F407446

General Info

Members Datasets Scaffolds Average Seq Length
324 176 648 208

Family's Representative Sequence

Representative Sequence 3300034818|Ga0373950_0012630|Ga0373950_0012630_386_1267
Length 205
Sequence MRLILLGPPGAGKGTQAQRLIEKHGIVQLSTGDMLRAAVAAGTPVGLRAKSIMDAGQLVPDEVVVAIIADRIGQPDAKRGFVLDGFPRTVPQAEALDKLLAERGLDAVIELKVDEGILIKRIETRVAEMTARGEPLRKDDNAEVLKGRLTAYRAQTAPLAGYYDAKGQLKSVDGMAPIDDVTAAIDSILGGKKPSKARRRLTKAS

Samples

Sample ID Description Type Environment
1 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
161 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
172 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
173 2643221674 Devosia sp. Root436 Isolate Unclassified
174 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
175 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
176 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0.62
Rhizoplane 1.85
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373950_0012630 3300034818 Bacteria 1397
2 Ga0070658_10032170 3300005327 Bacteria 4218
3 Ga0070658_10054549 3300005327 Bacteria 3245
4 Ga0070690_100341586 3300005330 Bacteria 1084
5 Ga0070680_100005733 3300005336 Bacteria 9421
6 Ga0070680_100264521 3300005336 Bacteria 1455
7 Ga0070660_100035951 3300005339 Bacteria 3750
8 Ga0070660_100036932 3300005339 Bacteria 3702
9 Ga0070660_100155477 3300005339 Bacteria 1840
10 Ga0070675_100063924 3300005354 Bacteria 3042
11 Ga0070709_10038757 3300005434 Bacteria 2920
12 Ga0070709_10265087 3300005434 Bacteria 1243
13 Ga0070714_100020135 3300005435 Bacteria 5444
14 Ga0070714_100222884 3300005435 Bacteria 1734
15 Ga0070713_100001694 3300005436 Bacteria 14164
16 Ga0070710_10015917 3300005437 Bacteria 3815
17 Ga0070681_10047402 3300005458 Bacteria 4296
18 Ga0070681_10344226 3300005458 Bacteria 1401
19 Ga0070679_100058470 3300005530 Bacteria 3841
20 Ga0070679_100084207 3300005530 Bacteria 3168
21 Ga0070679_100227274 3300005530 Bacteria 1826
22 Ga0068855_100030257 3300005563 Bacteria 6476
23 Ga0068855_100204252 3300005563 Bacteria 2223
24 Ga0068855_100437035 3300005563 Bacteria 1430
25 Ga0068859_100470857 3300005617 Bacteria 1352
26 Ga0081455_10191469 3300005937 Bacteria 1540
27 Ga0081538_10009048 3300005981 Bacteria 8358
28 Ga0081540_1037851 3300005983 Bacteria 2551
29 Ga0070717_10123210 3300006028 Bacteria 2223
30 Ga0070712_100188090 3300006175 Bacteria 1614
31 Ga0070712_100303968 3300006175 Bacteria 1292
32 Ga0075427_10003839 3300006194 Bacteria 2097
33 Ga0075428_100006364 3300006844 Bacteria 13140
34 Ga0075430_100000196 3300006846 Bacteria 40930
35 Ga0075430_100000605 3300006846 Bacteria 27377
36 Ga0075431_100001183 3300006847 Bacteria 23547
37 Ga0075433_10000991 3300006852 Bacteria 20176
38 Ga0075433_10107492 3300006852 Bacteria 2473
39 Ga0075434_100006955 3300006871 Bacteria 10427
40 Ga0075429_100000573 3300006880 Bacteria 28269
41 Ga0075436_100050481 3300006914 Bacteria 2871
42 Ga0097620_100470837 3300006931 Bacteria 1352
43 Ga0075435_100026184 3300007076 Bacteria 4547
44 Ga0075435_100029598 3300007076 Bacteria 4298
45 Ga0075435_100156700 3300007076 Bacteria 1916
46 Ga0099795_10003005 3300007788 Bacteria 4102
47 Ga0105240_10015848 3300009093 Bacteria 10226
48 Ga0111539_10000683 3300009094 Bacteria 43914
49 Ga0111539_10054772 3300009094 Bacteria 4744
50 Ga0105245_10014932 3300009098 Bacteria 6766
51 Ga0114129_10008352 3300009147 Bacteria 14760
52 Ga0114129_10034904 3300009147 Bacteria 7105
53 Ga0105242_10229589 3300009176 Bacteria 1663
54 Ga0105248_10168969 3300009177 Bacteria 2465
55 Ga0105238_10211399 3300009551 Bacteria 1916
56 Ga0157371_10097961 3300013102 Bacteria 2079
57 Ga0157371_10107692 3300013102 Bacteria 1978
58 Ga0157370_10140736 3300013104 Bacteria 2248
59 Ga0157372_10256378 3300013307 Bacteria 2031
60 Ga0157372_10890869 3300013307 Bacteria 1032
61 Ga0157372_10934421 3300013307 Bacteria 1005
62 Ga0157379_10307048 3300014968 Bacteria 1447
63 Ga0213876_10045285 3300021384 Bacteria 2327
64 Ga0209233_1014395 3300025261 Bacteria 2228
65 Ga0207705_10005544 3300025909 Bacteria 9436
66 Ga0207707_10009792 3300025912 Bacteria 8311
67 Ga0207707_10074527 3300025912 Bacteria 2960
68 Ga0207707_10136394 3300025912 Bacteria 2146
69 Ga0207695_10012684 3300025913 Bacteria 10093
70 Ga0207693_10104631 3300025915 Bacteria 2220
71 Ga0207693_10445197 3300025915 Bacteria 1012
72 Ga0207660_10016311 3300025917 Bacteria 4916
73 Ga0207660_10265069 3300025917 Bacteria 1360
74 Ga0207657_10044442 3300025919 Bacteria 3905
75 Ga0207657_10128573 3300025919 Bacteria 2078
76 Ga0207657_10170689 3300025919 Bacteria 1762
77 Ga0207652_10013408 3300025921 Bacteria 6634
78 Ga0207652_10058995 3300025921 Bacteria 3307
79 Ga0207652_10164855 3300025921 Bacteria 1987
80 Ga0207652_10192302 3300025921 Bacteria 1836
81 Ga0207652_10197878 3300025921 Bacteria 1808
82 Ga0207652_10252084 3300025921 Bacteria 1592
83 Ga0207694_10091400 3300025924 Bacteria 2402
84 Ga0207687_10008562 3300025927 Bacteria 6691
85 Ga0207700_10071813 3300025928 Bacteria 2666
86 Ga0207664_10006275 3300025929 Bacteria 8170
87 Ga0207664_10124367 3300025929 Bacteria 2163
88 Ga0207664_10197031 3300025929 Bacteria 1737
89 Ga0207690_10601019 3300025932 Bacteria 898
90 Ga0207665_10065544 3300025939 Bacteria 2470
91 Ga0207689_10092486 3300025942 Bacteria 2484
92 Ga0207667_10004001 3300025949 Bacteria 18104
93 Ga0207667_10248995 3300025949 Bacteria 1817
94 Ga0207667_10258074 3300025949 Bacteria 1782
95 Ga0207667_10510638 3300025949 Bacteria 1218
96 Ga0207668_10009850 3300025972 Bacteria 5742
97 Ga0207639_10117413 3300026041 Bacteria 2180
98 Ga0207702_10098962 3300026078 Bacteria 2570
99 Ga0207702_10257655 3300026078 Bacteria 1641
100 Ga0207676_10193162 3300026095 Bacteria 1793
101 Ga0209179_1004440 3300027512 Unclassified 2117
102 Ga0207428_10002442 3300027907 Bacteria 18563
103 Ga0268266_10051430 3300028379 Bacteria 3537
104 Ga0265337_1000827 3300028556 Bacteria 16247
105 Ga0265338_10043919 3300028800 Bacteria 4135
106 Ga0265330_10019333 3300031235 Bacteria 3123
107 Ga0265332_10066137 3300031238 Bacteria 1543
108 Ga0265325_10001071 3300031241 Bacteria 19727
109 Ga0265325_10009381 3300031241 Bacteria 5714
110 Ga0265339_10001408 3300031249 Bacteria 17842
111 Ga0265339_10013957 3300031249 Bacteria 4859
112 Ga0265331_10014022 3300031250 Bacteria 4284
113 Ga0265327_10210313 3300031251 Bacteria 878
114 Ga0265313_10004533 3300031595 Bacteria 10604
115 Ga0265313_10022796 3300031595 Bacteria 3388
116 Ga0265313_10041151 3300031595 Bacteria 2279
117 Ga0265313_10063677 3300031595 Bacteria 1718
118 Ga0265314_10004990 3300031711 Bacteria 12094
119 Ga0265314_10025851 3300031711 Bacteria 4420
120 Ga0265314_10070383 3300031711 Bacteria 2344
121 Ga0265342_10000677 3300031712 Bacteria 35579
122 Ga0265342_10009052 3300031712 Bacteria 7065
123 Ga0316583_10000484 3300032133 Bacteria 11841
124 Ga0373941_0001814 3300035115 Bacteria 4596
125 Ga0373953_0039605 3300035117 Bacteria 1868
126 Ga0373956_0046323 3300035119 Bacteria 1942
127 Ga0373956_0059294 3300035119 Bacteria 1731
128 Ga0373957_0019472 3300035120 Bacteria 2388
129 Ga0373955_0003246 3300035172 Bacteria 7124
130 Ga0373924_0045023 3300035410 Bacteria 1814
131 Ga0373933_0199431 3300035724 Bacteria 1280
132 Ga0373937_0021076 3300036401 Bacteria 5849
133 Ga0373937_0051996 3300036401 Bacteria 3755
134 Ga0373937_0071733 3300036401 Bacteria 3194
135 Ga0373937_0089618 3300036401 Bacteria 2848
136 Ga0373925_0039839 3300037068 Bacteria 3477
137 Ga0373925_0613457 3300037068 Bacteria 896
138 Ga0395899_0027617 3300037312 Bacteria 4276
139 Ga0395899_0091839 3300037312 Bacteria 2199
140 Ga0395900_0021199 3300037418 Bacteria 6643
141 Ga0395900_0044837 3300037418 Bacteria 4555
142 Ga0395898_0069518 3300037466 Bacteria 3407
143 Ga0436364_0989324 3300037853 Bacteria 5394
144 Ga0395901_0019075 3300038443 Bacteria 7013
145 Ga0436365_0105133 3300039437 Bacteria 6721
146 Ga0436365_1808227 3300039437 Bacteria 5095
147 Ga0436363_0759042 3300039450 Bacteria 1250
148 Ga0466966_0067594 3300044684 Bacteria 2244
149 Ga0466963_0052778 3300044694 Bacteria 2698
150 Ga0466963_0293684 3300044694 Bacteria 1143
151 Ga0466971_0077897 3300044719 Bacteria 1510
152 Ga0466957_0042883 3300044842 Bacteria 2738
153 Ga0466960_0188765 3300044901 Bacteria 1121
154 Ga0466958_0087166 3300045836 Bacteria 1927
155 Ga0466958_0489486 3300045836 Bacteria 798
156 Ga0466967_0150260 3300045976 Bacteria 2176
157 Ga0466967_1369633 3300045976 Bacteria 705
158 Ga0495592_0014401 3300046454 Bacteria 6005
159 Ga0495651_0003040 3300046462 Bacteria 12936
160 Ga0495606_0216892 3300046507 Bacteria 1081
161 Ga0495608_0079829 3300046511 Bacteria 2127
162 Ga0495628_0088235 3300046516 Bacteria 2404
163 Ga0495652_0008048 3300046529 Bacteria 9659
164 Ga0495587_0021132 3300046536 Bacteria 4014
165 Ga0495645_0002505 3300046543 Bacteria 12464
166 Ga0495667_0055113 3300046559 Bacteria 2615
167 Ga0495657_0009621 3300046675 Bacteria 7320
168 Ga0495599_0002367 3300046678 Bacteria 10955
169 Ga0495600_0071319 3300046809 Bacteria 2269
170 Ga0495604_0003635 3300047317 Bacteria 12295
171 Ga0495680_0012190 3300047322 Bacteria 7581
172 Ga0495602_0069117 3300048088 Bacteria 3029
173 Ga0496104_0000399 3300048907 Bacteria 38066
174 Ga0496104_0000877 3300048907 Bacteria 25894
175 Ga0496105_0002417 3300048908 Bacteria 13529
176 Ga0496105_0077228 3300048908 Bacteria 2750
177 Ga0496115_0079825 3300048918 Bacteria 2663
178 Ga0496115_0147760 3300048918 Bacteria 1940
179 Ga0501031_0011643 3300049568 Bacteria 5739
180 Ga0501031_0070410 3300049568 Bacteria 2278
181 Ga0501031_0125300 3300049568 Bacteria 1678
182 Ga0501032_0014845 3300049569 Bacteria 5511
183 Ga0501032_0031324 3300049569 Bacteria 3646
184 Ga0501032_0059498 3300049569 Bacteria 2564
185 Ga0501032_0100517 3300049569 Bacteria 1916
186 Ga0501034_0002673 3300049571 Bacteria 21040
187 Ga0501034_0006536 3300049571 Bacteria 12527
188 Ga0501034_0039870 3300049571 Bacteria 4757
189 Ga0501034_0050439 3300049571 Bacteria 4197
190 Ga0501034_0085750 3300049571 Bacteria 3150
191 Ga0501034_0179368 3300049571 Bacteria 2083
192 Ga0501034_0226834 3300049571 Bacteria 1818
193 Ga0501034_0257777 3300049571 Bacteria 1687
194 Ga0501034_0294115 3300049571 Bacteria 1561
195 Ga0501036_0000444 3300049572 Bacteria 29528
196 Ga0501036_0039716 3300049572 Bacteria 3981
197 Ga0501036_0079440 3300049572 Bacteria 2774
198 Ga0501036_0105811 3300049572 Bacteria 2379
199 Ga0501036_0122572 3300049572 Bacteria 2195
200 Ga0501036_0239331 3300049572 Bacteria 1522
201 Ga0501037_0018197 3300049573 Bacteria 5176
202 Ga0501037_0020882 3300049573 Bacteria 4835
203 Ga0501037_0021990 3300049573 Bacteria 4721
204 Ga0501038_0029565 3300049574 Bacteria 4853
205 Ga0501038_0032408 3300049574 Bacteria 4610
206 Ga0501038_0150445 3300049574 Bacteria 1898
207 Ga0501038_0157020 3300049574 Bacteria 1851
208 Ga0501038_0207713 3300049574 Bacteria 1568
209 Ga0501038_0444740 3300049574 Bacteria 997
210 Ga0501039_0098863 3300049575 Bacteria 2276
211 Ga0501039_0247665 3300049575 Bacteria 1401
212 Ga0501040_0044947 3300049576 Bacteria 3011
213 Ga0501040_0187826 3300049576 Bacteria 1466
214 Ga0501041_0487351 3300049577 Bacteria 784
215 Ga0501043_0006712 3300049579 Bacteria 9190
216 Ga0501043_0015239 3300049579 Bacteria 6020
217 Ga0501043_0027007 3300049579 Bacteria 4505
218 Ga0501043_0127237 3300049579 Bacteria 1997
219 Ga0501043_0337756 3300049579 Bacteria 1146
220 Ga0501046_0084962 3300049580 Bacteria 2440
221 Ga0501047_0000235 3300049581 Bacteria 65603
222 Ga0501047_0010311 3300049581 Bacteria 8836
223 Ga0501047_0072862 3300049581 Bacteria 3306
224 Ga0501047_0080380 3300049581 Bacteria 3133
225 Ga0501047_0092289 3300049581 Bacteria 2906
226 Ga0501047_0108949 3300049581 Bacteria 2652
227 Ga0501047_0119954 3300049581 Bacteria 2512
228 Ga0501047_0155171 3300049581 Bacteria 2163
229 Ga0501047_0477803 3300049581 Bacteria 1074
230 Ga0501048_0001478 3300049582 Bacteria 17828
231 Ga0501048_0019265 3300049582 Bacteria 5009
232 Ga0501068_0016038 3300049584 Bacteria 4315
233 Ga0501068_0115513 3300049584 Bacteria 1671
234 Ga0501068_0327585 3300049584 Bacteria 982
235 Ga0501069_0076444 3300049585 Bacteria 1882
236 Ga0501070_0008462 3300049586 Bacteria 8692
237 Ga0501070_0014169 3300049586 Bacteria 6709
238 Ga0501070_0048130 3300049586 Bacteria 3542
239 Ga0501070_0063486 3300049586 Bacteria 3059
240 Ga0501070_0075862 3300049586 Bacteria 2783
241 Ga0501070_0097895 3300049586 Bacteria 2426
242 Ga0501070_0146838 3300049586 Bacteria 1946
243 Ga0501070_0189551 3300049586 Bacteria 1691
244 Ga0501070_0324033 3300049586 Bacteria 1253
245 Ga0501072_0074127 3300049588 Bacteria 2691
246 Ga0501072_0232269 3300049588 Bacteria 1469
247 Ga0501073_0041475 3300049589 Bacteria 3252
248 Ga0501073_0061697 3300049589 Bacteria 2615
249 Ga0501073_0076429 3300049589 Bacteria 2330
250 Ga0501073_0188670 3300049589 Bacteria 1426
251 Ga0501074_0002757 3300049590 Bacteria 12304
252 Ga0501074_0049384 3300049590 Bacteria 3037
253 Ga0501074_0138591 3300049590 Bacteria 1740
254 Ga0501075_0094794 3300049591 Bacteria 2265
255 Ga0501076_0103535 3300049592 Bacteria 2296
256 Ga0501077_0024057 3300049593 Bacteria 3865
257 Ga0501079_0010115 3300049741 Bacteria 7161
258 Ga0501079_0062862 3300049741 Bacteria 2863
259 Ga0501079_0086061 3300049741 Bacteria 2433
260 Ga0501080_0013397 3300049742 Bacteria 7542
261 Ga0501080_0043942 3300049742 Bacteria 4160
262 Ga0501080_0067975 3300049742 Bacteria 3314
263 Ga0501080_0098176 3300049742 Bacteria 2718
264 Ga0501080_0216387 3300049742 Bacteria 1754
265 Ga0501081_0013277 3300049743 Bacteria 5418
266 Ga0501083_0004993 3300049744 Bacteria 9404
267 Ga0501083_0007208 3300049744 Bacteria 7895
268 Ga0501083_0031200 3300049744 Bacteria 3657
269 Ga0501083_0113498 3300049744 Bacteria 1780
270 Ga0501035_0001116 3300049822 Bacteria 28096
271 Ga0501035_0004418 3300049822 Bacteria 13348
272 Ga0501035_0045061 3300049822 Bacteria 3969
273 Ga0501035_0151206 3300049822 Bacteria 2014
274 Ga0501035_0197038 3300049822 Bacteria 1729
275 Ga0501035_0498737 3300049822 Bacteria 1002
276 Ga0501044_0074615 3300049823 Bacteria 3445
277 Ga0501044_0093339 3300049823 Bacteria 3034
278 Ga0501044_0115599 3300049823 Bacteria 2688
279 Ga0501044_0133845 3300049823 Bacteria 2471
280 Ga0501044_0318726 3300049823 Bacteria 1479
281 Ga0501044_0471435 3300049823 Bacteria 1159
282 Ga0501044_0772985 3300049823 Bacteria 841
283 nmdc:mga05p37_128584_c1 3300050507 Bacteria 3110
284 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
285 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
286 nmdc:mga0qj67_299_c1 3300050509 Bacteria 34404
287 nmdc:mga0qj67_572002_c1 3300050509 Bacteria 905
288 nmdc:mga0qj67_969_c1 3300050509 Bacteria 19753
289 nmdc:mga06r32_519798_c1 3300050510 Bacteria 1166
290 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
291 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
292 nmdc:mga0n895_213890_c2 3300050512 Bacteria 895
293 nmdc:mga0n895_283_c1 3300050512 Bacteria 33340
294 nmdc:mga0n895_40555_c1 3300050512 Bacteria 4522
295 nmdc:mga0rr50_436593_c1 3300050513 Bacteria 1109
296 nmdc:mga0rr50_6776_c1 3300050513 Bacteria 7016
297 nmdc:mga0a205_111062_c1 3300050515 Bacteria 2640
298 nmdc:mga0a205_745_c1 3300050515 Bacteria 26246
299 Ga0495601_0002429 3300053077 Bacteria 10574
300 Ga0495612_0018791 3300053078 Bacteria 2767
301 Ga0495595_0038523 3300053084 Bacteria 2178
302 Ga0500643_001596 3300053087 Bacteria 12817
303 Ga0500644_0007015 3300053088 Bacteria 2916
304 Ga0500651_0047561 3300053093 Bacteria 2696
305 Ga0500651_0256850 3300053093 Bacteria 1014
306 Ga0500650_0147463 3300053098 Bacteria 1089
307 Ga0500593_004202 3300053117 Bacteria 5549
308 Ga0500595_000016 3300053119 Bacteria 211397
309 Ga0500568_0020788 3300053139 Bacteria 2834
310 Ga0500573_0222784 3300053140 Bacteria 988
311 Ga0500616_0000006 3300053153 Bacteria 944738
312 Ga0500616_0040972 3300053153 Bacteria 2488
313 Ga0500645_021076 3300053730 Bacteria 2013
314 Ga0501084_0007924 3300054114 Bacteria 8745
315 Ga0501082_0011097 3300060353 Bacteria 7746
316 Ga0501082_0017885 3300060353 Bacteria 6106
317 Ga0501082_0227503 3300060353 Bacteria 1623
318 Ga0530510_0085072 3300061734 Bacteria 2304
319 2513715307 2513237104 Bacteria 10034502
320 2643755800 2643221547 Bacteria 4740017
321 2644410393 2643221674 Bacteria 3919126
322 2793282375 2791355253 Bacteria 5171699
323 643599664 643348564 Bacteria 8839022
324 8002061418 8002060224 Bacteria 4026565
325 Ga0373950_0012630
326 Ga0070658_10032170
327 Ga0070658_10054549
328 Ga0070690_100341586
329 Ga0070680_100005733
330 Ga0070680_100264521
331 Ga0070660_100035951
332 Ga0070660_100036932
333 Ga0070660_100155477
334 Ga0070675_100063924
335 Ga0070709_10038757
336 Ga0070709_10265087
337 Ga0070714_100020135
338 Ga0070714_100222884
339 Ga0070713_100001694
340 Ga0070710_10015917
341 Ga0070681_10047402
342 Ga0070681_10344226
343 Ga0070679_100058470
344 Ga0070679_100084207
345 Ga0070679_100227274
346 Ga0068855_100030257
347 Ga0068855_100204252
348 Ga0068855_100437035
349 Ga0068859_100470857
350 Ga0081455_10191469
351 Ga0081538_10009048
352 Ga0081540_1037851
353 Ga0070717_10123210
354 Ga0070712_100188090
355 Ga0070712_100303968
356 Ga0075427_10003839
357 Ga0075428_100006364
358 Ga0075430_100000196
359 Ga0075430_100000605
360 Ga0075431_100001183
361 Ga0075433_10000991
362 Ga0075433_10107492
363 Ga0075434_100006955
364 Ga0075429_100000573
365 Ga0075436_100050481
366 Ga0097620_100470837
367 Ga0075435_100026184
368 Ga0075435_100029598
369 Ga0075435_100156700
370 Ga0099795_10003005
371 Ga0105240_10015848
372 Ga0111539_10000683
373 Ga0111539_10054772
374 Ga0105245_10014932
375 Ga0114129_10008352
376 Ga0114129_10034904
377 Ga0105242_10229589
378 Ga0105248_10168969
379 Ga0105238_10211399
380 Ga0157371_10097961
381 Ga0157371_10107692
382 Ga0157370_10140736
383 Ga0157372_10256378
384 Ga0157372_10890869
385 Ga0157372_10934421
386 Ga0157379_10307048
387 Ga0213876_10045285
388 Ga0209233_1014395
389 Ga0207705_10005544
390 Ga0207707_10009792
391 Ga0207707_10074527
392 Ga0207707_10136394
393 Ga0207695_10012684
394 Ga0207693_10104631
395 Ga0207693_10445197
396 Ga0207660_10016311
397 Ga0207660_10265069
398 Ga0207657_10044442
399 Ga0207657_10128573
400 Ga0207657_10170689
401 Ga0207652_10013408
402 Ga0207652_10058995
403 Ga0207652_10164855
404 Ga0207652_10192302
405 Ga0207652_10197878
406 Ga0207652_10252084
407 Ga0207694_10091400
408 Ga0207687_10008562
409 Ga0207700_10071813
410 Ga0207664_10006275
411 Ga0207664_10124367
412 Ga0207664_10197031
413 Ga0207690_10601019
414 Ga0207665_10065544
415 Ga0207689_10092486
416 Ga0207667_10004001
417 Ga0207667_10248995
418 Ga0207667_10258074
419 Ga0207667_10510638
420 Ga0207668_10009850
421 Ga0207639_10117413
422 Ga0207702_10098962
423 Ga0207702_10257655
424 Ga0207676_10193162
425 Ga0209179_1004440
426 Ga0207428_10002442
427 Ga0268266_10051430
428 Ga0265337_1000827
429 Ga0265338_10043919
430 Ga0265330_10019333
431 Ga0265332_10066137
432 Ga0265325_10001071
433 Ga0265325_10009381
434 Ga0265339_10001408
435 Ga0265339_10013957
436 Ga0265331_10014022
437 Ga0265327_10210313
438 Ga0265313_10004533
439 Ga0265313_10022796
440 Ga0265313_10041151
441 Ga0265313_10063677
442 Ga0265314_10004990
443 Ga0265314_10025851
444 Ga0265314_10070383
445 Ga0265342_10000677
446 Ga0265342_10009052
447 Ga0316583_10000484
448 Ga0373941_0001814
449 Ga0373953_0039605
450 Ga0373956_0046323
451 Ga0373956_0059294
452 Ga0373957_0019472
453 Ga0373955_0003246
454 Ga0373924_0045023
455 Ga0373933_0199431
456 Ga0373937_0021076
457 Ga0373937_0051996
458 Ga0373937_0071733
459 Ga0373937_0089618
460 Ga0373925_0039839
461 Ga0373925_0613457
462 Ga0395899_0027617
463 Ga0395899_0091839
464 Ga0395900_0021199
465 Ga0395900_0044837
466 Ga0395898_0069518
467 Ga0436364_0989324
468 Ga0395901_0019075
469 Ga0436365_0105133
470 Ga0436365_1808227
471 Ga0436363_0759042
472 Ga0466966_0067594
473 Ga0466963_0052778
474 Ga0466963_0293684
475 Ga0466971_0077897
476 Ga0466957_0042883
477 Ga0466960_0188765
478 Ga0466958_0087166
479 Ga0466958_0489486
480 Ga0466967_0150260
481 Ga0466967_1369633
482 Ga0495592_0014401
483 Ga0495651_0003040
484 Ga0495606_0216892
485 Ga0495608_0079829
486 Ga0495628_0088235
487 Ga0495652_0008048
488 Ga0495587_0021132
489 Ga0495645_0002505
490 Ga0495667_0055113
491 Ga0495657_0009621
492 Ga0495599_0002367
493 Ga0495600_0071319
494 Ga0495604_0003635
495 Ga0495680_0012190
496 Ga0495602_0069117
497 Ga0496104_0000399
498 Ga0496104_0000877
499 Ga0496105_0002417
500 Ga0496105_0077228
501 Ga0496115_0079825
502 Ga0496115_0147760
503 Ga0501031_0011643
504 Ga0501031_0070410
505 Ga0501031_0125300
506 Ga0501032_0014845
507 Ga0501032_0031324
508 Ga0501032_0059498
509 Ga0501032_0100517
510 Ga0501034_0002673
511 Ga0501034_0006536
512 Ga0501034_0039870
513 Ga0501034_0050439
514 Ga0501034_0085750
515 Ga0501034_0179368
516 Ga0501034_0226834
517 Ga0501034_0257777
518 Ga0501034_0294115
519 Ga0501036_0000444
520 Ga0501036_0039716
521 Ga0501036_0079440
522 Ga0501036_0105811
523 Ga0501036_0122572
524 Ga0501036_0239331
525 Ga0501037_0018197
526 Ga0501037_0020882
527 Ga0501037_0021990
528 Ga0501038_0029565
529 Ga0501038_0032408
530 Ga0501038_0150445
531 Ga0501038_0157020
532 Ga0501038_0207713
533 Ga0501038_0444740
534 Ga0501039_0098863
535 Ga0501039_0247665
536 Ga0501040_0044947
537 Ga0501040_0187826
538 Ga0501041_0487351
539 Ga0501043_0006712
540 Ga0501043_0015239
541 Ga0501043_0027007
542 Ga0501043_0127237
543 Ga0501043_0337756
544 Ga0501046_0084962
545 Ga0501047_0000235
546 Ga0501047_0010311
547 Ga0501047_0072862
548 Ga0501047_0080380
549 Ga0501047_0092289
550 Ga0501047_0108949
551 Ga0501047_0119954
552 Ga0501047_0155171
553 Ga0501047_0477803
554 Ga0501048_0001478
555 Ga0501048_0019265
556 Ga0501068_0016038
557 Ga0501068_0115513
558 Ga0501068_0327585
559 Ga0501069_0076444
560 Ga0501070_0008462
561 Ga0501070_0014169
562 Ga0501070_0048130
563 Ga0501070_0063486
564 Ga0501070_0075862
565 Ga0501070_0097895
566 Ga0501070_0146838
567 Ga0501070_0189551
568 Ga0501070_0324033
569 Ga0501072_0074127
570 Ga0501072_0232269
571 Ga0501073_0041475
572 Ga0501073_0061697
573 Ga0501073_0076429
574 Ga0501073_0188670
575 Ga0501074_0002757
576 Ga0501074_0049384
577 Ga0501074_0138591
578 Ga0501075_0094794
579 Ga0501076_0103535
580 Ga0501077_0024057
581 Ga0501079_0010115
582 Ga0501079_0062862
583 Ga0501079_0086061
584 Ga0501080_0013397
585 Ga0501080_0043942
586 Ga0501080_0067975
587 Ga0501080_0098176
588 Ga0501080_0216387
589 Ga0501081_0013277
590 Ga0501083_0004993
591 Ga0501083_0007208
592 Ga0501083_0031200
593 Ga0501083_0113498
594 Ga0501035_0001116
595 Ga0501035_0004418
596 Ga0501035_0045061
597 Ga0501035_0151206
598 Ga0501035_0197038
599 Ga0501035_0498737
600 Ga0501044_0074615
601 Ga0501044_0093339
602 Ga0501044_0115599
603 Ga0501044_0133845
604 Ga0501044_0318726
605 Ga0501044_0471435
606 Ga0501044_0772985
607 nmdc:mga05p37_128584_c1
608 nmdc:mga05p37_2437_c1
609 nmdc:mga09592_1370_c1
610 nmdc:mga0qj67_299_c1
611 nmdc:mga0qj67_572002_c1
612 nmdc:mga0qj67_969_c1
613 nmdc:mga06r32_519798_c1
614 nmdc:mga06r32_638_c1
615 nmdc:mga08y16_549_c1
616 nmdc:mga0n895_213890_c2
617 nmdc:mga0n895_283_c1
618 nmdc:mga0n895_40555_c1
619 nmdc:mga0rr50_436593_c1
620 nmdc:mga0rr50_6776_c1
621 nmdc:mga0a205_111062_c1
622 nmdc:mga0a205_745_c1
623 Ga0495601_0002429
624 Ga0495612_0018791
625 Ga0495595_0038523
626 Ga0500643_001596
627 Ga0500644_0007015
628 Ga0500651_0047561
629 Ga0500651_0256850
630 Ga0500650_0147463
631 Ga0500593_004202
632 Ga0500595_000016
633 Ga0500568_0020788
634 Ga0500573_0222784
635 Ga0500616_0000006
636 Ga0500616_0040972
637 Ga0500645_021076
638 Ga0501084_0007924
639 Ga0501082_0011097
640 Ga0501082_0017885
641 Ga0501082_0227503
642 Ga0530510_0085072
643 2513715307
644 2643755800
645 2644410393
646 2793282375
647 643599664
648 8002061418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

5

168

0.97

PF13207

AAA_17

AAA domain

6

146

0.86

PF13671

AAA_33

AAA domain

3

159

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dvr-assembly1.cif.gz_B structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp 0.9065 1 192
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8942 1 191
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8926 1 191
4w5h-assembly1.cif.gz_A new structural conformations of adenylate kinase from streptococcus pneumoniae d39 0.8789 1 191
3umf-assembly1.cif.gz_A schistosoma mansoni adenylate kinase 0.8741 3 191
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 2 125 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8942 1 191 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8741 3 191 3.40.50.300
3cm0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8613 2 191 3.40.50.300
af_A5PMF1_372_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8499 3 191 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A529NWT0-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9954 1 108 GO:0004017
GO:0005524
GO:0005737
AF-A0A529NWT0-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9863 1 108 GO:0004017
GO:0005524
GO:0005737
AF-A0A4Y7WT41-F1-model_v4 deleted 0.9823 1 116
AF-A0A3D3RZ18-F1-model_v4 deleted 0.9822 1 113
AF-A0A546XYY2-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9805 1 191 GO:0004017
GO:0005524
GO:0005737
GO:0044209

Map