F407028

General Info

Members Datasets Scaffolds Average Seq Length
323 208 646 107

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0587861|Ga0453684_0587861_186_500
Length 104
Sequence MKRVAFKMHLNEGQKAEYIKRHNEIWPELKTLLQDSGISEYSIFLDEETNTLFAFQKVSSEGGSQDLGKTEIVQLWWKFMADIMKTNPDNSPVTKELEEVFYME

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
205 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
206 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
207 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
208 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.22
Nodule 1.86
Rhizoplane 0.31
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0587861 3300044712 Unclassified 1222
2 SwRhRL3b_contig_1035158 2162886006 Unclassified 951
3 SwRhRL2b_contig_1164167 2162886007 Bacteria 1410
4 MBSR1b_contig_4453202 2162886012 Bacteria 1810
5 Ga0065704_10000576 3300005289 Bacteria 17595
6 Ga0065704_10083454 3300005289 Bacteria 3463
7 Ga0065712_10103388 3300005290 Bacteria 1986
8 Ga0065715_10019958 3300005293 Bacteria 2313
9 Ga0065715_10217976 3300005293 Unclassified 1284
10 Ga0065707_10002256 3300005295 Bacteria 4933
11 Ga0070676_10056677 3300005328 Bacteria 2316
12 Ga0070676_10226539 3300005328 Bacteria 1237
13 Ga0070683_100484511 3300005329 Bacteria 1181
14 Ga0070670_100116511 3300005331 Bacteria 2304
15 Ga0070670_100803356 3300005331 Bacteria 850
16 Ga0068869_100056890 3300005334 Bacteria 2853
17 Ga0068869_100120870 3300005334 Bacteria 2003
18 Ga0070666_10255239 3300005335 Bacteria 1242
19 Ga0068868_100030550 3300005338 Bacteria 4131
20 Ga0070689_100020016 3300005340 Bacteria 4959
21 Ga0070689_100315833 3300005340 Bacteria 1303
22 Ga0070689_100726799 3300005340 Unclassified 869
23 Ga0070687_100001125 3300005343 Bacteria 9233
24 Ga0070661_100463043 3300005344 Unclassified 1010
25 Ga0070692_10934177 3300005345 Unclassified 602
26 Ga0070668_100374466 3300005347 Bacteria 1210
27 Ga0070668_100628576 3300005347 Unclassified 942
28 Ga0070668_101593511 3300005347 Unclassified 598
29 Ga0070669_100154458 3300005353 Bacteria 1779
30 Ga0070669_101169819 3300005353 Bacteria 664
31 Ga0070675_100076358 3300005354 Bacteria 2787
32 Ga0070675_100358752 3300005354 Bacteria 1294
33 Ga0070671_100387526 3300005355 Bacteria 1195
34 Ga0070674_100020580 3300005356 Bacteria 4219
35 Ga0070674_100221912 3300005356 Bacteria 1471
36 Ga0070673_101043738 3300005364 Bacteria 762
37 Ga0070673_101256711 3300005364 Unclassified 695
38 Ga0070688_100026185 3300005365 Bacteria 3462
39 Ga0070688_100048076 3300005365 Bacteria 2649
40 Ga0070659_100455201 3300005366 Bacteria 1086
41 Ga0070667_100456940 3300005367 Unclassified 1167
42 Ga0070667_100761103 3300005367 Bacteria 898
43 Ga0070701_10173062 3300005438 Bacteria 1259
44 Ga0070700_100017722 3300005441 Bacteria 4079
45 Ga0070700_100454613 3300005441 Bacteria 975
46 Ga0070700_100489910 3300005441 Bacteria 943
47 Ga0070694_100010491 3300005444 Bacteria 5716
48 Ga0070708_100160880 3300005445 Bacteria 2092
49 Ga0070708_100279921 3300005445 Bacteria 1570
50 Ga0070708_100337264 3300005445 Bacteria 1421
51 Ga0070708_100792560 3300005445 Bacteria 891
52 Ga0070663_100058100 3300005455 Bacteria 2777
53 Ga0070663_100496354 3300005455 Unclassified 1013
54 Ga0070678_100085088 3300005456 Bacteria 2409
55 Ga0070662_100069123 3300005457 Bacteria 2598
56 Ga0068867_100009656 3300005459 Bacteria 6801
57 Ga0068867_101721494 3300005459 Bacteria 588
58 Ga0068867_102087538 3300005459 Bacteria 537
59 Ga0070706_100027367 3300005467 Bacteria 5248
60 Ga0070706_100292327 3300005467 Bacteria 1520
61 Ga0070707_100016508 3300005468 Bacteria 6928
62 Ga0070707_100387242 3300005468 Unclassified 1358
63 Ga0070707_101268192 3300005468 Bacteria 703
64 Ga0070698_100014864 3300005471 Bacteria 8229
65 Ga0070698_100082783 3300005471 Bacteria 3200
66 Ga0070698_100538640 3300005471 Bacteria 1106
67 Ga0070698_100839434 3300005471 Bacteria 863
68 Ga0070699_100007532 3300005518 Bacteria 9467
69 Ga0070699_101671200 3300005518 Bacteria 583
70 Ga0070679_101991160 3300005530 Bacteria 530
71 Ga0070697_100043034 3300005536 Bacteria 3656
72 Ga0068853_101412592 3300005539 Bacteria 673
73 Ga0070672_100016199 3300005543 Bacteria 5331
74 Ga0070686_100057064 3300005544 Bacteria 2507
75 Ga0070695_100250681 3300005545 Bacteria 1288
76 Ga0070696_100106274 3300005546 Bacteria 2017
77 Ga0070665_100000679 3300005548 Bacteria 45689
78 Ga0070665_100658418 3300005548 Bacteria 1060
79 Ga0070665_101408733 3300005548 Bacteria 706
80 Ga0070665_101467643 3300005548 Unclassified 691
81 Ga0068857_100244728 3300005577 Bacteria 1643
82 Ga0068854_100257785 3300005578 Bacteria 1395
83 Ga0070702_101703866 3300005615 Bacteria 524
84 Ga0068859_100066978 3300005617 Bacteria 3626
85 Ga0068859_100363293 3300005617 Bacteria 1543
86 Ga0068864_100363199 3300005618 Bacteria 1369
87 Ga0068864_100443060 3300005618 Bacteria 1241
88 Ga0068866_10455377 3300005718 Bacteria 838
89 Ga0068861_100195439 3300005719 Bacteria 1694
90 Ga0068861_101147312 3300005719 Unclassified 749
91 Ga0068861_102069842 3300005719 Bacteria 569
92 Ga0068870_10108550 3300005840 Bacteria 1580
93 Ga0068863_100657667 3300005841 Bacteria 1039
94 Ga0068858_100042682 3300005842 Bacteria 4204
95 Ga0068858_100188946 3300005842 Bacteria 1946
96 Ga0068860_100028169 3300005843 Bacteria 5408
97 Ga0068862_100101140 3300005844 Bacteria 2521
98 Ga0068862_100132452 3300005844 Bacteria 2206
99 Ga0068862_100629033 3300005844 Bacteria 1033
100 Ga0068862_101535141 3300005844 Bacteria 672
101 Ga0081455_10446935 3300005937 Bacteria 884
102 Ga0075365_10417884 3300006038 Bacteria 947
103 Ga0075368_10014764 3300006042 Bacteria 2889
104 Ga0075368_10563509 3300006042 Bacteria 513
105 Ga0075363_100353924 3300006048 Bacteria 858
106 Ga0075364_10056612 3300006051 Bacteria 2567
107 Ga0075364_10336236 3300006051 Bacteria 1029
108 Ga0075364_10539433 3300006051 Bacteria 797
109 Ga0075362_10029109 3300006177 Bacteria 2377
110 Ga0075362_10128530 3300006177 Bacteria 1203
111 Ga0075367_10014535 3300006178 Bacteria 4262
112 Ga0075367_10026629 3300006178 Bacteria 3282
113 Ga0075367_10473289 3300006178 Unclassified 794
114 Ga0075366_10018424 3300006195 Bacteria 4030
115 Ga0075366_10045430 3300006195 Bacteria 2603
116 Ga0075370_10066023 3300006353 Bacteria 2064
117 Ga0075370_10455739 3300006353 Bacteria 770
118 Ga0075428_100098179 3300006844 Bacteria 3193
119 Ga0075428_100957045 3300006844 Bacteria 907
120 Ga0075431_100011072 3300006847 Bacteria 9076
121 Ga0075431_100765024 3300006847 Bacteria 941
122 Ga0075433_11521034 3300006852 Unclassified 578
123 Ga0075434_100295834 3300006871 Bacteria 1639
124 Ga0075434_100601130 3300006871 Bacteria 1119
125 Ga0075429_100014024 3300006880 Bacteria 6946
126 Ga0075429_100147847 3300006880 Bacteria 2057
127 Ga0068865_100011733 3300006881 Bacteria 5489
128 Ga0068865_100019405 3300006881 Bacteria 4399
129 Ga0097620_100066979 3300006931 Bacteria 3626
130 Ga0097620_100363271 3300006931 Bacteria 1543
131 Ga0079104_1000386 3300006946 Bacteria 51269
132 Ga0079104_1085529 3300006946 Bacteria 645
133 Ga0075435_100253867 3300007076 Bacteria 1497
134 Ga0105244_10040421 3300009036 Bacteria 2422
135 Ga0105244_10121200 3300009036 Bacteria 1266
136 Ga0105240_10000006 3300009093 Bacteria 669662
137 Ga0111539_10000785 3300009094 Bacteria 41318
138 Ga0111539_10014758 3300009094 Bacteria 9745
139 Ga0105245_10052148 3300009098 Bacteria 3668
140 Ga0114129_10396991 3300009147 Unclassified 1818
141 Ga0114129_10413654 3300009147 Bacteria 1775
142 Ga0114129_11212046 3300009147 Bacteria 940
143 Ga0114129_11303592 3300009147 Bacteria 900
144 Ga0105243_10019490 3300009148 Bacteria 5143
145 Ga0105243_10577417 3300009148 Bacteria 1079
146 Ga0105248_10393393 3300009177 Bacteria 1561
147 Ga0105238_10834178 3300009551 Bacteria 938
148 Ga0105249_10119567 3300009553 Bacteria 2502
149 Ga0105249_10161994 3300009553 Bacteria 2162
150 Ga0105239_10020457 3300010375 Bacteria 7299
151 Ga0105239_10533783 3300010375 Bacteria 1335
152 Ga0157373_10011297 3300013100 Bacteria 6566
153 Ga0157371_10411116 3300013102 Bacteria 991
154 Ga0157378_10676070 3300013297 Bacteria 1050
155 Ga0163162_10132354 3300013306 Bacteria 2603
156 Ga0157375_10120520 3300013308 Bacteria 2732
157 Ga0157380_10019516 3300014326 Bacteria 5052
158 Ga0157380_10026103 3300014326 Bacteria 4435
159 Ga0157380_10113599 3300014326 Bacteria 2281
160 Ga0157377_10035236 3300014745 Bacteria 2744
161 Ga0157379_10064407 3300014968 Bacteria 3276
162 Ga0157379_10235962 3300014968 Bacteria 1658
163 Ga0207696_1000458 3300025711 Bacteria 35679
164 Ga0207655_1039819 3300025728 Bacteria 2036
165 Ga0207713_1004809 3300025735 Bacteria 8667
166 Ga0207642_10183879 3300025899 Bacteria 1141
167 Ga0207688_10750450 3300025901 Unclassified 618
168 Ga0207645_10093238 3300025907 Bacteria 1937
169 Ga0207645_10120715 3300025907 Bacteria 1701
170 Ga0207645_10141915 3300025907 Bacteria 1565
171 Ga0207684_10002300 3300025910 Bacteria 19431
172 Ga0207684_10069264 3300025910 Bacteria 2998
173 Ga0207695_10000017 3300025913 Bacteria 769384
174 Ga0207662_10029299 3300025918 Bacteria 3189
175 Ga0207652_10589614 3300025921 Bacteria 997
176 Ga0207646_10006553 3300025922 Bacteria 12015
177 Ga0207646_10591147 3300025922 Bacteria 997
178 Ga0207694_10571731 3300025924 Bacteria 949
179 Ga0207650_10118886 3300025925 Bacteria 2055
180 Ga0207650_10197800 3300025925 Bacteria 1609
181 Ga0207659_10285675 3300025926 Bacteria 1350
182 Ga0207687_10142101 3300025927 Bacteria 1822
183 Ga0207706_10077118 3300025933 Bacteria 2931
184 Ga0207706_10082795 3300025933 Bacteria 2820
185 Ga0207686_10399355 3300025934 Bacteria 1047
186 Ga0207709_10114615 3300025935 Bacteria 1809
187 Ga0207670_11338978 3300025936 Unclassified 607
188 Ga0207669_10056493 3300025937 Bacteria 2384
189 Ga0207704_10095770 3300025938 Bacteria 1963
190 Ga0207704_10215535 3300025938 Bacteria 1416
191 Ga0207691_10026771 3300025940 Bacteria 5411
192 Ga0207691_10300707 3300025940 Bacteria 1379
193 Ga0207689_10030905 3300025942 Bacteria 4461
194 Ga0207689_10123854 3300025942 Bacteria 2126
195 Ga0207679_10465738 3300025945 Bacteria 1123
196 Ga0207651_10377376 3300025960 Bacteria 1201
197 Ga0207712_10093123 3300025961 Bacteria 2223
198 Ga0207712_11119738 3300025961 Bacteria 701
199 Ga0207668_10079501 3300025972 Bacteria 2372
200 Ga0207668_10421355 3300025972 Unclassified 1133
201 Ga0207640_10134038 3300025981 Bacteria 1795
202 Ga0207640_10483084 3300025981 Bacteria 1028
203 Ga0207640_10719613 3300025981 Bacteria 858
204 Ga0207658_10211693 3300025986 Bacteria 1625
205 Ga0207677_10698092 3300026023 Bacteria 900
206 Ga0207703_10089851 3300026035 Bacteria 2580
207 Ga0207678_10009614 3300026067 Bacteria 8504
208 Ga0207708_10027343 3300026075 Bacteria 4318
209 Ga0207708_10496066 3300026075 Bacteria 1023
210 Ga0207641_10259834 3300026088 Bacteria 1625
211 Ga0207648_10009770 3300026089 Bacteria 9168
212 Ga0207676_10261794 3300026095 Bacteria 1562
213 Ga0207676_10400305 3300026095 Bacteria 1283
214 Ga0207675_100073597 3300026118 Bacteria 3197
215 Ga0207675_100862916 3300026118 Unclassified 920
216 Ga0207698_12090101 3300026142 Unclassified 580
217 Ga0209281_1000061 3300027111 Bacteria 293814
218 Ga0209982_1039613 3300027552 Bacteria 751
219 Ga0209813_10069334 3300027866 Bacteria 1143
220 Ga0207428_10000543 3300027907 Bacteria 44986
221 Ga0207428_10191085 3300027907 Bacteria 1543
222 Ga0268266_10000199 3300028379 Bacteria 104808
223 Ga0268266_10655714 3300028379 Bacteria 1010
224 Ga0268265_10152580 3300028380 Bacteria 1950
225 Ga0268264_10084800 3300028381 Bacteria 2717
226 Ga0265338_10182420 3300028800 Bacteria 1599
227 Ga0265338_10758815 3300028800 Unclassified 667
228 Ga0316576_10722383 3300031727 Bacteria 721
229 Ga0316577_10355342 3300031733 Bacteria 832
230 Ga0373950_0139877 3300034818 Archaea 547
231 Ga0373928_0207152 3300035084 Bacteria 568
232 Ga0373942_0207242 3300035207 Bacteria 653
233 Ga0373931_1183088 3300035691 Unclassified 523
234 Ga0316584_0655974 3300036712 Unclassified 723
235 Ga0451853_1698468 3300041512 Bacteria 4966
236 Ga0439452_000195 3300042010 Bacteria 44388
237 Ga0439452_000735 3300042010 Bacteria 15749
238 Ga0439464_0000223 3300042439 Bacteria 10269
239 Ga0453683_0631987 3300044673 Bacteria 699
240 Ga0453684_0264044 3300044712 Bacteria 1971
241 Ga0453684_0865429 3300044712 Unclassified 970
242 Ga0453684_2534073 3300044712 Bacteria 505
243 Ga0451576_0056884 3300045051 Bacteria 4089
244 Ga0495650_0000313 3300046471 Bacteria 87461
245 Ga0495620_0163596 3300046515 Bacteria 864
246 Ga0495637_0093009 3300046520 Bacteria 1187
247 Ga0495597_0017549 3300046542 Bacteria 3366
248 Ga0495625_0001634 3300046660 Bacteria 26376
249 Ga0495588_0004861 3300046674 Bacteria 5951
250 Ga0495679_000016 3300047446 Bacteria 282024
251 Ga0495686_0586577 3300047472 Bacteria 578
252 Ga0496110_0496183 3300048913 Bacteria 1112
253 Ga0496116_0002636 3300048919 Bacteria 18610
254 Ga0496117_0003465 3300048920 Bacteria 18335
255 Ga0496118_0006666 3300048921 Bacteria 12596
256 Ga0496119_0003998 3300048922 Bacteria 14923
257 Ga0496120_0006868 3300048923 Bacteria 8600
258 Ga0496121_0005675 3300048924 Bacteria 15874
259 Ga0496121_0059220 3300048924 Bacteria 3159
260 Ga0496122_0001205 3300048925 Bacteria 44063
261 Ga0496123_0001062 3300048926 Bacteria 41524
262 Ga0496124_0031519 3300048927 Bacteria 4692
263 Ga0496126_0249222 3300048929 Bacteria 1480
264 Ga0501033_0993737 3300049570 Bacteria 561
265 Ga0501034_0116166 3300049571 Bacteria 2664
266 Ga0501034_0429224 3300049571 Bacteria 1241
267 Ga0501034_0526120 3300049571 Bacteria 1094
268 Ga0501034_1223284 3300049571 Bacteria 629
269 Ga0501034_1424986 3300049571 Bacteria 567
270 Ga0501034_1686325 3300049571 Bacteria 506
271 Ga0501036_0403264 3300049572 Unclassified 1141
272 Ga0501037_0296780 3300049573 Unclassified 1123
273 Ga0501038_0155556 3300049574 Unclassified 1862
274 Ga0501039_0911004 3300049575 Unclassified 684
275 Ga0501039_1572644 3300049575 Bacteria 505
276 Ga0501042_0929716 3300049578 Unclassified 633
277 Ga0501047_0150353 3300049581 Bacteria 2205
278 Ga0501070_0193190 3300049586 Bacteria 1673
279 Ga0501076_1050930 3300049592 Unclassified 671
280 Ga0501076_1059652 3300049592 Bacteria 668
281 Ga0501079_1352081 3300049741 Bacteria 561
282 Ga0501079_1555796 3300049741 Bacteria 520
283 Ga0501083_0390876 3300049744 Unclassified 905
284 Ga0501044_0094748 3300049823 Unclassified 3009
285 nmdc:mga03683_27529_c1 3300050489 Bacteria 2252
286 nmdc:mga03683_54940_c1 3300050489 Bacteria 1671
287 nmdc:mga03n38_75911_c1 3300050490 Bacteria 1566
288 nmdc:mga00v17_18272_c1 3300050491 Bacteria 3979
289 nmdc:mga00v17_258715_c1 3300050491 Bacteria 1129
290 nmdc:mga00v17_404039_c1 3300050491 Bacteria 888
291 nmdc:mga0yw44_113666_c1 3300050492 Bacteria 1737
292 nmdc:mga0yw44_402520_c1 3300050492 Bacteria 925
293 nmdc:mga0k408_130531_c1 3300050493 Bacteria 1492
294 nmdc:mga0k408_2590_c1 3300050493 Bacteria 9606
295 nmdc:mga06z11_10747_c1 3300050494 Bacteria 3915
296 nmdc:mga06z11_21783_c1 3300050494 Bacteria 2983
297 nmdc:mga06z11_426048_c1 3300050494 Unclassified 800
298 nmdc:mga04h51_8340_c1 3300050495 Bacteria 2770
299 nmdc:mga07m45_112074_c1 3300050496 Bacteria 1572
300 nmdc:mga05p37_367200_c1 3300050507 Bacteria 1690
301 nmdc:mga05p37_383399_c1 3300050507 Unclassified 1646
302 nmdc:mga05p37_98638_c1 3300050507 Bacteria 3598
303 nmdc:mga09592_84528_c1 3300050508 Bacteria 2706
304 nmdc:mga09592_96383_c1 3300050508 Bacteria 2530
305 nmdc:mga0qj67_849651_c1 3300050509 Bacteria 721
306 nmdc:mga06r32_1124460_c1 3300050510 Bacteria 734
307 nmdc:mga06r32_14231_c1 3300050510 Bacteria 7215
308 nmdc:mga06r32_856576_c1 3300050510 Bacteria 867
309 nmdc:mga08y16_1183034_c1 3300050511 Unclassified 736
310 nmdc:mga08y16_297_c1 3300050511 Bacteria 44732
311 nmdc:mga08y16_37890_c1 3300050511 Bacteria 5062
312 nmdc:mga0n895_209321_c1 3300050512 Bacteria 1980
313 nmdc:mga0n895_81087_c1 3300050512 Bacteria 3233
314 nmdc:mga0rr50_121488_c1 3300050513 Bacteria 2079
315 nmdc:mga0rr50_184940_c1 3300050513 Bacteria 1705
316 Ga0495655_0224439 3300053083 Bacteria 623
317 Ga0500651_0121978 3300053093 Bacteria 1582
318 Ga0501082_0558917 3300060353 Bacteria 1001
319 2821126695 2821123053 Bacteria 7836056
320 2838740301 2838736955 Bacteria 5760694
321 2841843574 2841840854 Bacteria 5761912
322 2842143294 2842140634 Bacteria 5759631
323 2857535520 2857531043 Bacteria 6754041
324 Ga0453684_0587861
325 SwRhRL3b_contig_1035158
326 SwRhRL2b_contig_1164167
327 MBSR1b_contig_4453202
328 Ga0065704_10000576
329 Ga0065704_10083454
330 Ga0065712_10103388
331 Ga0065715_10019958
332 Ga0065715_10217976
333 Ga0065707_10002256
334 Ga0070676_10056677
335 Ga0070676_10226539
336 Ga0070683_100484511
337 Ga0070670_100116511
338 Ga0070670_100803356
339 Ga0068869_100056890
340 Ga0068869_100120870
341 Ga0070666_10255239
342 Ga0068868_100030550
343 Ga0070689_100020016
344 Ga0070689_100315833
345 Ga0070689_100726799
346 Ga0070687_100001125
347 Ga0070661_100463043
348 Ga0070692_10934177
349 Ga0070668_100374466
350 Ga0070668_100628576
351 Ga0070668_101593511
352 Ga0070669_100154458
353 Ga0070669_101169819
354 Ga0070675_100076358
355 Ga0070675_100358752
356 Ga0070671_100387526
357 Ga0070674_100020580
358 Ga0070674_100221912
359 Ga0070673_101043738
360 Ga0070673_101256711
361 Ga0070688_100026185
362 Ga0070688_100048076
363 Ga0070659_100455201
364 Ga0070667_100456940
365 Ga0070667_100761103
366 Ga0070701_10173062
367 Ga0070700_100017722
368 Ga0070700_100454613
369 Ga0070700_100489910
370 Ga0070694_100010491
371 Ga0070708_100160880
372 Ga0070708_100279921
373 Ga0070708_100337264
374 Ga0070708_100792560
375 Ga0070663_100058100
376 Ga0070663_100496354
377 Ga0070678_100085088
378 Ga0070662_100069123
379 Ga0068867_100009656
380 Ga0068867_101721494
381 Ga0068867_102087538
382 Ga0070706_100027367
383 Ga0070706_100292327
384 Ga0070707_100016508
385 Ga0070707_100387242
386 Ga0070707_101268192
387 Ga0070698_100014864
388 Ga0070698_100082783
389 Ga0070698_100538640
390 Ga0070698_100839434
391 Ga0070699_100007532
392 Ga0070699_101671200
393 Ga0070679_101991160
394 Ga0070697_100043034
395 Ga0068853_101412592
396 Ga0070672_100016199
397 Ga0070686_100057064
398 Ga0070695_100250681
399 Ga0070696_100106274
400 Ga0070665_100000679
401 Ga0070665_100658418
402 Ga0070665_101408733
403 Ga0070665_101467643
404 Ga0068857_100244728
405 Ga0068854_100257785
406 Ga0070702_101703866
407 Ga0068859_100066978
408 Ga0068859_100363293
409 Ga0068864_100363199
410 Ga0068864_100443060
411 Ga0068866_10455377
412 Ga0068861_100195439
413 Ga0068861_101147312
414 Ga0068861_102069842
415 Ga0068870_10108550
416 Ga0068863_100657667
417 Ga0068858_100042682
418 Ga0068858_100188946
419 Ga0068860_100028169
420 Ga0068862_100101140
421 Ga0068862_100132452
422 Ga0068862_100629033
423 Ga0068862_101535141
424 Ga0081455_10446935
425 Ga0075365_10417884
426 Ga0075368_10014764
427 Ga0075368_10563509
428 Ga0075363_100353924
429 Ga0075364_10056612
430 Ga0075364_10336236
431 Ga0075364_10539433
432 Ga0075362_10029109
433 Ga0075362_10128530
434 Ga0075367_10014535
435 Ga0075367_10026629
436 Ga0075367_10473289
437 Ga0075366_10018424
438 Ga0075366_10045430
439 Ga0075370_10066023
440 Ga0075370_10455739
441 Ga0075428_100098179
442 Ga0075428_100957045
443 Ga0075431_100011072
444 Ga0075431_100765024
445 Ga0075433_11521034
446 Ga0075434_100295834
447 Ga0075434_100601130
448 Ga0075429_100014024
449 Ga0075429_100147847
450 Ga0068865_100011733
451 Ga0068865_100019405
452 Ga0097620_100066979
453 Ga0097620_100363271
454 Ga0079104_1000386
455 Ga0079104_1085529
456 Ga0075435_100253867
457 Ga0105244_10040421
458 Ga0105244_10121200
459 Ga0105240_10000006
460 Ga0111539_10000785
461 Ga0111539_10014758
462 Ga0105245_10052148
463 Ga0114129_10396991
464 Ga0114129_10413654
465 Ga0114129_11212046
466 Ga0114129_11303592
467 Ga0105243_10019490
468 Ga0105243_10577417
469 Ga0105248_10393393
470 Ga0105238_10834178
471 Ga0105249_10119567
472 Ga0105249_10161994
473 Ga0105239_10020457
474 Ga0105239_10533783
475 Ga0157373_10011297
476 Ga0157371_10411116
477 Ga0157378_10676070
478 Ga0163162_10132354
479 Ga0157375_10120520
480 Ga0157380_10019516
481 Ga0157380_10026103
482 Ga0157380_10113599
483 Ga0157377_10035236
484 Ga0157379_10064407
485 Ga0157379_10235962
486 Ga0207696_1000458
487 Ga0207655_1039819
488 Ga0207713_1004809
489 Ga0207642_10183879
490 Ga0207688_10750450
491 Ga0207645_10093238
492 Ga0207645_10120715
493 Ga0207645_10141915
494 Ga0207684_10002300
495 Ga0207684_10069264
496 Ga0207695_10000017
497 Ga0207662_10029299
498 Ga0207652_10589614
499 Ga0207646_10006553
500 Ga0207646_10591147
501 Ga0207694_10571731
502 Ga0207650_10118886
503 Ga0207650_10197800
504 Ga0207659_10285675
505 Ga0207687_10142101
506 Ga0207706_10077118
507 Ga0207706_10082795
508 Ga0207686_10399355
509 Ga0207709_10114615
510 Ga0207670_11338978
511 Ga0207669_10056493
512 Ga0207704_10095770
513 Ga0207704_10215535
514 Ga0207691_10026771
515 Ga0207691_10300707
516 Ga0207689_10030905
517 Ga0207689_10123854
518 Ga0207679_10465738
519 Ga0207651_10377376
520 Ga0207712_10093123
521 Ga0207712_11119738
522 Ga0207668_10079501
523 Ga0207668_10421355
524 Ga0207640_10134038
525 Ga0207640_10483084
526 Ga0207640_10719613
527 Ga0207658_10211693
528 Ga0207677_10698092
529 Ga0207703_10089851
530 Ga0207678_10009614
531 Ga0207708_10027343
532 Ga0207708_10496066
533 Ga0207641_10259834
534 Ga0207648_10009770
535 Ga0207676_10261794
536 Ga0207676_10400305
537 Ga0207675_100073597
538 Ga0207675_100862916
539 Ga0207698_12090101
540 Ga0209281_1000061
541 Ga0209982_1039613
542 Ga0209813_10069334
543 Ga0207428_10000543
544 Ga0207428_10191085
545 Ga0268266_10000199
546 Ga0268266_10655714
547 Ga0268265_10152580
548 Ga0268264_10084800
549 Ga0265338_10182420
550 Ga0265338_10758815
551 Ga0316576_10722383
552 Ga0316577_10355342
553 Ga0373950_0139877
554 Ga0373928_0207152
555 Ga0373942_0207242
556 Ga0373931_1183088
557 Ga0316584_0655974
558 Ga0451853_1698468
559 Ga0439452_000195
560 Ga0439452_000735
561 Ga0439464_0000223
562 Ga0453683_0631987
563 Ga0453684_0264044
564 Ga0453684_0865429
565 Ga0453684_2534073
566 Ga0451576_0056884
567 Ga0495650_0000313
568 Ga0495620_0163596
569 Ga0495637_0093009
570 Ga0495597_0017549
571 Ga0495625_0001634
572 Ga0495588_0004861
573 Ga0495679_000016
574 Ga0495686_0586577
575 Ga0496110_0496183
576 Ga0496116_0002636
577 Ga0496117_0003465
578 Ga0496118_0006666
579 Ga0496119_0003998
580 Ga0496120_0006868
581 Ga0496121_0005675
582 Ga0496121_0059220
583 Ga0496122_0001205
584 Ga0496123_0001062
585 Ga0496124_0031519
586 Ga0496126_0249222
587 Ga0501033_0993737
588 Ga0501034_0116166
589 Ga0501034_0429224
590 Ga0501034_0526120
591 Ga0501034_1223284
592 Ga0501034_1424986
593 Ga0501034_1686325
594 Ga0501036_0403264
595 Ga0501037_0296780
596 Ga0501038_0155556
597 Ga0501039_0911004
598 Ga0501039_1572644
599 Ga0501042_0929716
600 Ga0501047_0150353
601 Ga0501070_0193190
602 Ga0501076_1050930
603 Ga0501076_1059652
604 Ga0501079_1352081
605 Ga0501079_1555796
606 Ga0501083_0390876
607 Ga0501044_0094748
608 nmdc:mga03683_27529_c1
609 nmdc:mga03683_54940_c1
610 nmdc:mga03n38_75911_c1
611 nmdc:mga00v17_18272_c1
612 nmdc:mga00v17_258715_c1
613 nmdc:mga00v17_404039_c1
614 nmdc:mga0yw44_113666_c1
615 nmdc:mga0yw44_402520_c1
616 nmdc:mga0k408_130531_c1
617 nmdc:mga0k408_2590_c1
618 nmdc:mga06z11_10747_c1
619 nmdc:mga06z11_21783_c1
620 nmdc:mga06z11_426048_c1
621 nmdc:mga04h51_8340_c1
622 nmdc:mga07m45_112074_c1
623 nmdc:mga05p37_367200_c1
624 nmdc:mga05p37_383399_c1
625 nmdc:mga05p37_98638_c1
626 nmdc:mga09592_84528_c1
627 nmdc:mga09592_96383_c1
628 nmdc:mga0qj67_849651_c1
629 nmdc:mga06r32_1124460_c1
630 nmdc:mga06r32_14231_c1
631 nmdc:mga06r32_856576_c1
632 nmdc:mga08y16_1183034_c1
633 nmdc:mga08y16_297_c1
634 nmdc:mga08y16_37890_c1
635 nmdc:mga0n895_209321_c1
636 nmdc:mga0n895_81087_c1
637 nmdc:mga0rr50_121488_c1
638 nmdc:mga0rr50_184940_c1
639 Ga0495655_0224439
640 Ga0500651_0121978
641 Ga0501082_0558917
642 2821126695
643 2838740301
644 2841843574
645 2842143294
646 2857535520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

3

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.942 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.9334 1 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9315 1 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9226 1 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.8999 2 104
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9425 1 97 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9333 1 97 3.30.70.100
1ej6A05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8935 38 60 2.60.40.10
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8662 2 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8251 2 97 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W1F1T7-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9611 1 104 GO:0005737
GO:0019301
GO:0062192
AF-A0A2E5UR87-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.96 1 103 GO:0005737
GO:0016857
GO:0019301
AF-A0A2V8IID8-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9587 1 104 GO:0005737
GO:0016857
GO:0019301
AF-A0A1Q7H0F6-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9585 1 104 GO:0005737
GO:0016857
GO:0019301
AF-Q65Q29-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) 0.9582 1 104 GO:0005737
GO:0019301
GO:0062192

Map