F407086

General Info

Members Datasets Scaffolds Average Seq Length
323 204 646 181

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_1132187|Ga0496114_1132187_32_604
Length 190
Sequence VTIRTAASRYARALFDVVVKESDGSRAADVTARLQQVEAELSSFGALFKANPELERVLLNPAVPAPRKRAAVAEIVGRMSVGGPLGKILTLLAERDRLIILPELVAAFQRRVLDLMNVVRAEVVTAADLPPGRAAQIERELGAATGRQVLLSTRVDPALIGGVVARIGSTVYDGSVVRQLQRIRERLEEA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.93
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 17.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_1132187 3300048917 Unclassified 668
2 Ga0065704_10100187 3300005289 Bacteria 2283
3 Ga0065712_10174587 3300005290 Unclassified 1225
4 Ga0065715_10247087 3300005293 Bacteria 1180
5 Ga0070677_10218789 3300005333 Unclassified 929
6 Ga0068869_100442547 3300005334 Bacteria 1076
7 Ga0070689_100021331 3300005340 Bacteria 4821
8 Ga0070687_100026026 3300005343 Bacteria 2813
9 Ga0070668_100248868 3300005347 Bacteria 1475
10 Ga0070675_100126352 3300005354 Bacteria 2176
11 Ga0070673_100769154 3300005364 Bacteria 888
12 Ga0070688_100024489 3300005365 Bacteria 3563
13 Ga0070667_100360409 3300005367 Bacteria 1318
14 Ga0070703_10000905 3300005406 Bacteria 9452
15 Ga0070713_100236301 3300005436 Bacteria 1663
16 Ga0070711_100000024 3300005439 Bacteria 117125
17 Ga0070694_100107296 3300005444 Unclassified 1984
18 Ga0070694_100261785 3300005444 Unclassified 1312
19 Ga0070708_100082721 3300005445 Bacteria 2909
20 Ga0070663_100110564 3300005455 Bacteria 2064
21 Ga0070678_100095728 3300005456 Unclassified 2289
22 Ga0070681_10592089 3300005458 Unclassified 1023
23 Ga0070685_10005356 3300005466 Bacteria 6502
24 Ga0070685_10322440 3300005466 Bacteria 1048
25 Ga0070706_100000647 3300005467 Bacteria 39813
26 Ga0070707_100125864 3300005468 Bacteria 2490
27 Ga0070698_100469191 3300005471 Bacteria 1195
28 Ga0070699_100154259 3300005518 Bacteria 2032
29 Ga0070679_100227361 3300005530 Bacteria 1826
30 Ga0070684_100441867 3300005535 Bacteria 1202
31 Ga0070697_100209388 3300005536 Unclassified 1659
32 Ga0068853_100018852 3300005539 Bacteria 5714
33 Ga0070696_100003688 3300005546 Bacteria 10218
34 Ga0070696_100004516 3300005546 Bacteria 9287
35 Ga0070693_100000179 3300005547 Bacteria 29123
36 Ga0070665_100139699 3300005548 Bacteria 2426
37 Ga0068855_100030994 3300005563 Bacteria 6391
38 Ga0068855_101305211 3300005563 Bacteria 751
39 Ga0070664_100005527 3300005564 Bacteria 10144
40 Ga0070664_100008720 3300005564 Bacteria 8209
41 Ga0070664_100624887 3300005564 Unclassified 1000
42 Ga0068857_100416181 3300005577 Bacteria 1252
43 Ga0068852_100579083 3300005616 Bacteria 1125
44 Ga0068859_100057522 3300005617 Bacteria 3917
45 Ga0068859_100136342 3300005617 Bacteria 2527
46 Ga0068859_100688090 3300005617 Bacteria 1114
47 Ga0068859_101030256 3300005617 Bacteria 904
48 Ga0068864_100072584 3300005618 Bacteria 3000
49 Ga0068864_100175726 3300005618 Unclassified 1955
50 Ga0068864_101302876 3300005618 Unclassified 727
51 Ga0068861_100094062 3300005719 Bacteria 2371
52 Ga0068863_100023208 3300005841 Bacteria 5929
53 Ga0068863_100207834 3300005841 Unclassified 1884
54 Ga0068863_100314487 3300005841 Bacteria 1520
55 Ga0068858_100069236 3300005842 Bacteria 3271
56 Ga0068862_100167999 3300005844 Bacteria 1962
57 Ga0068862_100191837 3300005844 Unclassified 1839
58 Ga0068862_100194579 3300005844 Unclassified 1826
59 Ga0081455_10109753 3300005937 Bacteria 2195
60 Ga0081455_10268668 3300005937 Bacteria 1238
61 Ga0070715_10262464 3300006163 Bacteria 908
62 Ga0097621_100186378 3300006237 Bacteria 1795
63 Ga0097621_100586462 3300006237 Bacteria 1018
64 Ga0097621_101397843 3300006237 Bacteria 662
65 Ga0068871_100408280 3300006358 Bacteria 1211
66 Ga0068871_100468809 3300006358 Bacteria 1131
67 Ga0075430_100378725 3300006846 Unclassified 1168
68 Ga0075433_10361942 3300006852 Unclassified 1281
69 Ga0075436_100059892 3300006914 Bacteria 2630
70 Ga0075436_100183216 3300006914 Bacteria 1480
71 Ga0097620_100057523 3300006931 Bacteria 3917
72 Ga0097620_100136350 3300006931 Bacteria 2527
73 Ga0097620_100688041 3300006931 Bacteria 1114
74 Ga0097620_101030124 3300006931 Bacteria 904
75 Ga0105251_10077158 3300009011 Bacteria 1545
76 Ga0105240_10138428 3300009093 Bacteria 2913
77 Ga0105240_10329537 3300009093 Bacteria 1738
78 Ga0105247_10031561 3300009101 Bacteria 3215
79 Ga0114129_10682371 3300009147 Bacteria 1322
80 Ga0114129_11026435 3300009147 Bacteria 1037
81 Ga0105241_10032392 3300009174 Unclassified 3918
82 Ga0105241_10193825 3300009174 Bacteria 1693
83 Ga0105241_10492258 3300009174 Unclassified 1092
84 Ga0105241_10568651 3300009174 Bacteria 1020
85 Ga0105242_10443738 3300009176 Bacteria 1221
86 Ga0105242_11328949 3300009176 Unclassified 744
87 Ga0105248_10092853 3300009177 Bacteria 3399
88 Ga0105248_10126567 3300009177 Bacteria 2882
89 Ga0105248_10213328 3300009177 Bacteria 2175
90 Ga0105248_10920190 3300009177 Bacteria 987
91 Ga0105237_10004874 3300009545 Bacteria 15372
92 Ga0105237_10417011 3300009545 Bacteria 1348
93 Ga0105237_10938952 3300009545 Bacteria 872
94 Ga0105249_10014926 3300009553 Bacteria 6871
95 Ga0105249_10503404 3300009553 Bacteria 1257
96 Ga0105239_10066295 3300010375 Bacteria 3966
97 Ga0105239_10252217 3300010375 Bacteria 1982
98 Ga0105239_10332132 3300010375 Unclassified 1715
99 Ga0105239_11456394 3300010375 Bacteria 791
100 Ga0157373_10050097 3300013100 Bacteria 2975
101 Ga0157373_10219350 3300013100 Bacteria 1341
102 Ga0157371_10988798 3300013102 Unclassified 641
103 Ga0157370_10160010 3300013104 Bacteria 2095
104 Ga0157369_10461767 3300013105 Bacteria 1315
105 Ga0157374_10341316 3300013296 Bacteria 1487
106 Ga0157378_10313512 3300013297 Bacteria 1522
107 Ga0157378_10449147 3300013297 Bacteria 1279
108 Ga0163162_10162775 3300013306 Unclassified 2353
109 Ga0163162_10304017 3300013306 Unclassified 1727
110 Ga0163162_10632413 3300013306 Bacteria 1195
111 Ga0163162_10993405 3300013306 Unclassified 949
112 Ga0157372_10088210 3300013307 Unclassified 3522
113 Ga0157372_10292688 3300013307 Bacteria 1894
114 Ga0157372_10340979 3300013307 Bacteria 1745
115 Ga0157375_10134361 3300013308 Bacteria 2596
116 Ga0157375_10498106 3300013308 Bacteria 1382
117 Ga0163163_10169251 3300014325 Unclassified 2231
118 Ga0163163_10288856 3300014325 Bacteria 1692
119 Ga0163163_10500145 3300014325 Bacteria 1277
120 Ga0163163_10781432 3300014325 Unclassified 1018
121 Ga0163163_11545867 3300014325 Unclassified 725
122 Ga0157376_10006398 3300014969 Bacteria 8322
123 Ga0157376_10074795 3300014969 Bacteria 2889
124 Ga0157376_10181032 3300014969 Bacteria 1926
125 Ga0157376_10212757 3300014969 Bacteria 1786
126 Ga0157376_10254536 3300014969 Bacteria 1642
127 Ga0157376_10615045 3300014969 Bacteria 1083
128 Ga0163161_10100768 3300017792 Bacteria 2150
129 Ga0207653_10000022 3300025885 Bacteria 126662
130 Ga0207685_10140905 3300025905 Bacteria 1081
131 Ga0207645_10757766 3300025907 Bacteria 660
132 Ga0207684_10000049 3300025910 Bacteria 240008
133 Ga0207654_10312822 3300025911 Unclassified 1071
134 Ga0207707_10224505 3300025912 Bacteria 1635
135 Ga0207695_10217454 3300025913 Bacteria 1819
136 Ga0207695_10325714 3300025913 Bacteria 1425
137 Ga0207671_10028503 3300025914 Bacteria 4172
138 Ga0207663_10000012 3300025916 Bacteria 167739
139 Ga0207662_10035806 3300025918 Bacteria 2900
140 Ga0207657_10076858 3300025919 Bacteria 2815
141 Ga0207694_10778594 3300025924 Unclassified 808
142 Ga0207650_10067169 3300025925 Bacteria 2690
143 Ga0207650_10206892 3300025925 Bacteria 1574
144 Ga0207659_10140668 3300025926 Bacteria 1873
145 Ga0207644_10038617 3300025931 Bacteria 3365
146 Ga0207690_10064128 3300025932 Bacteria 2507
147 Ga0207670_10031939 3300025936 Bacteria 3380
148 Ga0207670_10068857 3300025936 Bacteria 2440
149 Ga0207711_10082386 3300025941 Bacteria 2812
150 Ga0207711_10139607 3300025941 Unclassified 2179
151 Ga0207711_10439624 3300025941 Bacteria 1214
152 Ga0207689_10414048 3300025942 Bacteria 1124
153 Ga0207679_10119016 3300025945 Bacteria 2099
154 Ga0207679_10134730 3300025945 Bacteria 1987
155 Ga0207667_10074671 3300025949 Bacteria 3521
156 Ga0207667_10673947 3300025949 Bacteria 1038
157 Ga0207712_10073548 3300025961 Bacteria 2466
158 Ga0207712_10164947 3300025961 Bacteria 1726
159 Ga0207658_11076785 3300025986 Bacteria 734
160 Ga0207703_10506240 3300026035 Unclassified 1134
161 Ga0207639_10021083 3300026041 Unclassified 4675
162 Ga0207678_10066354 3300026067 Bacteria 3099
163 Ga0207708_10713312 3300026075 Unclassified 858
164 Ga0207641_11113909 3300026088 Unclassified 788
165 Ga0207641_11391491 3300026088 Unclassified 703
166 Ga0207641_11443446 3300026088 Unclassified 689
167 Ga0207648_10286205 3300026089 Bacteria 1475
168 Ga0207676_10043310 3300026095 Bacteria 3465
169 Ga0207676_10810388 3300026095 Unclassified 914
170 Ga0207674_10124914 3300026116 Bacteria 2539
171 Ga0207675_100158025 3300026118 Bacteria 2161
172 Ga0207683_10197652 3300026121 Unclassified 1827
173 Ga0268266_10352266 3300028379 Bacteria 1384
174 Ga0268265_10146214 3300028380 Bacteria 1986
175 Ga0268265_10176862 3300028380 Bacteria 1830
176 Ga0268264_10732818 3300028381 Bacteria 984
177 Ga0265337_1028973 3300028556 Bacteria 1658
178 Ga0265323_10014069 3300028653 Bacteria 3178
179 Ga0265323_10014176 3300028653 Bacteria 3164
180 Ga0265322_10069409 3300028654 Bacteria 999
181 Ga0307515_10392221 3300028794 Bacteria 1017
182 Ga0265338_10041034 3300028800 Bacteria 4335
183 Ga0265330_10002037 3300031235 Bacteria 11212
184 Ga0265330_10022016 3300031235 Bacteria 2903
185 Ga0265330_10044359 3300031235 Bacteria 1963
186 Ga0265332_10088229 3300031238 Bacteria 1313
187 Ga0265320_10041827 3300031240 Bacteria 2277
188 Ga0265325_10019351 3300031241 Bacteria 3764
189 Ga0265329_10000712 3300031242 Bacteria 16884
190 Ga0265329_10018211 3300031242 Bacteria 2405
191 Ga0265340_10000094 3300031247 Bacteria 41873
192 Ga0265340_10112955 3300031247 Bacteria 1254
193 Ga0265339_10188721 3300031249 Bacteria 1023
194 Ga0265331_10007977 3300031250 Bacteria 6060
195 Ga0265331_10028516 3300031250 Bacteria 2791
196 Ga0265316_10005058 3300031344 Bacteria 12939
197 Ga0265316_10009384 3300031344 Bacteria 9007
198 Ga0265316_10016331 3300031344 Bacteria 6442
199 Ga0265316_10025801 3300031344 Bacteria 4898
200 Ga0265316_10031474 3300031344 Bacteria 4337
201 Ga0265316_10087943 3300031344 Bacteria 2373
202 Ga0307408_100368015 3300031548 Bacteria 1225
203 Ga0265313_10017662 3300031595 Bacteria 4039
204 Ga0265314_10000086 3300031711 Bacteria 139471
205 Ga0265314_10012236 3300031711 Bacteria 7020
206 Ga0265314_10024413 3300031711 Bacteria 4584
207 Ga0265342_10000253 3300031712 Bacteria 60170
208 Ga0265342_10002249 3300031712 Bacteria 16880
209 Ga0316576_10218287 3300031727 Bacteria 1435
210 Ga0316577_10299649 3300031733 Bacteria 911
211 Ga0307413_10420861 3300031824 Bacteria 1052
212 Ga0307410_10303347 3300031852 Unclassified 1261
213 Ga0307410_11287116 3300031852 Bacteria 639
214 Ga0307406_10006285 3300031901 Bacteria 6547
215 Ga0307406_10238344 3300031901 Bacteria 1363
216 Ga0307406_11123161 3300031901 Bacteria 679
217 Ga0307407_10121610 3300031903 Bacteria 1656
218 Ga0307412_10626482 3300031911 Unclassified 914
219 Ga0307409_100052728 3300031995 Bacteria 3121
220 Ga0307416_100015812 3300032002 Bacteria 5223
221 Ga0307416_100404779 3300032002 Bacteria 1403
222 Ga0307415_100062071 3300032126 Bacteria 2590
223 Ga0373950_0000005 3300034818 Bacteria 404272
224 Ga0373923_0175932 3300035111 Bacteria 982
225 Ga0373953_0184062 3300035117 Bacteria 902
226 Ga0373957_0062136 3300035120 Bacteria 1449
227 Ga0373943_0837697 3300035170 Bacteria 548
228 Ga0316574_0061545 3300035398 Bacteria 2357
229 Ga0373935_0071889 3300035692 Bacteria 2233
230 Ga0373927_0075611 3300035695 Bacteria 2181
231 Ga0373937_0107430 3300036401 Bacteria 2595
232 Ga0316584_0057441 3300036712 Bacteria 2913
233 Ga0373925_0149880 3300037068 Unclassified 1831
234 Ga0373925_0415190 3300037068 Bacteria 1099
235 Ga0436361_1022758 3300039447 Unclassified 661
236 Ga0451837_1223287 3300041494 Bacteria 2563
237 Ga0451843_0505945 3300041509 Bacteria 1357
238 Ga0439441_104152 3300042001 Unclassified 639
239 Ga0439435_0013132 3300042436 Bacteria 2020
240 Ga0451577_0102875 3300042876 Bacteria 2552
241 Ga0451577_0189807 3300042876 Bacteria 1854
242 Ga0453683_0653085 3300044673 Bacteria 688
243 Ga0453684_0007616 3300044712 Bacteria 19834
244 Ga0453684_0069548 3300044712 Bacteria 4464
245 Ga0453684_0209158 3300044712 Bacteria 2269
246 Ga0466957_0398281 3300044842 Bacteria 941
247 Ga0451576_0088380 3300045051 Bacteria 3223
248 Ga0451576_1111293 3300045051 Unclassified 827
249 Ga0495629_0423936 3300046459 Unclassified 903
250 Ga0495651_0137169 3300046462 Bacteria 1778
251 Ga0495653_0154021 3300046463 Bacteria 1603
252 Ga0495580_0027849 3300046472 Bacteria 4110
253 Ga0495580_0246293 3300046472 Unclassified 1224
254 Ga0495662_0297589 3300046476 Bacteria 794
255 Ga0495664_0169827 3300046477 Bacteria 1323
256 Ga0495594_0535921 3300046499 Bacteria 664
257 Ga0495608_0126442 3300046511 Bacteria 1637
258 Ga0495628_0077744 3300046516 Bacteria 2581
259 Ga0495628_0084876 3300046516 Bacteria 2457
260 Ga0495628_0403467 3300046516 Bacteria 998
261 Ga0495630_0060365 3300046517 Bacteria 2846
262 Ga0495652_0109729 3300046529 Bacteria 2221
263 Ga0495652_0189595 3300046529 Bacteria 1570
264 Ga0495640_0030248 3300046533 Bacteria 3879
265 Ga0495598_0011460 3300046537 Bacteria 2151
266 Ga0495645_0026689 3300046543 Bacteria 4193
267 Ga0495645_0543354 3300046543 Bacteria 721
268 Ga0495645_0552981 3300046543 Unclassified 713
269 Ga0495667_0053124 3300046559 Bacteria 2669
270 Ga0495667_0056291 3300046559 Bacteria 2586
271 Ga0495667_0099162 3300046559 Bacteria 1886
272 Ga0495635_0121039 3300046663 Bacteria 1785
273 Ga0495635_0131766 3300046663 Bacteria 1704
274 Ga0495599_0134002 3300046678 Bacteria 1538
275 Ga0495599_0465567 3300046678 Bacteria 747
276 Ga0495623_0004572 3300046679 Bacteria 9093
277 Ga0495623_0022525 3300046679 Bacteria 4070
278 Ga0495623_0044013 3300046679 Bacteria 2838
279 Ga0495613_0177903 3300046689 Bacteria 1507
280 Ga0495613_0382027 3300046689 Bacteria 963
281 Ga0495600_0176775 3300046809 Bacteria 1376
282 Ga0495604_0014587 3300047317 Bacteria 6263
283 Ga0495604_0084744 3300047317 Bacteria 2366
284 Ga0495604_0272378 3300047317 Bacteria 1146
285 Ga0495604_0455598 3300047317 Unclassified 835
286 Ga0495604_0714733 3300047317 Bacteria 635
287 Ga0495674_0003992 3300047319 Bacteria 14305
288 Ga0495674_0012770 3300047319 Bacteria 7909
289 Ga0495674_0039384 3300047319 Bacteria 4237
290 Ga0495674_0176222 3300047319 Bacteria 1782
291 Ga0495674_0319493 3300047319 Unclassified 1265
292 Ga0495680_0147700 3300047322 Bacteria 1716
293 Ga0495675_0039278 3300047444 Bacteria 3014
294 Ga0495675_0055729 3300047444 Bacteria 2507
295 Ga0495675_0190239 3300047444 Bacteria 1253
296 Ga0495675_0523011 3300047444 Unclassified 679
297 Ga0495684_0013361 3300047471 Bacteria 6322
298 Ga0495684_0102932 3300047471 Bacteria 2158
299 Ga0495684_0774239 3300047471 Bacteria 629
300 Ga0495602_0017564 3300048088 Bacteria 7167
301 Ga0495602_0808996 3300048088 Unclassified 629
302 Ga0496110_0514529 3300048913 Bacteria 1089
303 Ga0496115_0115022 3300048918 Bacteria 2212
304 Ga0501067_0000013 3300049583 Bacteria 111318
305 Ga0501069_0018492 3300049585 Bacteria 3761
306 Ga0501072_0063979 3300049588 Bacteria 2901
307 Ga0501073_0068794 3300049589 Bacteria 2467
308 Ga0501074_0280994 3300049590 Bacteria 1183
309 Ga0501074_0396453 3300049590 Bacteria 979
310 Ga0501075_0850942 3300049591 Unclassified 694
311 Ga0501235_057109 3300049669 Bacteria 911
312 Ga0501080_0091925 3300049742 Bacteria 2818
313 Ga0501083_0047948 3300049744 Bacteria 2884
314 nmdc:mga09592_248957_c2 3300050508 Bacteria 677
315 nmdc:mga0qj67_210986_c1 3300050509 Bacteria 1577
316 nmdc:mga0n895_1373988_c1 3300050512 Unclassified 675
317 nmdc:mga08x19_71276_c1 3300050514 Unclassified 2266
318 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
319 nmdc:mga0a205_48739_c1 3300050515 Bacteria 4089
320 Ga0495601_0173244 3300053077 Bacteria 1411
321 Ga0500556_0088893 3300053104 Bacteria 1177
322 Ga0590075_026171 3300059424 Unclassified 1468
323 Ga0590077_099229 3300059426 Bacteria 680
324 Ga0496114_1132187
325 Ga0065704_10100187
326 Ga0065712_10174587
327 Ga0065715_10247087
328 Ga0070677_10218789
329 Ga0068869_100442547
330 Ga0070689_100021331
331 Ga0070687_100026026
332 Ga0070668_100248868
333 Ga0070675_100126352
334 Ga0070673_100769154
335 Ga0070688_100024489
336 Ga0070667_100360409
337 Ga0070703_10000905
338 Ga0070713_100236301
339 Ga0070711_100000024
340 Ga0070694_100107296
341 Ga0070694_100261785
342 Ga0070708_100082721
343 Ga0070663_100110564
344 Ga0070678_100095728
345 Ga0070681_10592089
346 Ga0070685_10005356
347 Ga0070685_10322440
348 Ga0070706_100000647
349 Ga0070707_100125864
350 Ga0070698_100469191
351 Ga0070699_100154259
352 Ga0070679_100227361
353 Ga0070684_100441867
354 Ga0070697_100209388
355 Ga0068853_100018852
356 Ga0070696_100003688
357 Ga0070696_100004516
358 Ga0070693_100000179
359 Ga0070665_100139699
360 Ga0068855_100030994
361 Ga0068855_101305211
362 Ga0070664_100005527
363 Ga0070664_100008720
364 Ga0070664_100624887
365 Ga0068857_100416181
366 Ga0068852_100579083
367 Ga0068859_100057522
368 Ga0068859_100136342
369 Ga0068859_100688090
370 Ga0068859_101030256
371 Ga0068864_100072584
372 Ga0068864_100175726
373 Ga0068864_101302876
374 Ga0068861_100094062
375 Ga0068863_100023208
376 Ga0068863_100207834
377 Ga0068863_100314487
378 Ga0068858_100069236
379 Ga0068862_100167999
380 Ga0068862_100191837
381 Ga0068862_100194579
382 Ga0081455_10109753
383 Ga0081455_10268668
384 Ga0070715_10262464
385 Ga0097621_100186378
386 Ga0097621_100586462
387 Ga0097621_101397843
388 Ga0068871_100408280
389 Ga0068871_100468809
390 Ga0075430_100378725
391 Ga0075433_10361942
392 Ga0075436_100059892
393 Ga0075436_100183216
394 Ga0097620_100057523
395 Ga0097620_100136350
396 Ga0097620_100688041
397 Ga0097620_101030124
398 Ga0105251_10077158
399 Ga0105240_10138428
400 Ga0105240_10329537
401 Ga0105247_10031561
402 Ga0114129_10682371
403 Ga0114129_11026435
404 Ga0105241_10032392
405 Ga0105241_10193825
406 Ga0105241_10492258
407 Ga0105241_10568651
408 Ga0105242_10443738
409 Ga0105242_11328949
410 Ga0105248_10092853
411 Ga0105248_10126567
412 Ga0105248_10213328
413 Ga0105248_10920190
414 Ga0105237_10004874
415 Ga0105237_10417011
416 Ga0105237_10938952
417 Ga0105249_10014926
418 Ga0105249_10503404
419 Ga0105239_10066295
420 Ga0105239_10252217
421 Ga0105239_10332132
422 Ga0105239_11456394
423 Ga0157373_10050097
424 Ga0157373_10219350
425 Ga0157371_10988798
426 Ga0157370_10160010
427 Ga0157369_10461767
428 Ga0157374_10341316
429 Ga0157378_10313512
430 Ga0157378_10449147
431 Ga0163162_10162775
432 Ga0163162_10304017
433 Ga0163162_10632413
434 Ga0163162_10993405
435 Ga0157372_10088210
436 Ga0157372_10292688
437 Ga0157372_10340979
438 Ga0157375_10134361
439 Ga0157375_10498106
440 Ga0163163_10169251
441 Ga0163163_10288856
442 Ga0163163_10500145
443 Ga0163163_10781432
444 Ga0163163_11545867
445 Ga0157376_10006398
446 Ga0157376_10074795
447 Ga0157376_10181032
448 Ga0157376_10212757
449 Ga0157376_10254536
450 Ga0157376_10615045
451 Ga0163161_10100768
452 Ga0207653_10000022
453 Ga0207685_10140905
454 Ga0207645_10757766
455 Ga0207684_10000049
456 Ga0207654_10312822
457 Ga0207707_10224505
458 Ga0207695_10217454
459 Ga0207695_10325714
460 Ga0207671_10028503
461 Ga0207663_10000012
462 Ga0207662_10035806
463 Ga0207657_10076858
464 Ga0207694_10778594
465 Ga0207650_10067169
466 Ga0207650_10206892
467 Ga0207659_10140668
468 Ga0207644_10038617
469 Ga0207690_10064128
470 Ga0207670_10031939
471 Ga0207670_10068857
472 Ga0207711_10082386
473 Ga0207711_10139607
474 Ga0207711_10439624
475 Ga0207689_10414048
476 Ga0207679_10119016
477 Ga0207679_10134730
478 Ga0207667_10074671
479 Ga0207667_10673947
480 Ga0207712_10073548
481 Ga0207712_10164947
482 Ga0207658_11076785
483 Ga0207703_10506240
484 Ga0207639_10021083
485 Ga0207678_10066354
486 Ga0207708_10713312
487 Ga0207641_11113909
488 Ga0207641_11391491
489 Ga0207641_11443446
490 Ga0207648_10286205
491 Ga0207676_10043310
492 Ga0207676_10810388
493 Ga0207674_10124914
494 Ga0207675_100158025
495 Ga0207683_10197652
496 Ga0268266_10352266
497 Ga0268265_10146214
498 Ga0268265_10176862
499 Ga0268264_10732818
500 Ga0265337_1028973
501 Ga0265323_10014069
502 Ga0265323_10014176
503 Ga0265322_10069409
504 Ga0307515_10392221
505 Ga0265338_10041034
506 Ga0265330_10002037
507 Ga0265330_10022016
508 Ga0265330_10044359
509 Ga0265332_10088229
510 Ga0265320_10041827
511 Ga0265325_10019351
512 Ga0265329_10000712
513 Ga0265329_10018211
514 Ga0265340_10000094
515 Ga0265340_10112955
516 Ga0265339_10188721
517 Ga0265331_10007977
518 Ga0265331_10028516
519 Ga0265316_10005058
520 Ga0265316_10009384
521 Ga0265316_10016331
522 Ga0265316_10025801
523 Ga0265316_10031474
524 Ga0265316_10087943
525 Ga0307408_100368015
526 Ga0265313_10017662
527 Ga0265314_10000086
528 Ga0265314_10012236
529 Ga0265314_10024413
530 Ga0265342_10000253
531 Ga0265342_10002249
532 Ga0316576_10218287
533 Ga0316577_10299649
534 Ga0307413_10420861
535 Ga0307410_10303347
536 Ga0307410_11287116
537 Ga0307406_10006285
538 Ga0307406_10238344
539 Ga0307406_11123161
540 Ga0307407_10121610
541 Ga0307412_10626482
542 Ga0307409_100052728
543 Ga0307416_100015812
544 Ga0307416_100404779
545 Ga0307415_100062071
546 Ga0373950_0000005
547 Ga0373923_0175932
548 Ga0373953_0184062
549 Ga0373957_0062136
550 Ga0373943_0837697
551 Ga0316574_0061545
552 Ga0373935_0071889
553 Ga0373927_0075611
554 Ga0373937_0107430
555 Ga0316584_0057441
556 Ga0373925_0149880
557 Ga0373925_0415190
558 Ga0436361_1022758
559 Ga0451837_1223287
560 Ga0451843_0505945
561 Ga0439441_104152
562 Ga0439435_0013132
563 Ga0451577_0102875
564 Ga0451577_0189807
565 Ga0453683_0653085
566 Ga0453684_0007616
567 Ga0453684_0069548
568 Ga0453684_0209158
569 Ga0466957_0398281
570 Ga0451576_0088380
571 Ga0451576_1111293
572 Ga0495629_0423936
573 Ga0495651_0137169
574 Ga0495653_0154021
575 Ga0495580_0027849
576 Ga0495580_0246293
577 Ga0495662_0297589
578 Ga0495664_0169827
579 Ga0495594_0535921
580 Ga0495608_0126442
581 Ga0495628_0077744
582 Ga0495628_0084876
583 Ga0495628_0403467
584 Ga0495630_0060365
585 Ga0495652_0109729
586 Ga0495652_0189595
587 Ga0495640_0030248
588 Ga0495598_0011460
589 Ga0495645_0026689
590 Ga0495645_0543354
591 Ga0495645_0552981
592 Ga0495667_0053124
593 Ga0495667_0056291
594 Ga0495667_0099162
595 Ga0495635_0121039
596 Ga0495635_0131766
597 Ga0495599_0134002
598 Ga0495599_0465567
599 Ga0495623_0004572
600 Ga0495623_0022525
601 Ga0495623_0044013
602 Ga0495613_0177903
603 Ga0495613_0382027
604 Ga0495600_0176775
605 Ga0495604_0014587
606 Ga0495604_0084744
607 Ga0495604_0272378
608 Ga0495604_0455598
609 Ga0495604_0714733
610 Ga0495674_0003992
611 Ga0495674_0012770
612 Ga0495674_0039384
613 Ga0495674_0176222
614 Ga0495674_0319493
615 Ga0495680_0147700
616 Ga0495675_0039278
617 Ga0495675_0055729
618 Ga0495675_0190239
619 Ga0495675_0523011
620 Ga0495684_0013361
621 Ga0495684_0102932
622 Ga0495684_0774239
623 Ga0495602_0017564
624 Ga0495602_0808996
625 Ga0496110_0514529
626 Ga0496115_0115022
627 Ga0501067_0000013
628 Ga0501069_0018492
629 Ga0501072_0063979
630 Ga0501073_0068794
631 Ga0501074_0280994
632 Ga0501074_0396453
633 Ga0501075_0850942
634 Ga0501235_057109
635 Ga0501080_0091925
636 Ga0501083_0047948
637 nmdc:mga09592_248957_c2
638 nmdc:mga0qj67_210986_c1
639 nmdc:mga0n895_1373988_c1
640 nmdc:mga08x19_71276_c1
641 nmdc:mga08x19_7_c1
642 nmdc:mga0a205_48739_c1
643 Ga0495601_0173244
644 Ga0500556_0088893
645 Ga0590075_026171
646 Ga0590077_099229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

6

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6re7-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2c, focussed refinement of f1 head and rotor 0.9189 7 102
6re1-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2a, focussed refinement of f1 head and rotor 0.9182 7 102
6rea-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2d, focussed refinement of f1 head and rotor 0.9178 7 105
6rde-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 2, focussed refinement of f1 head and rotor 0.9137 7 105
6rdv-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 1e, focussed refinement of f1 head and rotor 0.9112 7 105
ID Description Score Start End Superfamily
af_Q9DB20_36_129_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.962 6 98 1.10.520.20
af_I1MUQ0_165_253_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9591 101 177 3.30.2320.30
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9506 108 177 3.30.2320.30
af_Q96251_57_149_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9428 8 98 1.10.520.20
af_A0A1D6Q869_55_156_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9352 8 98 1.10.520.20
ID Description Score Start End GO Terms
AF-A0A7V9V6W5-F1-model_v4 F0F1 ATP synthase subunit delta 0.9714 106 176 GO:0016020
GO:0046933
AF-A0A3M1ZZR0-F1-model_v4 F0F1 ATP synthase subunit delta 0.9632 1 107 GO:0016020
GO:0046933
AF-A0A3M1ZZR0-F1-model_v4 F0F1 ATP synthase subunit delta 0.9461 1 107 GO:0016020
GO:0046933
AF-A0A0G1WAR4-F1-model_v4 Uncharacterized protein 0.9449 108 176 GO:0016020
GO:0046933
AF-A0A645JB25-F1-model_v4 ATP synthase subunit delta 0.9407 92 180 GO:0016020
GO:0046933

Map