F407137

General Info

Members Datasets Scaffolds Average Seq Length
323 199 646 164

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0010476|Ga0500559_0010476_212_766
Length 184
Sequence MSLAQSAPAHPDNAAVISLKDKAPHAMKALTIRLQDELFAVEAGSVREILDLVPITEVPNASPFVGGLINVRGRVVPLADLRVMFNMDRPDPDADTRIVVMEIDIEGEPAIVGILADKVHDVTDIETASIEEAPRVGMRWKPEFVAGIGKRNGQFVIIPDMNKIFQTQIARKANQQNPEERSPT

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
161 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
162 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
183 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
184 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
185 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
186 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
187 2643221580 Devosia sp. Root635 Isolate Unclassified
188 2643221584 Caulobacter sp. Root656 Isolate Unclassified
189 2643221591 Devosia sp. Root685 Isolate Unclassified
190 2643221629 Devosia sp. Root105 Isolate Unclassified
191 2643221640 Caulobacter sp. Root342 Isolate Unclassified
192 2643221642 Caulobacter sp. Root343 Isolate Unclassified
193 2643221662 Devosia sp. Root413D1 Isolate Unclassified
194 2643221674 Devosia sp. Root436 Isolate Unclassified
195 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
196 2818991435 Caulobacter henricii 536 Isolate Unclassified
197 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
198 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
199 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 0
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.93
Nodule 0
Rhizoplane 1.24
Rhizosphere 61.61
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0010476 3300053136 Bacteria 3980
2 JGI25165J46597_1005238 3300003214 Bacteria 2551
3 JGI25153J46596_10006258 3300003215 Bacteria 6084
4 JGI25153J46596_10075447 3300003215 Bacteria 857
5 rootH2_10006208 3300003320 Bacteria 13872
6 rootH2_10092011 3300003320 Bacteria 2028
7 rootL2_10061176 3300003322 Bacteria 1033
8 rootL2_10061177 3300003322 Bacteria 2107
9 rootH1_10079308 3300003323 Bacteria 2036
10 Ga0055537_1001608 3300003773 Bacteria 8506
11 Ga0055524_1002102 3300003775 Bacteria 10525
12 Ga0055524_1052966 3300003775 Bacteria 902
13 Ga0055536_1000614 3300003781 Bacteria 24285
14 Ga0055536_1005655 3300003781 Bacteria 6048
15 Ga0055528_1008596 3300003790 Bacteria 4348
16 Ga0055530_10001919 3300003791 Bacteria 14197
17 Ga0055530_10003968 3300003791 Bacteria 7994
18 Ga0055530_10018010 3300003791 Bacteria 2193
19 Ga0055531_10001676 3300003794 Bacteria 15946
20 Ga0055531_10006391 3300003794 Bacteria 6701
21 Ga0055531_10007324 3300003794 Bacteria 6048
22 Ga0065165_1000192 3300005262 Bacteria 106862
23 Ga0065165_1007162 3300005262 Bacteria 5577
24 Ga0065704_10197425 3300005289 Bacteria 1161
25 Ga0070658_10004891 3300005327 Bacteria 10915
26 Ga0070661_100017991 3300005344 Bacteria 5019
27 Ga0070661_100018694 3300005344 Bacteria 4931
28 Ga0070661_100253110 3300005344 Bacteria 1360
29 Ga0070659_100098224 3300005366 Bacteria 2354
30 Ga0070667_100607470 3300005367 Bacteria 1008
31 Ga0070663_100530592 3300005455 Bacteria 981
32 Ga0070681_10960386 3300005458 Bacteria 774
33 Ga0070679_100391393 3300005530 Bacteria 1336
34 Ga0068853_100037867 3300005539 Bacteria 4106
35 Ga0068855_100047692 3300005563 Bacteria 5060
36 Ga0068855_100111216 3300005563 Bacteria 3144
37 Ga0068855_100377130 3300005563 Bacteria 1558
38 Ga0068855_100613944 3300005563 Bacteria 1171
39 Ga0068855_101622487 3300005563 Bacteria 661
40 Ga0068857_100267304 3300005577 Bacteria 1571
41 Ga0068854_100043625 3300005578 Bacteria 3179
42 Ga0068856_100033684 3300005614 Bacteria 5016
43 Ga0068852_100008082 3300005616 Bacteria 7719
44 Ga0068852_100030195 3300005616 Bacteria 4459
45 Ga0068852_100048337 3300005616 Bacteria 3634
46 Ga0068852_100354649 3300005616 Bacteria 1433
47 Ga0075365_10146677 3300006038 Bacteria 1640
48 Ga0075368_10022186 3300006042 Bacteria 2415
49 Ga0075364_10764036 3300006051 Bacteria 659
50 Ga0075367_10068208 3300006178 Bacteria 2133
51 Ga0075369_10008658 3300006186 Bacteria 3925
52 Ga0075366_10175924 3300006195 Bacteria 1299
53 Ga0075366_10184887 3300006195 Bacteria 1266
54 Ga0075370_10088260 3300006353 Bacteria 1788
55 Ga0105240_10121721 3300009093 Bacteria 3141
56 Ga0105238_10141185 3300009551 Bacteria 2385
57 Ga0105239_10078209 3300010375 Bacteria 3640
58 Ga0157373_10244748 3300013100 Bacteria 1268
59 Ga0157373_10304935 3300013100 Bacteria 1131
60 Ga0157371_10369488 3300013102 Bacteria 1046
61 Ga0157370_10023865 3300013104 Bacteria 6065
62 Ga0157370_10278980 3300013104 Bacteria 1544
63 Ga0157370_10326115 3300013104 Bacteria 1416
64 Ga0157370_11368775 3300013104 Unclassified 637
65 Ga0157369_10028825 3300013105 Bacteria 6140
66 Ga0157369_10035813 3300013105 Bacteria 5441
67 Ga0157372_10041130 3300013307 Bacteria 5109
68 Ga0157372_10282113 3300013307 Bacteria 1931
69 Ga0163163_10185735 3300014325 Bacteria 2127
70 Ga0213872_10001373 3300021361 Bacteria 16037
71 Ga0213872_10002297 3300021361 Bacteria 11397
72 Ga0213872_10004701 3300021361 Bacteria 7173
73 Ga0213872_10013992 3300021361 Bacteria 3751
74 Ga0213872_10064290 3300021361 Bacteria 1657
75 Ga0207427_104099 3300025231 Bacteria 2622
76 Ga0209233_1000866 3300025261 Bacteria 13356
77 Ga0209565_1000266 3300025263 Bacteria 54266
78 Ga0209673_1001114 3300025273 Bacteria 29923
79 Ga0209673_1026040 3300025273 Bacteria 1931
80 Ga0209675_1002890 3300025291 Bacteria 8507
81 Ga0209676_1000295 3300025292 Bacteria 100711
82 Ga0209676_1000392 3300025292 Bacteria 79950
83 Ga0209564_1001656 3300025295 Bacteria 21435
84 Ga0209564_1023167 3300025295 Bacteria 2166
85 Ga0209758_1000240 3300025297 Bacteria 114169
86 Ga0209758_1000785 3300025297 Bacteria 45459
87 Ga0209758_1001874 3300025297 Bacteria 23048
88 Ga0209758_1004340 3300025297 Bacteria 11884
89 Ga0209050_1000029 3300025298 Bacteria 465801
90 Ga0209050_1000362 3300025298 Bacteria 87030
91 Ga0209050_1000411 3300025298 Bacteria 79805
92 Ga0209256_1001074 3300025299 Bacteria 31611
93 Ga0209256_1013836 3300025299 Bacteria 2963
94 Ga0209256_1032434 3300025299 Bacteria 1416
95 Ga0207426_1070081 3300025302 Bacteria 981
96 Ga0209051_1002593 3300025303 Bacteria 12725
97 Ga0209257_1000066 3300025304 Bacteria 344166
98 Ga0209257_1000493 3300025304 Bacteria 71002
99 Ga0209257_1000513 3300025304 Bacteria 67348
100 Ga0209257_1008646 3300025304 Bacteria 5709
101 Ga0207705_10095716 3300025909 Bacteria 2179
102 Ga0207707_11038449 3300025912 Bacteria 671
103 Ga0207695_10158821 3300025913 Bacteria 2194
104 Ga0207649_10027924 3300025920 Bacteria 3318
105 Ga0207649_10070658 3300025920 Bacteria 2227
106 Ga0207649_10180198 3300025920 Bacteria 1478
107 Ga0207652_10305104 3300025921 Bacteria 1437
108 Ga0207694_10081394 3300025924 Bacteria 2544
109 Ga0207690_10066554 3300025932 Bacteria 2468
110 Ga0207667_10066687 3300025949 Bacteria 3751
111 Ga0207667_10353335 3300025949 Bacteria 1499
112 Ga0207640_10015333 3300025981 Bacteria 4434
113 Ga0207658_10034957 3300025986 Bacteria 3596
114 Ga0207639_10049040 3300026041 Bacteria 3199
115 Ga0207678_11173335 3300026067 Bacteria 680
116 Ga0207678_11726269 3300026067 Bacteria 549
117 Ga0207702_10019166 3300026078 Bacteria 5661
118 Ga0207702_10189882 3300026078 Bacteria 1897
119 Ga0207674_10232343 3300026116 Bacteria 1792
120 Ga0207698_10019850 3300026142 Bacteria 4612
121 Ga0207698_10091308 3300026142 Bacteria 2493
122 Ga0209813_10012732 3300027866 Bacteria 2231
123 Ga0265319_1029313 3300028563 Bacteria 1933
124 Ga0265334_10207786 3300028573 Bacteria 679
125 Ga0265318_10011750 3300028577 Bacteria 3752
126 Ga0265324_10003311 3300029957 Bacteria 7742
127 Ga0265328_10014516 3300031239 Bacteria 3101
128 Ga0265320_10024438 3300031240 Bacteria 3196
129 Ga0265320_10047535 3300031240 Bacteria 2098
130 Ga0265329_10087352 3300031242 Bacteria 989
131 Ga0265331_10000403 3300031250 Bacteria 44394
132 Ga0265327_10018081 3300031251 Bacteria 4385
133 Ga0307513_10067004 3300031456 Bacteria 3770
134 Ga0307513_10526100 3300031456 Bacteria 897
135 Ga0265313_10015184 3300031595 Bacteria 4502
136 Ga0265313_10122428 3300031595 Bacteria 1133
137 Ga0316575_10227237 3300031665 Bacteria 780
138 Ga0265314_10000870 3300031711 Bacteria 35906
139 Ga0265314_10028120 3300031711 Bacteria 4196
140 Ga0265314_10220225 3300031711 Bacteria 1108
141 Ga0307516_10035764 3300031730 Bacteria 4979
142 Ga0307516_10437429 3300031730 Bacteria 965
143 Ga0307413_10583785 3300031824 Bacteria 912
144 Ga0307414_10129111 3300032004 Bacteria 1959
145 Ga0307414_11158454 3300032004 Bacteria 715
146 Ga0307510_10055483 3300033180 Bacteria 4138
147 Ga0307510_10236677 3300033180 Bacteria 1324
148 Ga0307510_10423629 3300033180 Bacteria 773
149 Ga0373927_0000326 3300035695 Bacteria 37493
150 Ga0316582_0019614 3300036647 Bacteria 3962
151 Ga0373925_0016809 3300037068 Bacteria 5297
152 Ga0395899_0091396 3300037312 Bacteria 2205
153 Ga0395899_0098107 3300037312 Bacteria 2117
154 Ga0395900_0053641 3300037418 Bacteria 4149
155 Ga0395900_0108044 3300037418 Bacteria 2858
156 Ga0395900_0202964 3300037418 Bacteria 2005
157 Ga0395898_0076795 3300037466 Bacteria 3225
158 Ga0395898_0108806 3300037466 Bacteria 2657
159 Ga0395898_0224095 3300037466 Bacteria 1793
160 Ga0395905_0079347 3300037471 Bacteria 3077
161 Ga0436360_0812873 3300039438 Bacteria 990
162 Ga0436361_0021071 3300039447 Bacteria 11285
163 Ga0436361_0196141 3300039447 Bacteria 1739
164 Ga0436361_0741013 3300039447 Bacteria 4370
165 Ga0436361_0813166 3300039447 Bacteria 7778
166 Ga0439466_0152461 3300041411 Bacteria 708
167 Ga0439465_0007477 3300041413 Bacteria 3473
168 Ga0451853_4060034 3300041512 Bacteria 891
169 Ga0439459_0077135 3300042438 Bacteria 780
170 Ga0451577_0200729 3300042876 Bacteria 1800
171 Ga0453683_0001398 3300044673 Bacteria 20963
172 Ga0453683_0013421 3300044673 Bacteria 5350
173 Ga0453683_0056760 3300044673 Bacteria 2450
174 Ga0453684_0110409 3300044712 Bacteria 3342
175 Ga0451576_0000301 3300045051 Bacteria 119546
176 Ga0451576_0002693 3300045051 Bacteria 25851
177 Ga0466967_1334461 3300045976 Bacteria 714
178 Ga0495638_0001874 3300046460 Bacteria 18183
179 Ga0495638_0002897 3300046460 Bacteria 13706
180 Ga0495650_0000045 3300046471 Bacteria 346204
181 Ga0495650_0024527 3300046471 Bacteria 2846
182 Ga0495606_0093862 3300046507 Bacteria 1840
183 Ga0495610_0001073 3300046512 Bacteria 25099
184 Ga0495610_0099910 3300046512 Bacteria 1301
185 Ga0495616_0000115 3300046513 Bacteria 70371
186 Ga0495620_0098663 3300046515 Bacteria 1166
187 Ga0495632_0064741 3300046519 Bacteria 1767
188 Ga0495637_0053946 3300046520 Bacteria 1671
189 Ga0495643_0171387 3300046522 Bacteria 1061
190 Ga0495654_0011719 3300046530 Bacteria 4737
191 Ga0495654_0061268 3300046530 Bacteria 1807
192 Ga0495597_0135777 3300046542 Bacteria 1017
193 Ga0495668_0004147 3300046616 Bacteria 10473
194 Ga0495668_0022967 3300046616 Bacteria 3562
195 Ga0495668_0165487 3300046616 Bacteria 1211
196 Ga0495625_0005057 3300046660 Bacteria 12213
197 Ga0495625_0093217 3300046660 Bacteria 2079
198 Ga0495625_0153177 3300046660 Bacteria 1548
199 Ga0495625_0256666 3300046660 Bacteria 1133
200 Ga0495670_0051937 3300046691 Bacteria 2052
201 Ga0495670_0163609 3300046691 Bacteria 1170
202 Ga0495660_0025652 3300046810 Bacteria 3346
203 Ga0495660_0089030 3300046810 Bacteria 1607
204 Ga0495672_0056563 3300047320 Bacteria 2281
205 Ga0495679_006631 3300047446 Bacteria 4951
206 Ga0495673_0000333 3300047469 Bacteria 60696
207 Ga0495673_0023031 3300047469 Bacteria 3040
208 Ga0495681_0060012 3300047470 Bacteria 1756
209 Ga0495686_0119523 3300047472 Bacteria 1572
210 Ga0496110_0106326 3300048913 Bacteria 2518
211 Ga0496114_0879896 3300048917 Bacteria 776
212 Ga0496115_0000595 3300048918 Bacteria 27678
213 Ga0496115_0701659 3300048918 Bacteria 795
214 Ga0496121_0119986 3300048924 Bacteria 1987
215 Ga0496121_0161669 3300048924 Bacteria 1637
216 Ga0496124_0066433 3300048927 Bacteria 3003
217 Ga0496125_0000115 3300048928 Bacteria 181994
218 Ga0496125_0108270 3300048928 Bacteria 2022
219 Ga0496125_0268550 3300048928 Bacteria 1064
220 Ga0496126_0000962 3300048929 Bacteria 49354
221 Ga0496126_0008225 3300048929 Bacteria 11277
222 Ga0501031_0032881 3300049568 Bacteria 3382
223 Ga0501032_0153448 3300049569 Bacteria 1514
224 Ga0501033_0115987 3300049570 Bacteria 1946
225 Ga0501033_0297629 3300049570 Bacteria 1136
226 Ga0501034_0002063 3300049571 Bacteria 25112
227 Ga0501034_0010291 3300049571 Bacteria 9751
228 Ga0501034_0025500 3300049571 Bacteria 6020
229 Ga0501034_0038021 3300049571 Bacteria 4875
230 Ga0501034_0142054 3300049571 Bacteria 2380
231 Ga0501034_0322154 3300049571 Bacteria 1478
232 Ga0501034_0330120 3300049571 Bacteria 1457
233 Ga0501034_0375330 3300049571 Bacteria 1347
234 Ga0501036_0120215 3300049572 Bacteria 2219
235 Ga0501036_0237894 3300049572 Bacteria 1527
236 Ga0501036_0312707 3300049572 Bacteria 1313
237 Ga0501036_0646290 3300049572 Bacteria 876
238 Ga0501037_0453503 3300049573 Bacteria 874
239 Ga0501038_0157713 3300049574 Bacteria 1847
240 Ga0501038_0337485 3300049574 Bacteria 1176
241 Ga0501038_0341727 3300049574 Bacteria 1167
242 Ga0501039_0108821 3300049575 Bacteria 2166
243 Ga0501039_0305564 3300049575 Bacteria 1250
244 Ga0501043_0061840 3300049579 Bacteria 2940
245 Ga0501043_0502811 3300049579 Bacteria 905
246 Ga0501043_0954934 3300049579 Bacteria 612
247 Ga0501043_1085540 3300049579 Bacteria 566
248 Ga0501046_0492503 3300049580 Bacteria 879
249 Ga0501046_0654818 3300049580 Unclassified 742
250 Ga0501047_0071070 3300049581 Bacteria 3350
251 Ga0501047_0141999 3300049581 Bacteria 2279
252 Ga0501047_0154866 3300049581 Bacteria 2166
253 Ga0501068_0146028 3300049584 Bacteria 1485
254 Ga0501069_0171825 3300049585 Bacteria 1251
255 Ga0501070_0065947 3300049586 Bacteria 2998
256 Ga0501070_0110997 3300049586 Bacteria 2266
257 Ga0501070_0303053 3300049586 Bacteria 1301
258 Ga0501080_0791185 3300049742 Bacteria 832
259 Ga0501035_0029874 3300049822 Bacteria 4970
260 Ga0501035_0094891 3300049822 Bacteria 2622
261 Ga0501035_0135058 3300049822 Bacteria 2148
262 Ga0501035_0226540 3300049822 Bacteria 1594
263 Ga0501044_0040421 3300049823 Bacteria 4860
264 Ga0501044_0089135 3300049823 Bacteria 3114
265 Ga0501044_0115153 3300049823 Bacteria 2693
266 Ga0501044_0121403 3300049823 Bacteria 2614
267 Ga0501044_0211669 3300049823 Bacteria 1892
268 Ga0501044_0242090 3300049823 Bacteria 1747
269 Ga0501044_0652431 3300049823 Bacteria 941
270 nmdc:mga03n38_83519_c1 3300050490 Bacteria 1506
271 nmdc:mga0yw44_389071_c1 3300050492 Bacteria 942
272 nmdc:mga0k408_189541_c1 3300050493 Bacteria 1227
273 nmdc:mga0k408_71609_c1 3300050493 Bacteria 2024
274 nmdc:mga04h51_26864_c1 3300050495 Bacteria 1784
275 nmdc:mga07m45_184729_c1 3300050496 Bacteria 1212
276 nmdc:mga0sz30_2127_c1 3300050516 Bacteria 6784
277 Ga0500644_0000109 3300053088 Bacteria 52262
278 Ga0500651_0263294 3300053093 Bacteria 999
279 Ga0500554_001178 3300053102 Bacteria 5069
280 Ga0500555_059453 3300053103 Bacteria 1031
281 Ga0500556_0000822 3300053104 Bacteria 17940
282 Ga0500597_239338 3300053120 Bacteria 747
283 Ga0500608_000429 3300053122 Bacteria 15955
284 Ga0500614_066118 3300053123 Bacteria 982
285 Ga0500618_000022 3300053125 Bacteria 157907
286 Ga0500642_0071308 3300053130 Bacteria 1581
287 Ga0500658_0001171 3300053134 Bacteria 10680
288 Ga0500559_0000054 3300053136 Bacteria 90695
289 Ga0500559_0012850 3300053136 Bacteria 3553
290 Ga0500559_0036413 3300053136 Bacteria 2128
291 Ga0500564_000087 3300053138 Bacteria 23585
292 Ga0500577_0030531 3300053142 Bacteria 1878
293 Ga0500588_0047419 3300053146 Bacteria 1325
294 Ga0500604_0000229 3300053151 Bacteria 15983
295 Ga0500616_0016069 3300053153 Bacteria 4270
296 Ga0500616_0054150 3300053153 Bacteria 2103
297 Ga0500622_0005812 3300053156 Bacteria 7311
298 Ga0500622_0024099 3300053156 Bacteria 3220
299 Ga0500627_0053138 3300053158 Bacteria 1769
300 Ga0500634_0000001 3300053161 Bacteria 258285
301 Ga0500645_008468 3300053730 Bacteria 3511
302 Ga0500645_124909 3300053730 Bacteria 716
303 Ga0500609_000056 3300053731 Bacteria 14815
304 Ga0501084_0128963 3300054114 Bacteria 2129
305 Ga0501082_1004859 3300060353 Bacteria 729
306 2585147982 2582581279 Bacteria 4980720
307 2585150801 2582581280 Bacteria 5994497
308 2585195773 2582581293 Bacteria 5907401
309 2587919771 2585428106 Bacteria 5179711
310 2643780622 2643221552 Bacteria 5708754
311 2643912650 2643221580 Bacteria 3816678
312 2643929394 2643221584 Bacteria 5511711
313 2643966155 2643221591 Bacteria 4397626
314 2644165392 2643221629 Bacteria 5850260
315 2644223604 2643221640 Bacteria 5258820
316 2644236308 2643221642 Bacteria 5357871
317 2644348385 2643221662 Bacteria 5851492
318 2644413342 2643221674 Bacteria 3919126
319 2644508177 2643221691 Bacteria 5093099
320 2819538652 2818991435 Bacteria 5433759
321 2819646814 2818991454 Bacteria 5563326
322 2857508662 2857504554 Bacteria 5369913
323 2928531911 2928531327 Bacteria 5101314
324 Ga0500559_0010476
325 JGI25165J46597_1005238
326 JGI25153J46596_10006258
327 JGI25153J46596_10075447
328 rootH2_10006208
329 rootH2_10092011
330 rootL2_10061176
331 rootL2_10061177
332 rootH1_10079308
333 Ga0055537_1001608
334 Ga0055524_1002102
335 Ga0055524_1052966
336 Ga0055536_1000614
337 Ga0055536_1005655
338 Ga0055528_1008596
339 Ga0055530_10001919
340 Ga0055530_10003968
341 Ga0055530_10018010
342 Ga0055531_10001676
343 Ga0055531_10006391
344 Ga0055531_10007324
345 Ga0065165_1000192
346 Ga0065165_1007162
347 Ga0065704_10197425
348 Ga0070658_10004891
349 Ga0070661_100017991
350 Ga0070661_100018694
351 Ga0070661_100253110
352 Ga0070659_100098224
353 Ga0070667_100607470
354 Ga0070663_100530592
355 Ga0070681_10960386
356 Ga0070679_100391393
357 Ga0068853_100037867
358 Ga0068855_100047692
359 Ga0068855_100111216
360 Ga0068855_100377130
361 Ga0068855_100613944
362 Ga0068855_101622487
363 Ga0068857_100267304
364 Ga0068854_100043625
365 Ga0068856_100033684
366 Ga0068852_100008082
367 Ga0068852_100030195
368 Ga0068852_100048337
369 Ga0068852_100354649
370 Ga0075365_10146677
371 Ga0075368_10022186
372 Ga0075364_10764036
373 Ga0075367_10068208
374 Ga0075369_10008658
375 Ga0075366_10175924
376 Ga0075366_10184887
377 Ga0075370_10088260
378 Ga0105240_10121721
379 Ga0105238_10141185
380 Ga0105239_10078209
381 Ga0157373_10244748
382 Ga0157373_10304935
383 Ga0157371_10369488
384 Ga0157370_10023865
385 Ga0157370_10278980
386 Ga0157370_10326115
387 Ga0157370_11368775
388 Ga0157369_10028825
389 Ga0157369_10035813
390 Ga0157372_10041130
391 Ga0157372_10282113
392 Ga0163163_10185735
393 Ga0213872_10001373
394 Ga0213872_10002297
395 Ga0213872_10004701
396 Ga0213872_10013992
397 Ga0213872_10064290
398 Ga0207427_104099
399 Ga0209233_1000866
400 Ga0209565_1000266
401 Ga0209673_1001114
402 Ga0209673_1026040
403 Ga0209675_1002890
404 Ga0209676_1000295
405 Ga0209676_1000392
406 Ga0209564_1001656
407 Ga0209564_1023167
408 Ga0209758_1000240
409 Ga0209758_1000785
410 Ga0209758_1001874
411 Ga0209758_1004340
412 Ga0209050_1000029
413 Ga0209050_1000362
414 Ga0209050_1000411
415 Ga0209256_1001074
416 Ga0209256_1013836
417 Ga0209256_1032434
418 Ga0207426_1070081
419 Ga0209051_1002593
420 Ga0209257_1000066
421 Ga0209257_1000493
422 Ga0209257_1000513
423 Ga0209257_1008646
424 Ga0207705_10095716
425 Ga0207707_11038449
426 Ga0207695_10158821
427 Ga0207649_10027924
428 Ga0207649_10070658
429 Ga0207649_10180198
430 Ga0207652_10305104
431 Ga0207694_10081394
432 Ga0207690_10066554
433 Ga0207667_10066687
434 Ga0207667_10353335
435 Ga0207640_10015333
436 Ga0207658_10034957
437 Ga0207639_10049040
438 Ga0207678_11173335
439 Ga0207678_11726269
440 Ga0207702_10019166
441 Ga0207702_10189882
442 Ga0207674_10232343
443 Ga0207698_10019850
444 Ga0207698_10091308
445 Ga0209813_10012732
446 Ga0265319_1029313
447 Ga0265334_10207786
448 Ga0265318_10011750
449 Ga0265324_10003311
450 Ga0265328_10014516
451 Ga0265320_10024438
452 Ga0265320_10047535
453 Ga0265329_10087352
454 Ga0265331_10000403
455 Ga0265327_10018081
456 Ga0307513_10067004
457 Ga0307513_10526100
458 Ga0265313_10015184
459 Ga0265313_10122428
460 Ga0316575_10227237
461 Ga0265314_10000870
462 Ga0265314_10028120
463 Ga0265314_10220225
464 Ga0307516_10035764
465 Ga0307516_10437429
466 Ga0307413_10583785
467 Ga0307414_10129111
468 Ga0307414_11158454
469 Ga0307510_10055483
470 Ga0307510_10236677
471 Ga0307510_10423629
472 Ga0373927_0000326
473 Ga0316582_0019614
474 Ga0373925_0016809
475 Ga0395899_0091396
476 Ga0395899_0098107
477 Ga0395900_0053641
478 Ga0395900_0108044
479 Ga0395900_0202964
480 Ga0395898_0076795
481 Ga0395898_0108806
482 Ga0395898_0224095
483 Ga0395905_0079347
484 Ga0436360_0812873
485 Ga0436361_0021071
486 Ga0436361_0196141
487 Ga0436361_0741013
488 Ga0436361_0813166
489 Ga0439466_0152461
490 Ga0439465_0007477
491 Ga0451853_4060034
492 Ga0439459_0077135
493 Ga0451577_0200729
494 Ga0453683_0001398
495 Ga0453683_0013421
496 Ga0453683_0056760
497 Ga0453684_0110409
498 Ga0451576_0000301
499 Ga0451576_0002693
500 Ga0466967_1334461
501 Ga0495638_0001874
502 Ga0495638_0002897
503 Ga0495650_0000045
504 Ga0495650_0024527
505 Ga0495606_0093862
506 Ga0495610_0001073
507 Ga0495610_0099910
508 Ga0495616_0000115
509 Ga0495620_0098663
510 Ga0495632_0064741
511 Ga0495637_0053946
512 Ga0495643_0171387
513 Ga0495654_0011719
514 Ga0495654_0061268
515 Ga0495597_0135777
516 Ga0495668_0004147
517 Ga0495668_0022967
518 Ga0495668_0165487
519 Ga0495625_0005057
520 Ga0495625_0093217
521 Ga0495625_0153177
522 Ga0495625_0256666
523 Ga0495670_0051937
524 Ga0495670_0163609
525 Ga0495660_0025652
526 Ga0495660_0089030
527 Ga0495672_0056563
528 Ga0495679_006631
529 Ga0495673_0000333
530 Ga0495673_0023031
531 Ga0495681_0060012
532 Ga0495686_0119523
533 Ga0496110_0106326
534 Ga0496114_0879896
535 Ga0496115_0000595
536 Ga0496115_0701659
537 Ga0496121_0119986
538 Ga0496121_0161669
539 Ga0496124_0066433
540 Ga0496125_0000115
541 Ga0496125_0108270
542 Ga0496125_0268550
543 Ga0496126_0000962
544 Ga0496126_0008225
545 Ga0501031_0032881
546 Ga0501032_0153448
547 Ga0501033_0115987
548 Ga0501033_0297629
549 Ga0501034_0002063
550 Ga0501034_0010291
551 Ga0501034_0025500
552 Ga0501034_0038021
553 Ga0501034_0142054
554 Ga0501034_0322154
555 Ga0501034_0330120
556 Ga0501034_0375330
557 Ga0501036_0120215
558 Ga0501036_0237894
559 Ga0501036_0312707
560 Ga0501036_0646290
561 Ga0501037_0453503
562 Ga0501038_0157713
563 Ga0501038_0337485
564 Ga0501038_0341727
565 Ga0501039_0108821
566 Ga0501039_0305564
567 Ga0501043_0061840
568 Ga0501043_0502811
569 Ga0501043_0954934
570 Ga0501043_1085540
571 Ga0501046_0492503
572 Ga0501046_0654818
573 Ga0501047_0071070
574 Ga0501047_0141999
575 Ga0501047_0154866
576 Ga0501068_0146028
577 Ga0501069_0171825
578 Ga0501070_0065947
579 Ga0501070_0110997
580 Ga0501070_0303053
581 Ga0501080_0791185
582 Ga0501035_0029874
583 Ga0501035_0094891
584 Ga0501035_0135058
585 Ga0501035_0226540
586 Ga0501044_0040421
587 Ga0501044_0089135
588 Ga0501044_0115153
589 Ga0501044_0121403
590 Ga0501044_0211669
591 Ga0501044_0242090
592 Ga0501044_0652431
593 nmdc:mga03n38_83519_c1
594 nmdc:mga0yw44_389071_c1
595 nmdc:mga0k408_189541_c1
596 nmdc:mga0k408_71609_c1
597 nmdc:mga04h51_26864_c1
598 nmdc:mga07m45_184729_c1
599 nmdc:mga0sz30_2127_c1
600 Ga0500644_0000109
601 Ga0500651_0263294
602 Ga0500554_001178
603 Ga0500555_059453
604 Ga0500556_0000822
605 Ga0500597_239338
606 Ga0500608_000429
607 Ga0500614_066118
608 Ga0500618_000022
609 Ga0500642_0071308
610 Ga0500658_0001171
611 Ga0500559_0000054
612 Ga0500559_0012850
613 Ga0500559_0036413
614 Ga0500564_000087
615 Ga0500577_0030531
616 Ga0500588_0047419
617 Ga0500604_0000229
618 Ga0500616_0016069
619 Ga0500616_0054150
620 Ga0500622_0005812
621 Ga0500622_0024099
622 Ga0500627_0053138
623 Ga0500634_0000001
624 Ga0500645_008468
625 Ga0500645_124909
626 Ga0500609_000056
627 Ga0501084_0128963
628 Ga0501082_1004859
629 2585147982
630 2585150801
631 2585195773
632 2587919771
633 2643780622
634 2643912650
635 2643929394
636 2643966155
637 2644165392
638 2644223604
639 2644236308
640 2644348385
641 2644413342
642 2644508177
643 2819538652
644 2819646814
645 2857508662
646 2928531911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

28

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qdl-assembly1.cif.gz_A crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.9049 7 150
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.9013 7 148
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8958 7 150
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.8846 7 150
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8807 8 146
ID Description Score Start End Superfamily
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8783 27 98 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8196 27 95 2.40.50.180
2ch4A02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8134 7 142 2.30.30.40
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8087 28 98 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8085 27 95 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A0F5PXC5-F1-model_v4 Purine-binding chemotaxis protein CheW 0.9908 7 154 GO:0005829
GO:0006935
GO:0007165
AF-W9HA82-F1-model_v4 Chemotaxis protein CheW 0.986 12 146 GO:0005829
GO:0006935
GO:0007165
AF-A0A143ZLD9-F1-model_v4 Purine-binding chemotaxis protein CheW 0.982 4 148 GO:0005829
GO:0006935
GO:0007165
AF-A0A1F8IT56-F1-model_v4 deleted 0.9811 7 117
AF-A0A7V8IU17-F1-model_v4 deleted 0.9792 7 151

Map