F407317

General Info

Members Datasets Scaffolds Average Seq Length
324 206 648 114

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101034420|Ga0075428_1010344202
Length 127
Sequence MTGGRMRRVDEAMREVLSGAITSELKDPRVGFVTVTAVDTATDLRHARVFVSVLGGGAVRRRTLAGLRSAHGFLQRRVADELHLKHTPTLDFVYDDTSERAQRIEELLGREAEDVVPPGNTPGRGNH

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
119 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 6.48
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 16.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101034420 3300006844 Bacteria 869
2 JGI25407J50210_10025845 3300003373 Bacteria 1522
3 Ga0070683_100542802 3300005329 Bacteria 1112
4 Ga0070680_100821798 3300005336 Bacteria 801
5 Ga0070682_100670157 3300005337 Bacteria 828
6 Ga0068868_101970191 3300005338 Bacteria 554
7 Ga0070691_10436749 3300005341 Bacteria 745
8 Ga0070661_100731634 3300005344 Bacteria 808
9 Ga0070692_11218144 3300005345 Bacteria 537
10 Ga0070668_100833634 3300005347 Bacteria 821
11 Ga0070674_100976893 3300005356 Bacteria 742
12 Ga0070673_100594122 3300005364 Bacteria 1009
13 Ga0070688_100652467 3300005365 Bacteria 810
14 Ga0070659_101356048 3300005366 Bacteria 631
15 Ga0070667_100831386 3300005367 Bacteria 858
16 Ga0070709_11361209 3300005434 Unclassified 574
17 Ga0070714_100256557 3300005435 Bacteria 1618
18 Ga0070713_101648148 3300005436 Bacteria 623
19 Ga0070700_100815360 3300005441 Bacteria 753
20 Ga0070700_101152931 3300005441 Bacteria 645
21 Ga0070663_101594035 3300005455 Bacteria 582
22 Ga0070662_101128959 3300005457 Bacteria 673
23 Ga0070681_10076175 3300005458 Bacteria 3314
24 Ga0070685_10603245 3300005466 Unclassified 790
25 Ga0070698_101271496 3300005471 Bacteria 686
26 Ga0070679_101628191 3300005530 Bacteria 593
27 Ga0070684_100473445 3300005535 Bacteria 1159
28 Ga0070684_100968244 3300005535 Unclassified 798
29 Ga0070697_101467766 3300005536 Unclassified 609
30 Ga0070696_100692606 3300005546 Bacteria 830
31 Ga0070693_100266841 3300005547 Bacteria 1141
32 Ga0070693_100517609 3300005547 Bacteria 849
33 Ga0068856_100115932 3300005614 Bacteria 2679
34 Ga0068856_101895182 3300005614 Unclassified 607
35 Ga0070702_100498348 3300005615 Bacteria 894
36 Ga0070702_100503517 3300005615 Bacteria 890
37 Ga0068852_101642765 3300005616 Bacteria 665
38 Ga0068859_101700895 3300005617 Bacteria 697
39 Ga0068864_101603160 3300005618 Unclassified 655
40 Ga0068866_10096039 3300005718 Bacteria 1625
41 Ga0068866_10429738 3300005718 Bacteria 859
42 Ga0068870_11128612 3300005840 Bacteria 565
43 Ga0068862_101060976 3300005844 Unclassified 804
44 Ga0081455_10039495 3300005937 Bacteria 4170
45 Ga0081455_10209150 3300005937 Bacteria 1455
46 Ga0081538_10011872 3300005981 Bacteria 7032
47 Ga0081538_10022136 3300005981 Bacteria 4616
48 Ga0081538_10064114 3300005981 Bacteria 2080
49 Ga0081539_10001679 3300005985 Bacteria 35825
50 Ga0075365_11161796 3300006038 Unclassified 543
51 Ga0070712_101684016 3300006175 Unclassified 555
52 Ga0075428_100087232 3300006844 Bacteria 3404
53 Ga0075434_101268727 3300006871 Bacteria 748
54 Ga0075434_102125189 3300006871 Unclassified 566
55 Ga0075429_101713425 3300006880 Bacteria 546
56 Ga0097620_101700731 3300006931 Bacteria 697
57 Ga0111539_10152098 3300009094 Bacteria 2708
58 Ga0111539_10976698 3300009094 Bacteria 985
59 Ga0111539_11194502 3300009094 Bacteria 883
60 Ga0105245_11910363 3300009098 Bacteria 647
61 Ga0114129_10226290 3300009147 Bacteria 2521
62 Ga0114129_10990235 3300009147 Bacteria 1059
63 Ga0114129_11002376 3300009147 Bacteria 1052
64 Ga0114129_11341936 3300009147 Unclassified 885
65 Ga0114129_13021226 3300009147 Bacteria 552
66 Ga0105243_10193882 3300009148 Bacteria 1777
67 Ga0105243_11775769 3300009148 Bacteria 647
68 Ga0105241_10398036 3300009174 Bacteria 1207
69 Ga0105242_10304083 3300009176 Bacteria 1457
70 Ga0105248_10752503 3300009177 Bacteria 1100
71 Ga0105238_10265424 3300009551 Bacteria 1697
72 Ga0105249_10303233 3300009553 Bacteria 1603
73 Ga0105239_10315076 3300010375 Bacteria 1764
74 Ga0105239_13397036 3300010375 Unclassified 518
75 Ga0105246_10669365 3300011119 Bacteria 906
76 Ga0157371_11045435 3300013102 Unclassified 625
77 Ga0157369_12588693 3300013105 Bacteria 513
78 Ga0157374_11741741 3300013296 Bacteria 648
79 Ga0157378_10429385 3300013297 Bacteria 1307
80 Ga0157378_10456149 3300013297 Bacteria 1269
81 Ga0163162_10693560 3300013306 Bacteria 1140
82 Ga0157375_10958667 3300013308 Bacteria 997
83 Ga0163163_11300171 3300014325 Bacteria 789
84 Ga0163163_12920065 3300014325 Bacteria 533
85 Ga0157379_10375363 3300014968 Bacteria 1304
86 Ga0163161_11105987 3300017792 Bacteria 681
87 Ga0206356_11565444 3300020070 Bacteria 1421
88 Ga0206353_10049373 3300020082 Bacteria 750
89 Ga0206353_11055960 3300020082 Bacteria 1167
90 Ga0213874_10071949 3300021377 Bacteria 1105
91 Ga0207642_10161131 3300025899 Bacteria 1205
92 Ga0207642_10285085 3300025899 Bacteria 951
93 Ga0207680_10654920 3300025903 Unclassified 752
94 Ga0207643_10645604 3300025908 Bacteria 683
95 Ga0207707_10062352 3300025912 Bacteria 3244
96 Ga0207649_10590462 3300025920 Bacteria 853
97 Ga0207652_10345066 3300025921 Bacteria 1344
98 Ga0207664_10014653 3300025929 Bacteria 5670
99 Ga0207706_11400774 3300025933 Unclassified 574
100 Ga0207686_10878926 3300025934 Bacteria 722
101 Ga0207709_10104072 3300025935 Bacteria 1883
102 Ga0207709_10156708 3300025935 Bacteria 1583
103 Ga0207669_11184750 3300025937 Unclassified 647
104 Ga0207661_11383334 3300025944 Bacteria 646
105 Ga0207651_10341108 3300025960 Bacteria 1259
106 Ga0207668_10526216 3300025972 Bacteria 1021
107 Ga0207658_11000648 3300025986 Bacteria 763
108 Ga0207677_12218050 3300026023 Bacteria 511
109 Ga0207703_10814054 3300026035 Bacteria 892
110 Ga0207678_10144216 3300026067 Bacteria 2032
111 Ga0207678_10891953 3300026067 Bacteria 786
112 Ga0207708_10404105 3300026075 Unclassified 1130
113 Ga0207708_10504765 3300026075 Bacteria 1014
114 Ga0207702_10140186 3300026078 Bacteria 2187
115 Ga0207648_10188359 3300026089 Bacteria 1828
116 Ga0207648_10644968 3300026089 Bacteria 978
117 Ga0207676_10499700 3300026095 Bacteria 1155
118 Ga0207676_11697475 3300026095 Unclassified 630
119 Ga0207675_100397728 3300026118 Bacteria 1357
120 Ga0207675_102031136 3300026118 Bacteria 592
121 Ga0207683_10331646 3300026121 Bacteria 1395
122 Ga0207683_10468166 3300026121 Bacteria 1162
123 Ga0207698_10333398 3300026142 Bacteria 1426
124 Ga0207428_10118396 3300027907 Bacteria 2033
125 Ga0207428_10210264 3300027907 Bacteria 1462
126 Ga0268266_11663650 3300028379 Unclassified 614
127 Ga0307405_12128886 3300031731 Bacteria 504
128 Ga0307413_10030756 3300031824 Bacteria 3020
129 Ga0307413_10098036 3300031824 Bacteria 1929
130 Ga0307413_10177778 3300031824 Bacteria 1514
131 Ga0307410_10141883 3300031852 Bacteria 1778
132 Ga0307410_10239165 3300031852 Bacteria 1406
133 Ga0307410_10664867 3300031852 Bacteria 875
134 Ga0307406_10161483 3300031901 Bacteria 1611
135 Ga0307406_11063280 3300031901 Bacteria 697
136 Ga0307407_10178530 3300031903 Unclassified 1405
137 Ga0307407_10753303 3300031903 Unclassified 738
138 Ga0307412_10357600 3300031911 Bacteria 1175
139 Ga0307412_11488790 3300031911 Unclassified 615
140 Ga0307409_100329422 3300031995 Bacteria 1432
141 Ga0307409_100505935 3300031995 Viruses 1177
142 Ga0307409_102153075 3300031995 Unclassified 587
143 Ga0307416_100024584 3300032002 Bacteria 4401
144 Ga0307416_103864930 3300032002 Bacteria 502
145 Ga0307414_10748988 3300032004 Bacteria 888
146 Ga0307415_100045819 3300032126 Bacteria 2935
147 Ga0307415_100670067 3300032126 Unclassified 932
148 Ga0395900_0345193 3300037418 Bacteria 1463
149 Ga0395900_0836554 3300037418 Bacteria 847
150 Ga0395900_1006635 3300037418 Bacteria 753
151 Ga0395900_1254089 3300037418 Bacteria 656
152 Ga0395898_0508341 3300037466 Bacteria 1146
153 Ga0395905_0848697 3300037471 Bacteria 816
154 Ga0395901_0163140 3300038443 Bacteria 2340
155 Ga0395901_0398073 3300038443 Bacteria 1415
156 Ga0395901_0458979 3300038443 Bacteria 1302
157 Ga0395901_0603973 3300038443 Bacteria 1106
158 Ga0395901_0763226 3300038443 Bacteria 959
159 Ga0436360_1335886 3300039438 Bacteria 928
160 Ga0436363_0064795 3300039450 Bacteria 1195
161 Ga0436363_0093771 3300039450 Bacteria 2261
162 Ga0436363_1699585 3300039450 Bacteria 1287
163 Ga0451789_1361000 3300041443 Bacteria 711
164 Ga0451793_0100833 3300041452 Unclassified 544
165 Ga0451804_0475326 3300041463 Unclassified 666
166 Ga0451807_0363374 3300041486 Bacteria 597
167 Ga0451845_0682457 3300041501 Unclassified 620
168 Ga0451853_0907032 3300041512 Unclassified 722
169 Ga0451853_1779082 3300041512 Bacteria 734
170 Ga0439450_010215 3300042008 Bacteria 1805
171 Ga0439454_102873 3300042011 Unclassified 538
172 Ga0439463_052086 3300042016 Bacteria 1044
173 Ga0439460_0139664 3300042461 Bacteria 803
174 Ga0439440_0011809 3300042993 Bacteria 1848
175 Ga0439440_0178319 3300042993 Unclassified 621
176 Ga0466965_0507439 3300044683 Bacteria 677
177 Ga0466966_0339267 3300044684 Bacteria 903
178 Ga0466966_0340580 3300044684 Bacteria 901
179 Ga0466961_0127759 3300044693 Bacteria 1594
180 Ga0466961_0450825 3300044693 Bacteria 779
181 Ga0466961_0476702 3300044693 Bacteria 754
182 Ga0466963_0101087 3300044694 Bacteria 1974
183 Ga0466963_0244079 3300044694 Bacteria 1260
184 Ga0466963_1278182 3300044694 Unclassified 515
185 Ga0466964_0165916 3300044706 Bacteria 1036
186 Ga0466964_0735023 3300044706 Bacteria 553
187 Ga0466971_0017617 3300044719 Bacteria 3162
188 Ga0466971_0146484 3300044719 Bacteria 1101
189 Ga0466971_0476942 3300044719 Bacteria 614
190 Ga0466970_0087024 3300044765 Bacteria 1694
191 Ga0466957_0116223 3300044842 Bacteria 1702
192 Ga0466957_0442148 3300044842 Bacteria 895
193 Ga0466960_0028182 3300044901 Bacteria 2569
194 Ga0466960_0338158 3300044901 Unclassified 856
195 Ga0466960_1029862 3300044901 Unclassified 507
196 Ga0466959_0163731 3300045049 Bacteria 1563
197 Ga0466958_0742256 3300045836 Bacteria 640
198 Ga0466967_0004855 3300045976 Bacteria 9178
199 Ga0466967_0022456 3300045976 Bacteria 5149
200 Ga0466967_0100302 3300045976 Bacteria 2645
201 Ga0466967_0262594 3300045976 Bacteria 1652
202 Ga0466967_0297385 3300045976 Bacteria 1552
203 Ga0466967_0432180 3300045976 Bacteria 1285
204 Ga0466967_0469363 3300045976 Bacteria 1232
205 Ga0466967_0472765 3300045976 Bacteria 1227
206 Ga0466967_0712197 3300045976 Bacteria 994
207 Ga0466967_0735941 3300045976 Bacteria 978
208 Ga0466967_1019832 3300045976 Bacteria 824
209 Ga0466967_1113222 3300045976 Bacteria 787
210 Ga0466967_1278318 3300045976 Unclassified 731
211 Ga0495582_0266651 3300046473 Bacteria 982
212 Ga0495605_0233256 3300046474 Bacteria 792
213 Ga0495664_0172554 3300046477 Bacteria 1312
214 Ga0495596_0222728 3300046500 Bacteria 733
215 Ga0495607_0372930 3300046501 Bacteria 654
216 Ga0495608_0115063 3300046511 Bacteria 1727
217 Ga0495620_0096356 3300046515 Bacteria 1183
218 Ga0495643_0406138 3300046522 Bacteria 600
219 Ga0495644_0162622 3300046523 Bacteria 856
220 Ga0495663_0166699 3300046525 Bacteria 758
221 Ga0495656_0194874 3300046615 Bacteria 1003
222 Ga0495668_0500168 3300046616 Bacteria 670
223 Ga0495635_0343137 3300046663 Bacteria 997
224 Ga0495659_0560305 3300046664 Unclassified 505
225 Ga0495658_0153277 3300046683 Bacteria 1417
226 Ga0495613_0440959 3300046689 Bacteria 883
227 Ga0495624_0145257 3300046690 Bacteria 1452
228 Ga0495670_0197911 3300046691 Bacteria 1064
229 Ga0495589_0134729 3300046794 Bacteria 1185
230 Ga0495675_0406799 3300047444 Bacteria 793
231 Ga0495684_0680085 3300047471 Bacteria 685
232 Ga0495602_0667124 3300048088 Unclassified 709
233 Ga0496102_0575832 3300048905 Bacteria 1049
234 Ga0496102_0677859 3300048905 Bacteria 954
235 Ga0496102_1830110 3300048905 Unclassified 524
236 Ga0496104_0009205 3300048907 Bacteria 8780
237 Ga0496105_0008008 3300048908 Bacteria 8210
238 Ga0496106_0807122 3300048909 Bacteria 744
239 Ga0496108_0223752 3300048911 Bacteria 1635
240 Ga0496108_1761862 3300048911 Bacteria 508
241 Ga0496109_0003214 3300048912 Bacteria 13607
242 Ga0496109_0514861 3300048912 Bacteria 1129
243 Ga0496109_1182434 3300048912 Bacteria 701
244 Ga0496110_0340126 3300048913 Bacteria 1367
245 Ga0496111_0162223 3300048914 Bacteria 1660
246 Ga0496111_0428544 3300048914 Bacteria 977
247 Ga0496112_0484900 3300048915 Bacteria 1172
248 Ga0496114_0695389 3300048917 Bacteria 892
249 Ga0496114_1686754 3300048917 Unclassified 522
250 Ga0501318_058919 3300049534 Unclassified 586
251 Ga0501031_0039203 3300049568 Bacteria 3091
252 Ga0501032_0364633 3300049569 Bacteria 930
253 Ga0501033_0396577 3300049570 Bacteria 963
254 Ga0501033_0677770 3300049570 Unclassified 703
255 Ga0501036_0528872 3300049572 Bacteria 980
256 Ga0501036_0765750 3300049572 Unclassified 796
257 Ga0501037_0929122 3300049573 Bacteria 569
258 Ga0501037_1156065 3300049573 Bacteria 500
259 Ga0501038_0045908 3300049574 Bacteria 3790
260 Ga0501038_1112150 3300049574 Unclassified 576
261 Ga0501039_0356312 3300049575 Bacteria 1149
262 Ga0501039_0532257 3300049575 Bacteria 922
263 Ga0501040_0025955 3300049576 Bacteria 3942
264 Ga0501041_0020730 3300049577 Bacteria 3933
265 Ga0501041_0491504 3300049577 Bacteria 780
266 Ga0501042_0046117 3300049578 Bacteria 3107
267 Ga0501042_0385097 3300049578 Bacteria 1015
268 Ga0501042_0420485 3300049578 Bacteria 968
269 Ga0501042_0962300 3300049578 Bacteria 622
270 Ga0501043_0588727 3300049579 Unclassified 823
271 Ga0501048_0023077 3300049582 Bacteria 4548
272 Ga0501048_0054447 3300049582 Bacteria 2842
273 Ga0501067_0166445 3300049583 Bacteria 1228
274 Ga0501067_0420836 3300049583 Bacteria 745
275 Ga0501067_0526313 3300049583 Unclassified 662
276 Ga0501068_0427278 3300049584 Bacteria 856
277 Ga0501068_0515016 3300049584 Bacteria 776
278 Ga0501068_0755303 3300049584 Bacteria 637
279 Ga0501068_0981499 3300049584 Unclassified 557
280 Ga0501069_0420069 3300049585 Unclassified 793
281 Ga0501071_0073790 3300049587 Bacteria 2489
282 Ga0501071_0299257 3300049587 Bacteria 1219
283 Ga0501072_0196161 3300049588 Bacteria 1610
284 Ga0501072_0229966 3300049588 Bacteria 1477
285 Ga0501074_0085658 3300049590 Bacteria 2258
286 Ga0501074_0763860 3300049590 Unclassified 681
287 Ga0501075_0065272 3300049591 Bacteria 2746
288 Ga0501075_0276839 3300049591 Bacteria 1279
289 Ga0501075_1422374 3300049591 Bacteria 525
290 Ga0501076_0424954 3300049592 Bacteria 1093
291 Ga0501077_0271558 3300049593 Bacteria 1079
292 Ga0501077_1014430 3300049593 Unclassified 534
293 Ga0501079_0065707 3300049741 Bacteria 2799
294 Ga0501079_1566357 3300049741 Bacteria 518
295 Ga0501080_0617709 3300049742 Bacteria 961
296 Ga0501080_0816475 3300049742 Bacteria 817
297 Ga0501081_0287234 3300049743 Bacteria 1205
298 Ga0501044_0962197 3300049823 Unclassified 727
299 Ga0501045_0069646 3300049824 Bacteria 2586
300 Ga0501045_0960317 3300049824 Unclassified 627
301 nmdc:mga05p37_1566970_c1 3300050507 Bacteria 651
302 nmdc:mga05p37_1687851_c1 3300050507 Bacteria 618
303 nmdc:mga05p37_2167288_c1 3300050507 Unclassified 518
304 nmdc:mga09592_1638662_c1 3300050508 Bacteria 520
305 nmdc:mga09592_256972_c1 3300050508 Bacteria 1514
306 nmdc:mga08y16_129051_c1 3300050511 Bacteria 2630
307 nmdc:mga08y16_2124783_c1 3300050511 Bacteria 509
308 nmdc:mga08y16_731215_c1 3300050511 Bacteria 987
309 nmdc:mga0n895_316515_c1 3300050512 Bacteria 1581
310 nmdc:mga0n895_353792_c1 3300050512 Bacteria 1487
311 nmdc:mga0a205_612488_c1 3300050515 Bacteria 941
312 Ga0495601_0454195 3300053077 Bacteria 829
313 Ga0501084_0049842 3300054114 Bacteria 3505
314 Ga0501084_0072269 3300054114 Bacteria 2889
315 Ga0501084_1038545 3300054114 Bacteria 688
316 Ga0590071_146992 3300059421 Bacteria 610
317 Ga0590075_133282 3300059424 Unclassified 653
318 Ga0590077_019460 3300059426 Bacteria 1439
319 Ga0501082_0500091 3300060353 Bacteria 1062
320 Ga0466962_0142504 3300061719 Bacteria 1161
321 Ga0466962_0212906 3300061719 Bacteria 945
322 Ga0466962_0464785 3300061719 Bacteria 638
323 Ga0530510_0042962 3300061734 Bacteria 3265
324 Ga0530510_0107656 3300061734 Bacteria 2040
325 Ga0075428_101034420
326 JGI25407J50210_10025845
327 Ga0070683_100542802
328 Ga0070680_100821798
329 Ga0070682_100670157
330 Ga0068868_101970191
331 Ga0070691_10436749
332 Ga0070661_100731634
333 Ga0070692_11218144
334 Ga0070668_100833634
335 Ga0070674_100976893
336 Ga0070673_100594122
337 Ga0070688_100652467
338 Ga0070659_101356048
339 Ga0070667_100831386
340 Ga0070709_11361209
341 Ga0070714_100256557
342 Ga0070713_101648148
343 Ga0070700_100815360
344 Ga0070700_101152931
345 Ga0070663_101594035
346 Ga0070662_101128959
347 Ga0070681_10076175
348 Ga0070685_10603245
349 Ga0070698_101271496
350 Ga0070679_101628191
351 Ga0070684_100473445
352 Ga0070684_100968244
353 Ga0070697_101467766
354 Ga0070696_100692606
355 Ga0070693_100266841
356 Ga0070693_100517609
357 Ga0068856_100115932
358 Ga0068856_101895182
359 Ga0070702_100498348
360 Ga0070702_100503517
361 Ga0068852_101642765
362 Ga0068859_101700895
363 Ga0068864_101603160
364 Ga0068866_10096039
365 Ga0068866_10429738
366 Ga0068870_11128612
367 Ga0068862_101060976
368 Ga0081455_10039495
369 Ga0081455_10209150
370 Ga0081538_10011872
371 Ga0081538_10022136
372 Ga0081538_10064114
373 Ga0081539_10001679
374 Ga0075365_11161796
375 Ga0070712_101684016
376 Ga0075428_100087232
377 Ga0075434_101268727
378 Ga0075434_102125189
379 Ga0075429_101713425
380 Ga0097620_101700731
381 Ga0111539_10152098
382 Ga0111539_10976698
383 Ga0111539_11194502
384 Ga0105245_11910363
385 Ga0114129_10226290
386 Ga0114129_10990235
387 Ga0114129_11002376
388 Ga0114129_11341936
389 Ga0114129_13021226
390 Ga0105243_10193882
391 Ga0105243_11775769
392 Ga0105241_10398036
393 Ga0105242_10304083
394 Ga0105248_10752503
395 Ga0105238_10265424
396 Ga0105249_10303233
397 Ga0105239_10315076
398 Ga0105239_13397036
399 Ga0105246_10669365
400 Ga0157371_11045435
401 Ga0157369_12588693
402 Ga0157374_11741741
403 Ga0157378_10429385
404 Ga0157378_10456149
405 Ga0163162_10693560
406 Ga0157375_10958667
407 Ga0163163_11300171
408 Ga0163163_12920065
409 Ga0157379_10375363
410 Ga0163161_11105987
411 Ga0206356_11565444
412 Ga0206353_10049373
413 Ga0206353_11055960
414 Ga0213874_10071949
415 Ga0207642_10161131
416 Ga0207642_10285085
417 Ga0207680_10654920
418 Ga0207643_10645604
419 Ga0207707_10062352
420 Ga0207649_10590462
421 Ga0207652_10345066
422 Ga0207664_10014653
423 Ga0207706_11400774
424 Ga0207686_10878926
425 Ga0207709_10104072
426 Ga0207709_10156708
427 Ga0207669_11184750
428 Ga0207661_11383334
429 Ga0207651_10341108
430 Ga0207668_10526216
431 Ga0207658_11000648
432 Ga0207677_12218050
433 Ga0207703_10814054
434 Ga0207678_10144216
435 Ga0207678_10891953
436 Ga0207708_10404105
437 Ga0207708_10504765
438 Ga0207702_10140186
439 Ga0207648_10188359
440 Ga0207648_10644968
441 Ga0207676_10499700
442 Ga0207676_11697475
443 Ga0207675_100397728
444 Ga0207675_102031136
445 Ga0207683_10331646
446 Ga0207683_10468166
447 Ga0207698_10333398
448 Ga0207428_10118396
449 Ga0207428_10210264
450 Ga0268266_11663650
451 Ga0307405_12128886
452 Ga0307413_10030756
453 Ga0307413_10098036
454 Ga0307413_10177778
455 Ga0307410_10141883
456 Ga0307410_10239165
457 Ga0307410_10664867
458 Ga0307406_10161483
459 Ga0307406_11063280
460 Ga0307407_10178530
461 Ga0307407_10753303
462 Ga0307412_10357600
463 Ga0307412_11488790
464 Ga0307409_100329422
465 Ga0307409_100505935
466 Ga0307409_102153075
467 Ga0307416_100024584
468 Ga0307416_103864930
469 Ga0307414_10748988
470 Ga0307415_100045819
471 Ga0307415_100670067
472 Ga0395900_0345193
473 Ga0395900_0836554
474 Ga0395900_1006635
475 Ga0395900_1254089
476 Ga0395898_0508341
477 Ga0395905_0848697
478 Ga0395901_0163140
479 Ga0395901_0398073
480 Ga0395901_0458979
481 Ga0395901_0603973
482 Ga0395901_0763226
483 Ga0436360_1335886
484 Ga0436363_0064795
485 Ga0436363_0093771
486 Ga0436363_1699585
487 Ga0451789_1361000
488 Ga0451793_0100833
489 Ga0451804_0475326
490 Ga0451807_0363374
491 Ga0451845_0682457
492 Ga0451853_0907032
493 Ga0451853_1779082
494 Ga0439450_010215
495 Ga0439454_102873
496 Ga0439463_052086
497 Ga0439460_0139664
498 Ga0439440_0011809
499 Ga0439440_0178319
500 Ga0466965_0507439
501 Ga0466966_0339267
502 Ga0466966_0340580
503 Ga0466961_0127759
504 Ga0466961_0450825
505 Ga0466961_0476702
506 Ga0466963_0101087
507 Ga0466963_0244079
508 Ga0466963_1278182
509 Ga0466964_0165916
510 Ga0466964_0735023
511 Ga0466971_0017617
512 Ga0466971_0146484
513 Ga0466971_0476942
514 Ga0466970_0087024
515 Ga0466957_0116223
516 Ga0466957_0442148
517 Ga0466960_0028182
518 Ga0466960_0338158
519 Ga0466960_1029862
520 Ga0466959_0163731
521 Ga0466958_0742256
522 Ga0466967_0004855
523 Ga0466967_0022456
524 Ga0466967_0100302
525 Ga0466967_0262594
526 Ga0466967_0297385
527 Ga0466967_0432180
528 Ga0466967_0469363
529 Ga0466967_0472765
530 Ga0466967_0712197
531 Ga0466967_0735941
532 Ga0466967_1019832
533 Ga0466967_1113222
534 Ga0466967_1278318
535 Ga0495582_0266651
536 Ga0495605_0233256
537 Ga0495664_0172554
538 Ga0495596_0222728
539 Ga0495607_0372930
540 Ga0495608_0115063
541 Ga0495620_0096356
542 Ga0495643_0406138
543 Ga0495644_0162622
544 Ga0495663_0166699
545 Ga0495656_0194874
546 Ga0495668_0500168
547 Ga0495635_0343137
548 Ga0495659_0560305
549 Ga0495658_0153277
550 Ga0495613_0440959
551 Ga0495624_0145257
552 Ga0495670_0197911
553 Ga0495589_0134729
554 Ga0495675_0406799
555 Ga0495684_0680085
556 Ga0495602_0667124
557 Ga0496102_0575832
558 Ga0496102_0677859
559 Ga0496102_1830110
560 Ga0496104_0009205
561 Ga0496105_0008008
562 Ga0496106_0807122
563 Ga0496108_0223752
564 Ga0496108_1761862
565 Ga0496109_0003214
566 Ga0496109_0514861
567 Ga0496109_1182434
568 Ga0496110_0340126
569 Ga0496111_0162223
570 Ga0496111_0428544
571 Ga0496112_0484900
572 Ga0496114_0695389
573 Ga0496114_1686754
574 Ga0501318_058919
575 Ga0501031_0039203
576 Ga0501032_0364633
577 Ga0501033_0396577
578 Ga0501033_0677770
579 Ga0501036_0528872
580 Ga0501036_0765750
581 Ga0501037_0929122
582 Ga0501037_1156065
583 Ga0501038_0045908
584 Ga0501038_1112150
585 Ga0501039_0356312
586 Ga0501039_0532257
587 Ga0501040_0025955
588 Ga0501041_0020730
589 Ga0501041_0491504
590 Ga0501042_0046117
591 Ga0501042_0385097
592 Ga0501042_0420485
593 Ga0501042_0962300
594 Ga0501043_0588727
595 Ga0501048_0023077
596 Ga0501048_0054447
597 Ga0501067_0166445
598 Ga0501067_0420836
599 Ga0501067_0526313
600 Ga0501068_0427278
601 Ga0501068_0515016
602 Ga0501068_0755303
603 Ga0501068_0981499
604 Ga0501069_0420069
605 Ga0501071_0073790
606 Ga0501071_0299257
607 Ga0501072_0196161
608 Ga0501072_0229966
609 Ga0501074_0085658
610 Ga0501074_0763860
611 Ga0501075_0065272
612 Ga0501075_0276839
613 Ga0501075_1422374
614 Ga0501076_0424954
615 Ga0501077_0271558
616 Ga0501077_1014430
617 Ga0501079_0065707
618 Ga0501079_1566357
619 Ga0501080_0617709
620 Ga0501080_0816475
621 Ga0501081_0287234
622 Ga0501044_0962197
623 Ga0501045_0069646
624 Ga0501045_0960317
625 nmdc:mga05p37_1566970_c1
626 nmdc:mga05p37_1687851_c1
627 nmdc:mga05p37_2167288_c1
628 nmdc:mga09592_1638662_c1
629 nmdc:mga09592_256972_c1
630 nmdc:mga08y16_129051_c1
631 nmdc:mga08y16_2124783_c1
632 nmdc:mga08y16_731215_c1
633 nmdc:mga0n895_316515_c1
634 nmdc:mga0n895_353792_c1
635 nmdc:mga0a205_612488_c1
636 Ga0495601_0454195
637 Ga0501084_0049842
638 Ga0501084_0072269
639 Ga0501084_1038545
640 Ga0590071_146992
641 Ga0590075_133282
642 Ga0590077_019460
643 Ga0501082_0500091
644 Ga0466962_0142504
645 Ga0466962_0212906
646 Ga0466962_0464785
647 Ga0530510_0042962
648 Ga0530510_0107656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

5

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9369 6 94
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9307 6 94
7nav-assembly1.cif.gz_V bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.9257 5 96
2kzf-assembly1.cif.gz_A solution nmr structure of the thermotoga maritima protein tm0855 a putative ribosome binding factor a 0.9079 5 93
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.901 1 97
ID Description Score Start End Superfamily
af_P0A7G2_1_108_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9395 5 102 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9307 6 94 3.30.300.20
2kzfA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9079 5 93 3.30.300.20
af_Q5VPH3_41_157_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9003 5 101 3.30.300.20
af_Q2G2Q4_1_115_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8855 1 113 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A496UT03-F1-model_v4 Ribosome-binding factor A 0.9817 5 110 GO:0003676
GO:0005737
GO:0030490
AF-A0A1F4T4H0-F1-model_v4 Ribosome-binding factor A 0.9791 5 110 GO:0005829
GO:0030490
GO:0043024
AF-A0A1F2WJH0-F1-model_v4 Ribosome-binding factor A 0.9724 5 113 GO:0003676
GO:0005737
GO:0030490
AF-U2KBC0-F1-model_v4 Ribosome-binding factor A 0.9719 2 114 GO:0005829
GO:0030490
GO:0043024
AF-A0A1Q7LBC5-F1-model_v4 Ribosome-binding factor A 0.9665 3 97 GO:0005829
GO:0006364
GO:0043024

Map