3300005549 Unclassified 598
56 Ga0068857_100097389 3300005577 Bacteria 2637
57 Ga0068857_102150334 3300005577 Unclassified 548
58 Ga0070702_100950512 3300005615 Unclassified 677
59 Ga0068859_100054961 3300005617 Bacteria 4006
60 Ga0068859_100248311 3300005617 Bacteria 1870
61 Ga0068861_100396962 3300005719 Bacteria 1223
62 Ga0068861_100526179 3300005719 Unclassified 1073
63 Ga0068861_102080720 3300005719 Unclassified 567
64 Ga0068860_100393822 3300005843 Unclassified 1369
65 Ga0068860_101049885 3300005843 Unclassified 833
66 Ga0068862_100048496 3300005844 Unclassified 3626
67 Ga0068862_100062485 3300005844 Unclassified 3203
68 Ga0068862_100117606 3300005844 Bacteria 2339
69 Ga0068862_100782277 3300005844 Bacteria 931
70 Ga0081539_10003111 3300005985 Bacteria 21226
71 Ga0081539_10013995 3300005985 Bacteria 5980
72 Ga0075427_10001800 3300006194 Bacteria 2798
73 Ga0068871_101329323 3300006358 Unclassified 676
74 Ga0075428_100168303 3300006844 Bacteria 2377
75 Ga0075428_100291650 3300006844 Bacteria 1755
76 Ga0075428_100410285 3300006844 Bacteria 1451
77 Ga0075428_100676517 3300006844 Bacteria 1100
78 Ga0075428_101160259 3300006844 Unclassified 815
79 Ga0075430_100149003 3300006846 Unclassified 1948
80 Ga0075430_100296624 3300006846 Bacteria 1337
81 Ga0075430_100870357 3300006846 Unclassified 742
82 Ga0075431_100123283 3300006847 Bacteria 2674
83 Ga0075431_100141185 3300006847 Bacteria 2483
84 Ga0075431_100339494 3300006847 Unclassified 1512
85 Ga0075433_10387984 3300006852 Unclassified 1233
86 Ga0075433_10745398 3300006852 Unclassified 857
87 Ga0075433_11840293 3300006852 Unclassified 520
88 Ga0075433_11915274 3300006852 Unclassified 508
89 Ga0075434_100956105 3300006871 Unclassified 871
90 Ga0075429_100005207 3300006880 Bacteria 11184
91 Ga0075429_100043235 3300006880 Bacteria 3920
92 Ga0075429_100054287 3300006880 Bacteria 3486
93 Ga0075429_100070321 3300006880 Bacteria 3047
94 Ga0075429_100091954 3300006880 Bacteria 2647
95 Ga0075429_100178220 3300006880 Bacteria 1862
96 Ga0075429_100194373 3300006880 Bacteria 1777
97 Ga0075429_100922567 3300006880 Unclassified 764
98 Ga0075429_101844980 3300006880 Unclassified 524
99 Ga0097620_100054960 3300006931 Bacteria 4006
100 Ga0097620_100248294 3300006931 Bacteria 1870
101 Ga0111539_10937703 3300009094 Bacteria 1007
102 Ga0111539_11269978 3300009094 Unclassified 855
103 Ga0105245_13074940 3300009098 Unclassified 517
104 Ga0114129_10002036 3300009147 Bacteria 27722
105 Ga0114129_10013560 3300009147 Bacteria 11613
106 Ga0114129_10020412 3300009147 Bacteria 9423
107 Ga0114129_10257790 3300009147 Bacteria 2339
108 Ga0114129_10611329 3300009147 Bacteria 1411
109 Ga0114129_10808813 3300009147 Bacteria 1195
110 Ga0114129_10809945 3300009147 Bacteria 1194
111 Ga0114129_12213107 3300009147 Unclassified 661
112 Ga0105243_10036292 3300009148 Unclassified 3826
113 Ga0105243_10097667 3300009148 Bacteria 2432
114 Ga0105243_11329627 3300009148 Unclassified 737
115 Ga0105243_11651030 3300009148 Bacteria 669
116 Ga0105243_12485784 3300009148 Unclassified 557
117 Ga0105241_11535244 3300009174 Unclassified 642
118 Ga0105242_10255337 3300009176 Bacteria 1581
119 Ga0105249_10010673 3300009553 Bacteria 8069
120 Ga0105249_10188987 3300009553 Bacteria 2009
121 Ga0105249_10256544 3300009553 Bacteria 1735
122 Ga0105246_10037318 3300011119 Bacteria 3261
123 Ga0157378_12087821 3300013297 Unclassified 617
124 Ga0163162_11613551 3300013306 Unclassified 740
125 Ga0163163_12649198 3300014325 Unclassified 559
126 Ga0157380_10069859 3300014326 Bacteria 2836
127 Ga0157380_10396827 3300014326 Bacteria 1307
128 Ga0157380_12213957 3300014326 Unclassified 614
129 Ga0157377_11611291 3300014745 Unclassified 520
130 Ga0157379_11815443 3300014968 Unclassified 599
131 Ga0207653_10030613 3300025885 Bacteria 1737
132 Ga0207684_10469606 3300025910 Unclassified 1080
133 Ga0207684_10769898 3300025910 Unclassified 815
134 Ga0207684_11615443 3300025910 Unclassified 524
135 Ga0207660_10548468 3300025917 Bacteria 940
136 Ga0207646_10112815 3300025922 Bacteria 2440
137 Ga0207646_11519458 3300025922 Unclassified 579
138 Ga0207681_10149465 3300025923 Bacteria 1749
139 Ga0207686_10663794 3300025934 Unclassified 826
140 Ga0207709_10068446 3300025935 Unclassified 2244
141 Ga0207709_10901337 3300025935 Unclassified 719
142 Ga0207670_10531861 3300025936 Unclassified 958
143 Ga0207651_11732990 3300025960 Unclassified 562
144 Ga0207712_10177520 3300025961 Unclassified 1670
145 Ga0207712_11320587 3300025961 Bacteria 645
146 Ga0207708_10642385 3300026075 Unclassified 903
147 Ga0207674_10063762 3300026116 Bacteria 3718
148 Ga0207674_10451479 3300026116 Bacteria 1242
149 Ga0207674_10654289 3300026116 Unclassified 1015
150 Ga0207674_11413486 3300026116 Unclassified 665
151 Ga0207675_100207979 3300026118 Bacteria 1881
152 Ga0209981_1070278 3300027378 Unclassified 540
153 Ga0207428_10926004 3300027907 Unclassified 615
154 Ga0268265_10023275 3300028380 Unclassified 4366
155 Ga0268265_10147049 3300028380 Bacteria 1982
156 Ga0268265_11838836 3300028380 Unclassified 612
157 Ga0268264_10339698 3300028381 Unclassified 1426
158 Ga0265337_1087036 3300028556 Unclassified 853
159 Ga0265334_10022282 3300028573 Bacteria 2583
160 Ga0265336_10025045 3300028666 Bacteria 1881
161 Ga0265338_10910569 3300028800 Unclassified 598
162 Ga0265324_10114500 3300029957 Bacteria 916
163 Ga0265320_10037761 3300031240 Bacteria 2430
164 Ga0265320_10049914 3300031240 Bacteria 2036
165 Ga0265327_10024454 3300031251 Unclassified 3549
166 Ga0307408_100297345 3300031548 Bacteria 1351
167 Ga0316575_10021651 3300031665 Bacteria 2477
168 Ga0316579_10146704 3300031691 Bacteria 1138
169 Ga0316579_10437112 3300031691 Unclassified 633
170 Ga0316578_10301145 3300031728 Unclassified 959
171 Ga0316578_10435240 3300031728 Unclassified 776
172 Ga0307405_11119348 3300031731 Unclassified 677
173 Ga0316577_10031102 3300031733 Unclassified 2982
174 Ga0307413_10106205 3300031824 Bacteria 1868
175 Ga0307410_11319706 3300031852 Unclassified 631
176 Ga0307406_10123942 3300031901 Bacteria 1802
177 Ga0307407_10075169 3300031903 Unclassified 2024
178 Ga0307412_10184491 3300031911 Bacteria 1572
179 Ga0307409_100932422 3300031995 Unclassified 883
180 Ga0307416_100915327 3300032002 Unclassified 977
181 Ga0307416_101084620 3300032002 Unclassified 905
182 Ga0307415_100735532 3300032126 Bacteria 894
183 Ga0307415_100735977 3300032126 Unclassified 894
184 Ga0307415_101208607 3300032126 Unclassified 712
185 Ga0316596_1110007 3300033541 Unclassified 748
186 Ga0373932_0116524 3300035112 Bacteria 887
187 Ga0316574_0851831 3300035398 Bacteria 553
188 Ga0316582_0122968 3300036647 Bacteria 1738
189 Ga0316582_0429954 3300036647 Unclassified 910
190 Ga0316582_0674514 3300036647 Unclassified 710
191 Ga0316584_0076565 3300036712 Unclassified 2507
192 Ga0316584_0086805 3300036712 Bacteria 2342
193 Ga0316584_0137248 3300036712 Unclassified 1825
194 Ga0316581_0192106 3300037588 Unclassified 629
195 Ga0316581_0249023 3300037588 Bacteria 546
196 Ga0451841_0711691 3300041498 Bacteria 759
197 Ga0451577_0071206 3300042876 Bacteria 3100
198 Ga0451577_0100391 3300042876 Bacteria 2585
199 Ga0451577_0186869 3300042876 Bacteria 1869
200 Ga0451577_0215199 3300042876 Bacteria 1736
201 Ga0451577_0260813 3300042876 Unclassified 1569
202 Ga0451577_0388468 3300042876 Bacteria 1267
203 Ga0451577_0471332 3300042876 Unclassified 1140
204 Ga0451577_0673516 3300042876 Unclassified 938
205 Ga0451577_0698337 3300042876 Bacteria 919
206 Ga0451577_0736105 3300042876 Bacteria 892
207 Ga0451577_0851137 3300042876 Bacteria 822
208 Ga0451577_0962101 3300042876 Unclassified 768
209 Ga0451577_1132400 3300042876 Bacteria 699
210 Ga0451577_1188993 3300042876 Unclassified 680
211 Ga0451577_1365881 3300042876 Unclassified 629
212 Ga0451577_1475780 3300042876 Unclassified 602
213 Ga0451577_1918221 3300042876 Unclassified 518
214 Ga0453683_0002551 3300044673 Bacteria 14041
215 Ga0453683_0006582 3300044673 Bacteria 7962
216 Ga0453683_0035521 3300044673 Bacteria 3140
217 Ga0453683_0143409 3300044673 Bacteria 1508
218 Ga0453683_0227011 3300044673 Unclassified 1188
219 Ga0453683_0254217 3300044673 Bacteria 1120
220 Ga0453683_0307857 3300044673 Unclassified 1014
221 Ga0453683_0616291 3300044673 Bacteria 708
222 Ga0453683_0674821 3300044673 Unclassified 676
223 Ga0453683_0884933 3300044673 Bacteria 590
224 Ga0453684_0000044 3300044712 Bacteria 585643
225 Ga0453684_0000055 3300044712 Bacteria 532014
226 Ga0453684_0000720 3300044712 Bacteria 116865
227 Ga0453684_0002233 3300044712 Bacteria 48026
228 Ga0453684_0005126 3300044712 Bacteria 26372
229 Ga0453684_0006211 3300044712 Bacteria 22912
230 Ga0453684_0017849 3300044712 Bacteria 10951
231 Ga0453684_0101307 3300044712 Bacteria 3524
232 Ga0453684_0122123 3300044712 Bacteria 3143
233 Ga0453684_0152719 3300044712 Bacteria 2741
234 Ga0453684_0161561 3300044712 Bacteria 2649
235 Ga0453684_0162744 3300044712 Unclassified 2637
236 Ga0453684_0195759 3300044712 Bacteria 2361
237 Ga0453684_0264769 3300044712 Unclassified 1967
238 Ga0453684_0277335 3300044712 Bacteria 1913
239 Ga0453684_0471684 3300044712 Bacteria 1394
240 Ga0453684_0563646 3300044712 Bacteria 1253
241 Ga0453684_0577892 3300044712 Bacteria 1234
242 Ga0453684_0641058 3300044712 Bacteria 1160
243 Ga0453684_0714705 3300044712 Bacteria 1088
244 Ga0453684_0738716 3300044712 Bacteria 1066
245 Ga0453684_0745511 3300044712 Bacteria 1061
246 Ga0453684_0772735 3300044712 Bacteria 1038
247 Ga0453684_0794352 3300044712 Bacteria 1021
248 Ga0453684_0798737 3300044712 Unclassified 1018
249 Ga0453684_0986967 3300044712 Bacteria 896
250 Ga0453684_1020644 3300044712 Bacteria 878
251 Ga0453684_1230320 3300044712 Unclassified 784
252 Ga0453684_1562761 3300044712 Unclassified 678
253 Ga0451576_0012761 3300045051 Bacteria 9429
254 Ga0451576_0054835 3300045051 Bacteria 4172
255 Ga0451576_0080277 3300045051 Unclassified 3394
256 Ga0451576_0150782 3300045051 Bacteria 2425
257 Ga0451576_0153772 3300045051 Bacteria 2399
258 Ga0451576_0237294 3300045051 Bacteria 1904
259 Ga0451576_0649659 3300045051 Bacteria 1108
260 Ga0451576_0661122 3300045051 Bacteria 1098
261 Ga0451576_1199191 3300045051 Unclassified 793
262 Ga0451576_1996550 3300045051 Unclassified 598
263 Ga0451576_2234326 3300045051 Unclassified 561
264 Ga0501292_088365 3300049515 Unclassified 599
265 Ga0501298_093398 3300049521 Unclassified 677
266 Ga0501298_128863 3300049521 Unclassified 602
267 Ga0501299_053722 3300049522 Unclassified 838
268 Ga0501031_0493813 3300049568 Bacteria 790
269 Ga0501036_0353171 3300049572 Unclassified 1228
270 Ga0501040_0033836 3300049576 Unclassified 3464
271 Ga0501040_0051814 3300049576 Bacteria 2808
272 Ga0501042_0215246 3300049578 Bacteria 1386
273 Ga0501042_0523283 3300049578 Unclassified 862
274 Ga0501046_0724979 3300049580 Unclassified 699
275 Ga0501048_1329910 3300049582 Unclassified 517
276 Ga0501071_0423236 3300049587 Unclassified 1018
277 Ga0501071_1383857 3300049587 Unclassified 543
278 Ga0501072_0568175 3300049588 Unclassified 895
279 Ga0501073_1170943 3300049589 Unclassified 528
280 Ga0501074_0029250 3300049590 Bacteria 3991
281 Ga0501075_0217918 3300049591 Unclassified 1456
282 Ga0501075_1089917 3300049591 Unclassified 606
283 Ga0501076_0071569 3300049592 Unclassified 2774
284 Ga0501076_0354233 3300049592 Unclassified 1205
285 Ga0501079_0108092 3300049741 Unclassified 2160
286 Ga0501079_0350224 3300049741 Unclassified 1157
287 Ga0501079_1041056 3300049741 Unclassified 645
288 Ga0501080_0037821 3300049742 Bacteria 4506
289 Ga0501081_0210718 3300049743 Unclassified 1411
290 Ga0501081_0434798 3300049743 Unclassified 974
291 Ga0501081_0534199 3300049743 Unclassified 875
292 Ga0501035_1190354 3300049822 Unclassified 592
293 nmdc:mga05p37_14603_c1 3300050507 Bacteria 2968
294 nmdc:mga05p37_160546_c1 3300050507 Bacteria 2746
295 nmdc:mga05p37_190203_c1 3300050507 Bacteria 2493
296 nmdc:mga05p37_210652_c1 3300050507 Bacteria 2350
297 nmdc:mga05p37_230804_c1 3300050507 Bacteria 2230
298 nmdc:mga05p37_45394_c1 3300050507 Bacteria 5404
299 nmdc:mga05p37_680271_c1 3300050507 Bacteria 1147
300 nmdc:mga09592_1663109_c1 3300050508 Bacteria 516
301 nmdc:mga09592_4331_c1 3300050508 Bacteria 11472
302 nmdc:mga09592_440034_c1 3300050508 Bacteria 1125
303 nmdc:mga09592_66397_c1 3300050508 Bacteria 3057
304 nmdc:mga09592_67324_c1 3300050508 Bacteria 3037
305 nmdc:mga09592_701722_c1 3300050508 Unclassified 861
306 nmdc:mga09592_796569_c1 3300050508 Unclassified 800
307 nmdc:mga0qj67_110080_c1 3300050509 Bacteria 2223
308 nmdc:mga0qj67_578897_c1 3300050509 Unclassified 899
309 nmdc:mga06r32_168796_c1 3300050510 Bacteria 2171
310 nmdc:mga06r32_494902_c1 3300050510 Unclassified 1200
311 nmdc:mga06r32_957882_c1 3300050510 Bacteria 810
312 nmdc:mga0n895_883577_c1 3300050512 Unclassified 880
313 nmdc:mga0a205_151377_c1 3300050515 Bacteria 2219
314 nmdc:mga0a205_24153_c1 3300050515 Bacteria 5773
315 nmdc:mga0a205_464580_c1 3300050515 Unclassified 1125
316 nmdc:mga0a205_790198_c1 3300050515 Unclassified 797
317 Ga0501084_0258756 3300054114 Unclassified 1469
318 Ga0501084_0642675 3300054114 Bacteria 896
319 Ga0501084_0767167 3300054114 Bacteria 812
320 Ga0501082_0748799 3300060353 Unclassified 855
321 Ga0501082_0876830 3300060353 Unclassified 785
322 Ga0501082_0964795 3300060353 Unclassified 745
323 Ga0530510_1160440 3300061734 Unclassified 592
324 Ga0530510_1202129 3300061734 Unclassified 581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049522 Ga0501299_053722 Ga0501299_053722_22_273 83
2 3300060353 Ga0501082_0876830 Ga0501082_0876830_17_271 83
3 3300061734 Ga0530510_1160440 Ga0530510_1160440_315_569 83
4 3300044712 Ga0453684_0152719 Ga0453684_0152719_17_274 85
5 3300044712 Ga0453684_1020644 Ga0453684_1020644_605_862 85
6 3300061734 Ga0530510_1202129 Ga0530510_1202129_18_275 85
7 3300049521 Ga0501298_093398 Ga0501298_093398_100_378 92
8 3300044712 Ga0453684_0794352 Ga0453684_0794352_13_303 96
9 3300049588 Ga0501072_0568175 Ga0501072_0568175_123_416 96
10 3300049592 Ga0501076_0354233 Ga0501076_0354233_247_540 96
11 3300036647 Ga0316582_0122968 Ga0316582_0122968_563_886 101
12 3300036647 Ga0316582_0429954 Ga0316582_0429954_347_670 101
13 3300037588 Ga0316581_0249023 Ga0316581_0249023_149_472 101
14 3300042876 Ga0451577_0100391 Ga0451577_0100391_1704_2009 101
15 3300044712 Ga0453684_0005126 Ga0453684_0005126_6882_7187 101
16 3300041498 Ga0451841_0711691 Ga0451841_0711691_238_546 102
17 3300042876 Ga0451577_0071206 Ga0451577_0071206_417_725 102
18 3300042876 Ga0451577_0260813 Ga0451577_0260813_742_1050 102
19 3300042876 Ga0451577_0962101 Ga0451577_0962101_378_686 102
20 3300042876 Ga0451577_1132400 Ga0451577_1132400_266_574 102
21 3300042876 Ga0451577_1365881 Ga0451577_1365881_291_599 102
22 3300042876 Ga0451577_1475780 Ga0451577_1475780_27_335 102
23 3300042876 Ga0451577_1918221 Ga0451577_1918221_79_387 102
24 3300044673 Ga0453683_0002551 Ga0453683_0002551_2791_3099 102
25 3300044673 Ga0453683_0006582 Ga0453683_0006582_473_781 102
26 3300044673 Ga0453683_0035521 Ga0453683_0035521_103_411 102
27 3300044673 Ga0453683_0143409 Ga0453683_0143409_852_1160 102
28 3300044673 Ga0453683_0884933 Ga0453683_0884933_53_361 102
29 3300044712 Ga0453684_0000044 Ga0453684_0000044_288692_289000 102
30 3300044712 Ga0453684_0002233 Ga0453684_0002233_32923_33231 102
31 3300044712 Ga0453684_0006211 Ga0453684_0006211_13765_14073 102
32 3300044712 Ga0453684_0017849 Ga0453684_0017849_7352_7660 102
33 3300044712 Ga0453684_0101307 Ga0453684_0101307_2788_3096 102
34 3300044712 Ga0453684_0161561 Ga0453684_0161561_81_389 102
35 3300044712 Ga0453684_0162744 Ga0453684_0162744_2018_2326 102
36 3300044712 Ga0453684_0195759 Ga0453684_0195759_287_595 102
37 3300044712 Ga0453684_0277335 Ga0453684_0277335_1445_1753 102
38 3300044712 Ga0453684_0641058 Ga0453684_0641058_738_1046 102
39 3300044712 Ga0453684_0714705 Ga0453684_0714705_424_732 102
40 3300044712 Ga0453684_0738716 Ga0453684_0738716_674_982 102
41 3300044712 Ga0453684_0745511 Ga0453684_0745511_312_620 102
42 3300044712 Ga0453684_0772735 Ga0453684_0772735_259_567 102
43 3300044712 Ga0453684_1230320 Ga0453684_1230320_346_654 102
44 3300045051 Ga0451576_0012761 Ga0451576_0012761_4206_4514 102
45 3300045051 Ga0451576_0080277 Ga0451576_0080277_922_1230 102
46 3300045051 Ga0451576_0150782 Ga0451576_0150782_142_450 102
47 3300045051 Ga0451576_0237294 Ga0451576_0237294_1220_1528 102
48 3300045051 Ga0451576_2234326 Ga0451576_2234326_19_327 102
49 2162886007 SwRhRL2b_contig_1913544 SwRhRL2b_0664.00002320 103
50 3300003203 JGI25406J46586_10000640 JGI25406J46586_100006407 103
51 3300004798 Ga0058859_10504959 Ga0058859_105049591 103
52 3300005289 Ga0065704_10070377 Ga0065704_100703778 103
53 3300005290 Ga0065712_10287334 Ga0065712_102873342 103
54 3300005293 Ga0065715_10353880 Ga0065715_103538803 103
55 3300005295 Ga0065707_10000768 Ga0065707_100007687 103
56 3300005295 Ga0065707_10003492 Ga0065707_100034924 103
57 3300005295 Ga0065707_10081987 Ga0065707_100819875 103
58 3300005295 Ga0065707_10083293 Ga0065707_100832936 103
59 3300005295 Ga0065707_10129709 Ga0065707_101297092 103
60 3300005295 Ga0065707_10256245 Ga0065707_102562453 103
61 3300005295 Ga0065707_10258812 Ga0065707_102588121 103
62 3300005340 Ga0070689_100369551 Ga0070689_1003695512 103
63 3300005340 Ga0070689_100649794 Ga0070689_1006497941 103
64 3300005353 Ga0070669_100237304 Ga0070669_1002373043 103
65 3300005364 Ga0070673_101464505 Ga0070673_1014645051 103
66 3300005365 Ga0070688_101447556 Ga0070688_1014475561 103
67 3300005406 Ga0070703_10074679 Ga0070703_100746792 103
68 3300005440 Ga0070705_100447362 Ga0070705_1004473621 103
69 3300005440 Ga0070705_100538587 Ga0070705_1005385871 103
70 3300005440 Ga0070705_101023023 Ga0070705_1010230232 103
71 3300005441 Ga0070700_100558164 Ga0070700_1005581642 103
72 3300005441 Ga0070700_100671632 Ga0070700_1006716323 103
73 3300005444 Ga0070694_100062091 Ga0070694_1000620914 103
74 3300005444 Ga0070694_100602171 Ga0070694_1006021713 103
75 3300005444 Ga0070694_101029320 Ga0070694_1010293202 103
76 3300005457 Ga0070662_100479667 Ga0070662_1004796671 103
77 3300005467 Ga0070706_100224416 Ga0070706_1002244163 103
78 3300005467 Ga0070706_100286578 Ga0070706_1002865783 103
79 3300005467 Ga0070706_100963314 Ga0070706_1009633142 103
80 3300005467 Ga0070706_101309195 Ga0070706_1013091952 103
81 3300005468 Ga0070707_100480039 Ga0070707_1004800393 103
82 3300005471 Ga0070698_100050908 Ga0070698_1000509084 103
83 3300005471 Ga0070698_100232025 Ga0070698_1002320253 103
84 3300005471 Ga0070698_100247260 Ga0070698_1002472603 103
85 3300005471 Ga0070698_100256959 Ga0070698_1002569591 103
86 3300005471 Ga0070698_100269182 Ga0070698_1002691822 103
87 3300005471 Ga0070698_100359052 Ga0070698_1003590521 103
88 3300005471 Ga0070698_102173566 Ga0070698_1021735661 103
89 3300005518 Ga0070699_100001469 Ga0070699_10000146928 103
90 3300005518 Ga0070699_100026066 Ga0070699_1000260665 103
91 3300005518 Ga0070699_100132223 Ga0070699_1001322232 103
92 3300005518 Ga0070699_100146658 Ga0070699_1001466582 103
93 3300005536 Ga0070697_100364856 Ga0070697_1003648562 103
94 3300005536 Ga0070697_100688993 Ga0070697_1006889931 103
95 3300005545 Ga0070695_100215707 Ga0070695_1002157073 103
96 3300005545 Ga0070695_100410073 Ga0070695_1004100732 103
97 3300005545 Ga0070695_100803435 Ga0070695_1008034351 103
98 3300005546 Ga0070696_100220512 Ga0070696_1002205121 103
99 3300005546 Ga0070696_100288193 Ga0070696_1002881931 103
100 3300005549 Ga0070704_100026110 Ga0070704_1000261103 103
101 3300005549 Ga0070704_100117097 Ga0070704_1001170972 103
102 3300005549 Ga0070704_100260954 Ga0070704_1002609543 103
103 3300005549 Ga0070704_101617048 Ga0070704_1016170481 103
104 3300005577 Ga0068857_100097389 Ga0068857_1000973894 103
105 3300005577 Ga0068857_102150334 Ga0068857_1021503342 103
106 3300005615 Ga0070702_100950512 Ga0070702_1009505121 103
107 3300005617 Ga0068859_100054961 Ga0068859_1000549612 103
108 3300005617 Ga0068859_100248311 Ga0068859_1002483111 103
109 3300005719 Ga0068861_100396962 Ga0068861_1003969622 103
110 3300005719 Ga0068861_100526179 Ga0068861_1005261793 103
111 3300005719 Ga0068861_102080720 Ga0068861_1020807202 103
112 3300005843 Ga0068860_100393822 Ga0068860_1003938222 103
113 3300005843 Ga0068860_101049885 Ga0068860_1010498852 103
114 3300005844 Ga0068862_100048496 Ga0068862_1000484966 103
115 3300005844 Ga0068862_100062485 Ga0068862_1000624855 103
116 3300005844 Ga0068862_100117606 Ga0068862_1001176064 103
117 3300005844 Ga0068862_100782277 Ga0068862_1007822773 103
118 3300005985 Ga0081539_10003111 Ga0081539_1000311120 103
119 3300005985 Ga0081539_10013995 Ga0081539_100139958 103
120 3300006194 Ga0075427_10001800 Ga0075427_100018003 103
121 3300006358 Ga0068871_101329323 Ga0068871_1013293231 103
122 3300006844 Ga0075428_100168303 Ga0075428_1001683033 103
123 3300006844 Ga0075428_100291650 Ga0075428_1002916503 103
124 3300006844 Ga0075428_100410285 Ga0075428_1004102852 103
125 3300006844 Ga0075428_100676517 Ga0075428_1006765172 103
126 3300006844 Ga0075428_101160259 Ga0075428_1011602592 103
127 3300006846 Ga0075430_100149003 Ga0075430_1001490032 103
128 3300006846 Ga0075430_100296624 Ga0075430_1002966242 103
129 3300006846 Ga0075430_100870357 Ga0075430_1008703572 103
130 3300006847 Ga0075431_100123283 Ga0075431_1001232833 103
131 3300006847 Ga0075431_100141185 Ga0075431_1001411852 103
132 3300006847 Ga0075431_100339494 Ga0075431_1003394943 103
133 3300006852 Ga0075433_10387984 Ga0075433_103879843 103
134 3300006852 Ga0075433_10745398 Ga0075433_107453982 103
135 3300006852 Ga0075433_11840293 Ga0075433_118402932 103
136 3300006852 Ga0075433_11915274 Ga0075433_119152741 103
137 3300006871 Ga0075434_100956105 Ga0075434_1009561053 103
138 3300006880 Ga0075429_100005207 Ga0075429_1000052077 103
139 3300006880 Ga0075429_100043235 Ga0075429_1000432352 103
140 3300006880 Ga0075429_100054287 Ga0075429_1000542872 103
141 3300006880 Ga0075429_100070321 Ga0075429_1000703211 103
142 3300006880 Ga0075429_100091954 Ga0075429_1000919543 103
143 3300006880 Ga0075429_100178220 Ga0075429_1001782202 103
144 3300006880 Ga0075429_100194373 Ga0075429_1001943733 103
145 3300006880 Ga0075429_100922567 Ga0075429_1009225672 103
146 3300006880 Ga0075429_101844980 Ga0075429_1018449802 103
147 3300006931 Ga0097620_100054960 Ga0097620_1000549606 103
148 3300006931 Ga0097620_100248294 Ga0097620_1002482941 103
149 3300009094 Ga0111539_10937703 Ga0111539_109377032 103
150 3300009094 Ga0111539_11269978 Ga0111539_112699783 103
151 3300009098 Ga0105245_13074940 Ga0105245_130749402 103
152 3300009147 Ga0114129_10002036 Ga0114129_100020367 103
153 3300009147 Ga0114129_10013560 Ga0114129_100135603 103
154 3300009147 Ga0114129_10020412 Ga0114129_100204124 103
155 3300009147 Ga0114129_10257790 Ga0114129_102577902 103
156 3300009147 Ga0114129_10611329 Ga0114129_106113292 103
157 3300009147 Ga0114129_10808813 Ga0114129_108088133 103
158 3300009147 Ga0114129_10809945 Ga0114129_108099453 103
159 3300009147 Ga0114129_12213107 Ga0114129_122131071 103
160 3300009148 Ga0105243_10036292 Ga0105243_100362924 103
161 3300009148 Ga0105243_10097667 Ga0105243_100976672 103
162 3300009148 Ga0105243_11329627 Ga0105243_113296271 103
163 3300009148 Ga0105243_11651030 Ga0105243_116510301 103
164 3300009148 Ga0105243_12485784 Ga0105243_124857841 103
165 3300009174 Ga0105241_11535244 Ga0105241_115352442 103
166 3300009176 Ga0105242_10255337 Ga0105242_102553372 103
167 3300009553 Ga0105249_10010673 Ga0105249_100106735 103
168 3300009553 Ga0105249_10188987 Ga0105249_101889872 103
169 3300009553 Ga0105249_10256544 Ga0105249_102565442 103
170 3300011119 Ga0105246_10037318 Ga0105246_100373182 103
171 3300013297 Ga0157378_12087821 Ga0157378_120878212 103
172 3300013306 Ga0163162_11613551 Ga0163162_116135512 103
173 3300014325 Ga0163163_12649198 Ga0163163_126491982 103
174 3300014326 Ga0157380_10069859 Ga0157380_100698595 103
175 3300014326 Ga0157380_10396827 Ga0157380_103968273 103
176 3300014326 Ga0157380_12213957 Ga0157380_122139571 103
177 3300014745 Ga0157377_11611291 Ga0157377_116112912 103
178 3300014968 Ga0157379_11815443 Ga0157379_118154431 103
179 3300025885 Ga0207653_10030613 Ga0207653_100306133 103
180 3300025910 Ga0207684_10469606 Ga0207684_104696063 103
181 3300025910 Ga0207684_10769898 Ga0207684_107698982 103
182 3300025910 Ga0207684_11615443 Ga0207684_116154432 103
183 3300025917 Ga0207660_10548468 Ga0207660_105484681 103
184 3300025922 Ga0207646_10112815 Ga0207646_101128152 103
185 3300025922 Ga0207646_11519458 Ga0207646_115194581 103
186 3300025923 Ga0207681_10149465 Ga0207681_101494654 103
187 3300025934 Ga0207686_10663794 Ga0207686_106637942 103
188 3300025935 Ga0207709_10068446 Ga0207709_100684462 103
189 3300025935 Ga0207709_10901337 Ga0207709_109013372 103
190 3300025936 Ga0207670_10531861 Ga0207670_105318612 103
191 3300025960 Ga0207651_11732990 Ga0207651_117329901 103
192 3300025961 Ga0207712_10177520 Ga0207712_101775202 103
193 3300025961 Ga0207712_11320587 Ga0207712_113205872 103
194 3300026075 Ga0207708_10642385 Ga0207708_106423852 103
195 3300026116 Ga0207674_10063762 Ga0207674_100637625 103
196 3300026116 Ga0207674_10451479 Ga0207674_104514791 103
197 3300026116 Ga0207674_10654289 Ga0207674_106542892 103
198 3300026116 Ga0207674_11413486 Ga0207674_114134861 103
199 3300026118 Ga0207675_100207979 Ga0207675_1002079794 103
200 3300027378 Ga0209981_1070278 Ga0209981_10702781 103
201 3300027907 Ga0207428_10926004 Ga0207428_109260042 103
202 3300028380 Ga0268265_10023275 Ga0268265_100232756 103
203 3300028380 Ga0268265_10147049 Ga0268265_101470493 103
204 3300028380 Ga0268265_11838836 Ga0268265_118388362 103
205 3300028381 Ga0268264_10339698 Ga0268264_103396983 103
206 3300028556 Ga0265337_1087036 Ga0265337_10870362 103
207 3300028573 Ga0265334_10022282 Ga0265334_100222824 103
208 3300028666 Ga0265336_10025045 Ga0265336_100250452 103
209 3300028800 Ga0265338_10910569 Ga0265338_109105692 103
210 3300029957 Ga0265324_10114500 Ga0265324_101145002 103
211 3300031240 Ga0265320_10037761 Ga0265320_100377612 103
212 3300031240 Ga0265320_10049914 Ga0265320_100499141 103
213 3300031251 Ga0265327_10024454 Ga0265327_100244543 103
214 3300031548 Ga0307408_100297345 Ga0307408_1002973453 103
215 3300031665 Ga0316575_10021651 Ga0316575_100216512 103
216 3300031691 Ga0316579_10146704 Ga0316579_101467043 103
217 3300031691 Ga0316579_10437112 Ga0316579_104371122 103
218 3300031728 Ga0316578_10301145 Ga0316578_103011452 103
219 3300031728 Ga0316578_10435240 Ga0316578_104352402 103
220 3300031731 Ga0307405_11119348 Ga0307405_111193482 103
221 3300031733 Ga0316577_10031102 Ga0316577_100311024 103
222 3300031824 Ga0307413_10106205 Ga0307413_101062052 103
223 3300031852 Ga0307410_11319706 Ga0307410_113197061 103
224 3300031901 Ga0307406_10123942 Ga0307406_101239423 103
225 3300031903 Ga0307407_10075169 Ga0307407_100751694 103
226 3300031911 Ga0307412_10184491 Ga0307412_101844912 103
227 3300031995 Ga0307409_100932422 Ga0307409_1009324221 103
228 3300032002 Ga0307416_100915327 Ga0307416_1009153272 103
229 3300032002 Ga0307416_101084620 Ga0307416_1010846201 103
230 3300032126 Ga0307415_100735532 Ga0307415_1007355321 103
231 3300032126 Ga0307415_100735977 Ga0307415_1007359772 103
232 3300032126 Ga0307415_101208607 Ga0307415_1012086072 103
233 3300033541 Ga0316596_1110007 Ga0316596_11100071 103
234 3300035112 Ga0373932_0116524 Ga0373932_0116524_527_838 103
235 3300035398 Ga0316574_0851831 Ga0316574_0851831_140_451 103
236 3300036647 Ga0316582_0674514 Ga0316582_0674514_118_429 103
237 3300036712 Ga0316584_0076565 Ga0316584_0076565_207_518 103
238 3300036712 Ga0316584_0086805 Ga0316584_0086805_1370_1681 103
239 3300036712 Ga0316584_0137248 Ga0316584_0137248_1029_1340 103
240 3300037588 Ga0316581_0192106 Ga0316581_0192106_266_577 103
241 3300042876 Ga0451577_0186869 Ga0451577_0186869_601_912 103
242 3300042876 Ga0451577_0215199 Ga0451577_0215199_676_990 103
243 3300042876 Ga0451577_0388468 Ga0451577_0388468_805_1116 103
244 3300042876 Ga0451577_0471332 Ga0451577_0471332_373_684 103
245 3300042876 Ga0451577_0673516 Ga0451577_0673516_599_910 103
246 3300042876 Ga0451577_0698337 Ga0451577_0698337_95_406 103
247 3300042876 Ga0451577_0736105 Ga0451577_0736105_291_602 103
248 3300042876 Ga0451577_0851137 Ga0451577_0851137_470_781 103
249 3300042876 Ga0451577_1188993 Ga0451577_1188993_94_405 103
250 3300044673 Ga0453683_0227011 Ga0453683_0227011_408_719 103
251 3300044673 Ga0453683_0254217 Ga0453683_0254217_322_633 103
252 3300044673 Ga0453683_0307857 Ga0453683_0307857_679_990 103
253 3300044673 Ga0453683_0616291 Ga0453683_0616291_285_596 103
254 3300044673 Ga0453683_0674821 Ga0453683_0674821_231_542 103
255 3300044712 Ga0453684_0000055 Ga0453684_0000055_446669_446983 103
256 3300044712 Ga0453684_0000720 Ga0453684_0000720_61034_61345 103
257 3300044712 Ga0453684_0122123 Ga0453684_0122123_2755_3066 103
258 3300044712 Ga0453684_0264769 Ga0453684_0264769_1095_1406 103
259 3300044712 Ga0453684_0471684 Ga0453684_0471684_489_800 103
260 3300044712 Ga0453684_0563646 Ga0453684_0563646_888_1199 103
261 3300044712 Ga0453684_0577892 Ga0453684_0577892_282_593 103
262 3300044712 Ga0453684_0798737 Ga0453684_0798737_10_321 103
263 3300044712 Ga0453684_0986967 Ga0453684_0986967_500_811 103
264 3300044712 Ga0453684_1562761 Ga0453684_1562761_323_634 103
265 3300045051 Ga0451576_0054835 Ga0451576_0054835_2417_2728 103
266 3300045051 Ga0451576_0153772 Ga0451576_0153772_1287_1598 103
267 3300045051 Ga0451576_0649659 Ga0451576_0649659_324_635 103
268 3300045051 Ga0451576_0661122 Ga0451576_0661122_610_921 103
269 3300045051 Ga0451576_1199191 Ga0451576_1199191_359_670 103
270 3300045051 Ga0451576_1996550 Ga0451576_1996550_21_332 103
271 3300049515 Ga0501292_088365 Ga0501292_088365_85_396 103
272 3300049521 Ga0501298_128863 Ga0501298_128863_141_452 103
273 3300049568 Ga0501031_0493813 Ga0501031_0493813_316_627 103
274 3300049572 Ga0501036_0353171 Ga0501036_0353171_381_692 103
275 3300049576 Ga0501040_0033836 Ga0501040_0033836_226_537 103
276 3300049576 Ga0501040_0051814 Ga0501040_0051814_1523_1834 103
277 3300049578 Ga0501042_0215246 Ga0501042_0215246_414_725 103
278 3300049578 Ga0501042_0523283 Ga0501042_0523283_88_399 103
279 3300049580 Ga0501046_0724979 Ga0501046_0724979_83_394 103
280 3300049582 Ga0501048_1329910 Ga0501048_1329910_70_381 103
281 3300049587 Ga0501071_0423236 Ga0501071_0423236_53_364 103
282 3300049587 Ga0501071_1383857 Ga0501071_1383857_171_482 103
283 3300049589 Ga0501073_1170943 Ga0501073_1170943_167_478 103
284 3300049590 Ga0501074_0029250 Ga0501074_0029250_3466_3777 103
285 3300049591 Ga0501075_0217918 Ga0501075_0217918_895_1206 103
286 3300049591 Ga0501075_1089917 Ga0501075_1089917_253_564 103
287 3300049592 Ga0501076_0071569 Ga0501076_0071569_2071_2382 103
288 3300049741 Ga0501079_0108092 Ga0501079_0108092_1289_1600 103
289 3300049741 Ga0501079_0350224 Ga0501079_0350224_809_1120 103
290 3300049741 Ga0501079_1041056 Ga0501079_1041056_216_527 103
291 3300049742 Ga0501080_0037821 Ga0501080_0037821_3333_3644 103
292 3300049743 Ga0501081_0210718 Ga0501081_0210718_188_499 103
293 3300049743 Ga0501081_0434798 Ga0501081_0434798_603_914 103
294 3300049743 Ga0501081_0534199 Ga0501081_0534199_255_566 103
295 3300049822 Ga0501035_1190354 Ga0501035_1190354_125_436 103
296 3300050507 nmdc:mga05p37_14603_c1 nmdc:mga05p37_14603_c1_1270_1581 103
297 3300050507 nmdc:mga05p37_160546_c1 nmdc:mga05p37_160546_c1_654_965 103
298 3300050507 nmdc:mga05p37_190203_c1 nmdc:mga05p37_190203_c1_1840_2151 103
299 3300050507 nmdc:mga05p37_210652_c1 nmdc:mga05p37_210652_c1_1495_1806 103
300 3300050507 nmdc:mga05p37_230804_c1 nmdc:mga05p37_230804_c1_186_497 103
301 3300050507 nmdc:mga05p37_45394_c1 nmdc:mga05p37_45394_c1_2400_2711 103
302 3300050507 nmdc:mga05p37_680271_c1 nmdc:mga05p37_680271_c1_647_958 103
303 3300050508 nmdc:mga09592_1663109_c1 nmdc:mga09592_1663109_c1_195_506 103
304 3300050508 nmdc:mga09592_4331_c1 nmdc:mga09592_4331_c1_3018_3329 103
305 3300050508 nmdc:mga09592_440034_c1 nmdc:mga09592_440034_c1_227_538 103
306 3300050508 nmdc:mga09592_66397_c1 nmdc:mga09592_66397_c1_586_897 103
307 3300050508 nmdc:mga09592_67324_c1 nmdc:mga09592_67324_c1_529_840 103
308 3300050508 nmdc:mga09592_701722_c1 nmdc:mga09592_701722_c1_248_559 103
309 3300050508 nmdc:mga09592_796569_c1 nmdc:mga09592_796569_c1_72_383 103
310 3300050509 nmdc:mga0qj67_110080_c1 nmdc:mga0qj67_110080_c1_1003_1314 103
311 3300050509 nmdc:mga0qj67_578897_c1 nmdc:mga0qj67_578897_c1_164_475 103
312 3300050510 nmdc:mga06r32_168796_c1 nmdc:mga06r32_168796_c1_1531_1842 103
313 3300050510 nmdc:mga06r32_494902_c1 nmdc:mga06r32_494902_c1_61_372 103
314 3300050510 nmdc:mga06r32_957882_c1 nmdc:mga06r32_957882_c1_234_545 103
315 3300050512 nmdc:mga0n895_883577_c1 nmdc:mga0n895_883577_c1_541_852 103
316 3300050515 nmdc:mga0a205_151377_c1 nmdc:mga0a205_151377_c1_1619_1930 103
317 3300050515 nmdc:mga0a205_24153_c1 nmdc:mga0a205_24153_c1_3179_3490 103
318 3300050515 nmdc:mga0a205_464580_c1 nmdc:mga0a205_464580_c1_681_992 103
319 3300050515 nmdc:mga0a205_790198_c1 nmdc:mga0a205_790198_c1_29_340 103
320 3300054114 Ga0501084_0258756 Ga0501084_0258756_809_1120 103
321 3300054114 Ga0501084_0642675 Ga0501084_0642675_238_549 103
322 3300054114 Ga0501084_0767167 Ga0501084_0767167_131_442 103
323 3300060353 Ga0501082_0748799 Ga0501082_0748799_173_484 103
324 3300060353 Ga0501082_0964795 Ga0501082_0964795_144_455 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

5

76

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.8077 8 88
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.7447 52 100
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7436 16 103
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.7152 52 100
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.6405 16 103
ID Description Score Start End Superfamily
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9664 12 100 3.30.1200.10
af_X1WD69_65_162_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9507 14 103 3.30.1200.10
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9254 12 100 3.30.1200.10
af_Q09EE9_24_127_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9082 14 102 3.30.1200.10
af_I1NJE4_134_231_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8952 6 103 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A3N5MV27-F1-model_v4 UPF0235 protein EHM70_12450 0.9987 13 103 GO:0005737
AF-A0A521UJW4-F1-model_v4 UPF0235 protein EPO21_16060 0.9891 15 101 GO:0005737
AF-A0A1F8MZB5-F1-model_v4 UPF0235 protein A2Y60_04090 0.9889 13 101 GO:0005737
AF-A0A3A4ZV49-F1-model_v4 UPF0235 protein C4576_29485 0.9877 17 103 GO:0005737
AF-A0A2H0S928-F1-model_v4 UPF0235 protein COU74_01630 0.9872 16 86 GO:0005737

Feature Viewer

pLDDT pTM Quality
87.13 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map