F406870

General Info

Members Datasets Scaffolds Average Seq Length
323 222 646 117

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100003200|Ga0075428_10000320010
Length 135
Sequence VRGCSPIVSQALHCVRGKGRLFLALAVLAATPADPGLAQAPAFTPSDERPEDFPPGPGREEAFYACVACHNFKLVAAQGMTRARWEESLAFMTQRHNMPALEGDERRIVLDYLETTFPPRAPARPGGWQNPFAPR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2643221736 Bosea sp. Root483D1 Isolate Unclassified
210 2791355199
211 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
212 2841760612 Bosea sp. Tri-49 Isolate Nodule
213 2844104063 Bosea sp. Tri-39 Isolate Nodule
214 2851182111 Bosea sp. Tri-44 Isolate Nodule
215 2851246043 Bosea sp. Tri-54 Isolate Nodule
216 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
217 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
218 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
219 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
220 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
221 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
222 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.38
Nodule 2.79
Rhizoplane 5.88
Rhizosphere 71.83
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100003200 3300006844 Bacteria 17905
2 JGI25151J46595_10079534 3300003187 Bacteria 955
3 JGI25153J46596_10001062 3300003215 Bacteria 16761
4 rootH2_10170455 3300003320 Bacteria 4097
5 rootH1_10285701 3300003323 Bacteria 1075
6 Ga0065165_1000046 3300005262 Bacteria 198873
7 Ga0070677_10023729 3300005333 Bacteria 2273
8 Ga0068869_100050995 3300005334 Bacteria 3001
9 Ga0068868_100170117 3300005338 Bacteria 1803
10 Ga0068868_101082762 3300005338 Bacteria 737
11 Ga0070687_100706670 3300005343 Bacteria 705
12 Ga0070661_100158550 3300005344 Bacteria 1713
13 Ga0070668_100736747 3300005347 Bacteria 871
14 Ga0070675_100961351 3300005354 Bacteria 784
15 Ga0070671_100328443 3300005355 Bacteria 1304
16 Ga0070674_100638391 3300005356 Bacteria 904
17 Ga0070688_100567734 3300005365 Bacteria 864
18 Ga0070667_100440413 3300005367 Bacteria 1190
19 Ga0070663_100009362 3300005455 Bacteria 6062
20 Ga0070663_100455118 3300005455 Bacteria 1055
21 Ga0070678_100898232 3300005456 Bacteria 810
22 Ga0070685_10866903 3300005466 Bacteria 670
23 Ga0070698_100081500 3300005471 Bacteria 3230
24 Ga0070684_101190385 3300005535 Bacteria 717
25 Ga0070672_101146308 3300005543 Bacteria 692
26 Ga0070672_101958032 3300005543 Bacteria 528
27 Ga0070665_100707542 3300005548 Bacteria 1020
28 Ga0070665_100954991 3300005548 Bacteria 870
29 Ga0070664_102148506 3300005564 Bacteria 530
30 Ga0070702_100738312 3300005615 Bacteria 755
31 Ga0068859_100262811 3300005617 Bacteria 1817
32 Ga0068859_100811941 3300005617 Bacteria 1023
33 Ga0068870_10830653 3300005840 Bacteria 648
34 Ga0068863_100402720 3300005841 Bacteria 1339
35 Ga0068858_100284211 3300005842 Bacteria 1575
36 Ga0068858_102520941 3300005842 Unclassified 508
37 Ga0068860_100104330 3300005843 Bacteria 2706
38 Ga0081455_10082984 3300005937 Bacteria 2620
39 Ga0081538_10050360 3300005981 Bacteria 2516
40 Ga0081538_10351310 3300005981 Bacteria 534
41 Ga0081540_1018628 3300005983 Bacteria 4251
42 Ga0081539_10042340 3300005985 Bacteria 2654
43 Ga0075365_10215141 3300006038 Bacteria 1347
44 Ga0075365_10326158 3300006038 Bacteria 1081
45 Ga0075365_10941197 3300006038 Bacteria 609
46 Ga0075363_100019588 3300006048 Bacteria 3384
47 Ga0075364_10557619 3300006051 Bacteria 783
48 Ga0075364_10597844 3300006051 Bacteria 754
49 Ga0075362_10068697 3300006177 Bacteria 1614
50 Ga0075362_10137554 3300006177 Bacteria 1166
51 Ga0075367_10668109 3300006178 Bacteria 661
52 Ga0075369_10294896 3300006186 Bacteria 757
53 Ga0075369_10392123 3300006186 Bacteria 654
54 Ga0075366_10711638 3300006195 Bacteria 624
55 Ga0075370_10166552 3300006353 Bacteria 1295
56 Ga0075428_100063104 3300006844 Bacteria 4056
57 Ga0075428_100155141 3300006844 Bacteria 2487
58 Ga0075428_100832210 3300006844 Bacteria 980
59 Ga0075428_101542065 3300006844 Bacteria 695
60 Ga0075430_100045742 3300006846 Bacteria 3696
61 Ga0075430_100095267 3300006846 Bacteria 2488
62 Ga0075430_100371575 3300006846 Bacteria 1180
63 Ga0075431_100000003 3300006847 Bacteria 112884
64 Ga0075431_100087493 3300006847 Bacteria 3215
65 Ga0075431_100182947 3300006847 Bacteria 2150
66 Ga0075431_100447917 3300006847 Bacteria 1287
67 Ga0075429_100012151 3300006880 Bacteria 7464
68 Ga0075429_100127840 3300006880 Bacteria 2222
69 Ga0075429_101025964 3300006880 Unclassified 721
70 Ga0097620_100262817 3300006931 Bacteria 1817
71 Ga0097620_100811961 3300006931 Bacteria 1023
72 Ga0105250_10090692 3300009092 Bacteria 1243
73 Ga0111539_10000504 3300009094 Bacteria 49771
74 Ga0111539_10835140 3300009094 Bacteria 1072
75 Ga0105247_10331107 3300009101 Bacteria 1065
76 Ga0105247_11828764 3300009101 Bacteria 506
77 Ga0114129_10000062 3300009147 Bacteria 96507
78 Ga0114129_10012887 3300009147 Bacteria 11899
79 Ga0114129_10475928 3300009147 Bacteria 1635
80 Ga0114129_11138069 3300009147 Bacteria 975
81 Ga0114129_11407798 3300009147 Bacteria 860
82 Ga0105243_11944297 3300009148 Bacteria 622
83 Ga0105248_10578732 3300009177 Bacteria 1267
84 Ga0105248_10789704 3300009177 Bacteria 1072
85 Ga0105249_10757184 3300009553 Bacteria 1033
86 Ga0105249_11766300 3300009553 Bacteria 691
87 Ga0105249_12149479 3300009553 Bacteria 631
88 Ga0105239_12790448 3300010375 Bacteria 570
89 Ga0157374_11633521 3300013296 Bacteria 669
90 Ga0163162_10759509 3300013306 Bacteria 1088
91 Ga0163162_11283080 3300013306 Bacteria 832
92 Ga0163162_12092259 3300013306 Bacteria 649
93 Ga0157375_10677323 3300013308 Bacteria 1186
94 Ga0163163_11846625 3300014325 Bacteria 664
95 Ga0163163_12928474 3300014325 Bacteria 533
96 Ga0157379_10385901 3300014968 Bacteria 1286
97 Ga0157376_10961799 3300014969 Bacteria 875
98 Ga0182007_10208664 3300015262 Bacteria 686
99 Ga0209130_1000703 3300025284 Bacteria 29959
100 Ga0209025_1002592 3300025294 Bacteria 18694
101 Ga0209758_1005146 3300025297 Bacteria 10311
102 Ga0207426_1072899 3300025302 Bacteria 952
103 Ga0207710_10072175 3300025900 Bacteria 1585
104 Ga0207645_10190344 3300025907 Bacteria 1348
105 Ga0207705_10177096 3300025909 Bacteria 1608
106 Ga0207649_10106760 3300025920 Bacteria 1863
107 Ga0207650_10338054 3300025925 Bacteria 1236
108 Ga0207650_10402298 3300025925 Bacteria 1133
109 Ga0207644_10285640 3300025931 Bacteria 1326
110 Ga0207709_11604096 3300025935 Bacteria 540
111 Ga0207704_10748287 3300025938 Bacteria 813
112 Ga0207691_10261900 3300025940 Bacteria 1491
113 Ga0207691_11044516 3300025940 Bacteria 681
114 Ga0207691_11689144 3300025940 Bacteria 513
115 Ga0207689_10007547 3300025942 Bacteria 9537
116 Ga0207679_11776876 3300025945 Bacteria 564
117 Ga0207667_10421331 3300025949 Bacteria 1358
118 Ga0207668_10467744 3300025972 Bacteria 1079
119 Ga0207668_10958467 3300025972 Bacteria 763
120 Ga0207640_11948681 3300025981 Bacteria 532
121 Ga0207658_11864468 3300025986 Bacteria 548
122 Ga0207703_10774279 3300026035 Bacteria 915
123 Ga0207703_11333062 3300026035 Bacteria 690
124 Ga0207639_10493511 3300026041 Bacteria 1118
125 Ga0207678_10033249 3300026067 Bacteria 4494
126 Ga0207678_10196725 3300026067 Bacteria 1723
127 Ga0207641_10204038 3300026088 Bacteria 1825
128 Ga0207676_12327139 3300026095 Bacteria 533
129 Ga0207683_10065313 3300026121 Bacteria 3208
130 Ga0207683_10892444 3300026121 Bacteria 825
131 Ga0207428_10004077 3300027907 Bacteria 13998
132 Ga0268266_10000827 3300028379 Bacteria 40488
133 Ga0268266_10066869 3300028379 Bacteria 3109
134 Ga0268266_10122571 3300028379 Bacteria 2315
135 Ga0268266_10981739 3300028379 Bacteria 817
136 Ga0268266_11969921 3300028379 Bacteria 558
137 Ga0268264_10615970 3300028381 Bacteria 1071
138 Ga0307515_10864995 3300028794 Bacteria 532
139 Ga0307512_10345841 3300030522 Bacteria 659
140 Ga0307513_10370770 3300031456 Bacteria 1174
141 Ga0307513_10455003 3300031456 Bacteria 1004
142 Ga0307513_10557086 3300031456 Bacteria 858
143 Ga0307408_101146971 3300031548 Unclassified 723
144 Ga0307408_101186743 3300031548 Bacteria 711
145 Ga0307408_102341856 3300031548 Bacteria 518
146 Ga0307405_10049251 3300031731 Bacteria 2603
147 Ga0307405_10127917 3300031731 Bacteria 1750
148 Ga0307405_11459206 3300031731 Bacteria 600
149 Ga0307413_10058820 3300031824 Bacteria 2358
150 Ga0307413_10062930 3300031824 Bacteria 2298
151 Ga0307413_11956121 3300031824 Unclassified 528
152 Ga0307410_10229441 3300031852 Bacteria 1433
153 Ga0307410_10239566 3300031852 Bacteria 1405
154 Ga0307410_11189705 3300031852 Unclassified 664
155 Ga0307406_10049130 3300031901 Bacteria 2669
156 Ga0307407_10092900 3300031903 Bacteria 1854
157 Ga0307407_10108503 3300031903 Bacteria 1738
158 Ga0307407_10788371 3300031903 Bacteria 722
159 Ga0307409_100047659 3300031995 Bacteria 3254
160 Ga0307416_100483025 3300032002 Bacteria 1299
161 Ga0307416_100977586 3300032002 Bacteria 949
162 Ga0307414_10511971 3300032004 Bacteria 1064
163 Ga0307411_10100468 3300032005 Bacteria 2044
164 Ga0307415_100287021 3300032126 Bacteria 1356
165 Ga0307415_101140520 3300032126 Bacteria 732
166 Ga0373940_0260947 3300035088 Bacteria 587
167 Ga0373952_0129480 3300035092 Bacteria 692
168 Ga0373935_1263900 3300035692 Bacteria 551
169 Ga0373927_0329514 3300035695 Bacteria 1006
170 Ga0237819_26748 3300038705 Bacteria 535
171 Ga0439465_0379707 3300041413 Bacteria 536
172 Ga0451791_1462769 3300041451 Bacteria 836
173 Ga0451795_1341459 3300041456 Bacteria 506
174 Ga0451798_0270381 3300041458 Bacteria 584
175 Ga0451802_0142015 3300041460 Bacteria 773
176 Ga0451807_2668894 3300041486 Bacteria 970
177 Ga0451837_0270499 3300041494 Bacteria 685
178 Ga0451837_0523816 3300041494 Unclassified 606
179 Ga0451849_1143594 3300041505 Bacteria 575
180 Ga0451855_0820861 3300041511 Bacteria 716
181 Ga0451853_0150707 3300041512 Bacteria 593
182 Ga0439455_0079198 3300042012 Bacteria 891
183 Ga0439464_0069860 3300042439 Bacteria 1038
184 Ga0495617_114001 3300046452 Bacteria 873
185 Ga0495603_0006264 3300046455 Bacteria 7113
186 Ga0495590_0029282 3300046457 Bacteria 1931
187 Ga0495590_0105471 3300046457 Bacteria 1003
188 Ga0495629_0323338 3300046459 Bacteria 1054
189 Ga0495638_0048277 3300046460 Bacteria 2665
190 Ga0495580_0247871 3300046472 Bacteria 1220
191 Ga0495605_0202956 3300046474 Bacteria 863
192 Ga0495605_0316462 3300046474 Bacteria 658
193 Ga0495605_0323220 3300046474 Bacteria 650
194 Ga0495605_0400189 3300046474 Bacteria 571
195 Ga0495585_0311605 3300046492 Bacteria 771
196 Ga0495607_0342775 3300046501 Bacteria 692
197 Ga0495610_0285637 3300046512 Bacteria 641
198 Ga0495616_0374483 3300046513 Bacteria 589
199 Ga0495632_0347291 3300046519 Bacteria 653
200 Ga0495632_0449085 3300046519 Bacteria 559
201 Ga0495648_0298486 3300046524 Bacteria 756
202 Ga0495663_0106483 3300046525 Bacteria 928
203 Ga0495598_0030493 3300046537 Bacteria 1511
204 Ga0495621_0018800 3300046539 Bacteria 2249
205 Ga0495621_0089528 3300046539 Bacteria 1159
206 Ga0495633_0088375 3300046558 Bacteria 1441
207 Ga0495656_0041092 3300046615 Bacteria 1930
208 Ga0495656_0395477 3300046615 Bacteria 722
209 Ga0495656_0407458 3300046615 Bacteria 712
210 Ga0495668_0172907 3300046616 Bacteria 1183
211 Ga0495611_0090456 3300046648 Bacteria 1414
212 Ga0495611_0249116 3300046648 Bacteria 823
213 Ga0495625_0103431 3300046660 Bacteria 1953
214 Ga0495625_0809619 3300046660 Bacteria 544
215 Ga0495659_0009063 3300046664 Bacteria 3173
216 Ga0495659_0117666 3300046664 Bacteria 1043
217 Ga0495661_0350071 3300046665 Bacteria 728
218 Ga0495588_0102617 3300046674 Bacteria 1503
219 Ga0495669_0054167 3300046684 Bacteria 1805
220 Ga0495676_0058344 3300047321 Bacteria 3037
221 Ga0495677_0187010 3300047445 Bacteria 803
222 Ga0495685_096768 3300047447 Bacteria 976
223 Ga0495686_0187587 3300047472 Bacteria 1194
224 Ga0495593_0136167 3300047673 Bacteria 1245
225 Ga0495615_0017738 3300048090 Bacteria 1556
226 Ga0496100_0808992 3300048903 Bacteria 734
227 Ga0496102_0187266 3300048905 Bacteria 1951
228 Ga0496102_0323074 3300048905 Bacteria 1454
229 Ga0496104_0151980 3300048907 Bacteria 2222
230 Ga0496106_0017139 3300048909 Bacteria 5363
231 Ga0496106_0448719 3300048909 Bacteria 1036
232 Ga0496107_0916986 3300048910 Bacteria 638
233 Ga0496109_0316778 3300048912 Bacteria 1472
234 Ga0496109_0807500 3300048912 Bacteria 876
235 Ga0496109_1398729 3300048912 Bacteria 635
236 Ga0496110_1199924 3300048913 Bacteria 668
237 Ga0496112_0496377 3300048915 Bacteria 1156
238 Ga0496114_0203652 3300048917 Bacteria 1734
239 Ga0496115_0534995 3300048918 Bacteria 938
240 Ga0496118_0183341 3300048921 Bacteria 1262
241 Ga0496119_0098722 3300048922 Bacteria 1644
242 Ga0496121_0298895 3300048924 Bacteria 1093
243 Ga0496124_0296496 3300048927 Bacteria 1170
244 Ga0496125_0081591 3300048928 Bacteria 2470
245 Ga0496126_0166772 3300048929 Bacteria 1879
246 Ga0501033_0892141 3300049570 Bacteria 598
247 Ga0501033_1000800 3300049570 Bacteria 559
248 Ga0501034_0000374 3300049571 Bacteria 76280
249 Ga0501037_0766069 3300049573 Bacteria 639
250 Ga0501067_0547965 3300049583 Bacteria 648
251 Ga0501068_0331332 3300049584 Bacteria 977
252 Ga0501071_0651082 3300049587 Bacteria 811
253 Ga0501074_0627153 3300049590 Unclassified 760
254 Ga0501075_0026878 3300049591 Bacteria 4239
255 Ga0501076_0102645 3300049592 Bacteria 2306
256 Ga0501076_0222726 3300049592 Bacteria 1542
257 Ga0501076_0547963 3300049592 Bacteria 954
258 Ga0501076_1480012 3300049592 Bacteria 558
259 Ga0501077_0694082 3300049593 Unclassified 654
260 Ga0501080_1126849 3300049742 Bacteria 677
261 Ga0501081_0911591 3300049743 Bacteria 663
262 Ga0501083_0081366 3300049744 Bacteria 2147
263 Ga0501045_0209593 3300049824 Bacteria 1452
264 nmdc:mga03683_256571_c1 3300050489 Bacteria 813
265 nmdc:mga03683_482657_c1 3300050489 Bacteria 599
266 nmdc:mga03683_85100_c1 3300050489 Bacteria 603
267 nmdc:mga03n38_125827_c1 3300050490 Bacteria 1265
268 nmdc:mga00v17_583158_c1 3300050491 Bacteria 722
269 nmdc:mga00v17_81577_c1 3300050491 Bacteria 2020
270 nmdc:mga0yw44_21485_c1 3300050492 Bacteria 3601
271 nmdc:mga0yw44_400596_c1 3300050492 Bacteria 928
272 nmdc:mga0yw44_52170_c1 3300050492 Bacteria 2479
273 nmdc:mga0yw44_589688_c1 3300050492 Bacteria 755
274 nmdc:mga0k408_662892_c1 3300050493 Bacteria 613
275 nmdc:mga0k408_739690_c1 3300050493 Bacteria 575
276 nmdc:mga07m45_187981_c1 3300050496 Bacteria 1201
277 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
278 nmdc:mga05p37_311_c1 3300050507 Bacteria 51481
279 nmdc:mga05p37_590415_c1 3300050507 Bacteria 1256
280 nmdc:mga05p37_6624_c1 3300050507 Bacteria 13657
281 nmdc:mga09592_10686_c1 3300050508 Bacteria 7472
282 nmdc:mga09592_127594_c1 3300050508 Bacteria 2187
283 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
284 nmdc:mga0qj67_153561_c1 3300050509 Bacteria 1868
285 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
286 nmdc:mga0qj67_297362_c1 3300050509 Bacteria 1308
287 nmdc:mga0qj67_406988_c1 3300050509 Bacteria 1098
288 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
289 nmdc:mga06r32_372583_c1 3300050510 Bacteria 1411
290 nmdc:mga06r32_653_c1 3300050510 Bacteria 30286
291 nmdc:mga08y16_165_c1 3300050511 Bacteria 57478
292 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
293 nmdc:mga08y16_392387_c1 3300050511 Bacteria 1422
294 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
295 nmdc:mga0rr50_7115_c1 3300050513 Bacteria 6872
296 nmdc:mga08x19_114694_c1 3300050514 Bacteria 1800
297 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
298 nmdc:mga0sz30_249704_c1 3300050516 Bacteria 790
299 Ga0495619_0842978 3300053085 Bacteria 619
300 Ga0500583_0170856 3300053092 Bacteria 1082
301 Ga0500594_0042133 3300053118 Bacteria 1254
302 Ga0500658_0542266 3300053134 Bacteria 524
303 Ga0500588_0040449 3300053146 Bacteria 1402
304 Ga0500634_0050705 3300053161 Bacteria 2235
305 Ga0500645_142865 3300053730 Bacteria 662
306 Ga0501084_0239108 3300054114 Bacteria 1533
307 Ga0501082_0917948 3300060353 Bacteria 766
308 Ga0530510_0106610 3300061734 Bacteria 2051
309 Ga0530510_0794699 3300061734 Bacteria 722
310 2644746702 2643221736 Bacteria 6608466
311 2793081139
312 2829749658 2829745981 Bacteria 5406054
313 2841762661 2841760612 Bacteria 6454112
314 2844110331 2844104063 Bacteria 6440972
315 2851187103 2851182111 Bacteria 6047226
316 2851251993 2851246043 Bacteria 6439203
317 2876811869 2876808645 Bacteria 8824342
318 2879118727 2879110137 Bacteria 8907982
319 2889039121 2889033259 Bacteria 9099371
320 2922362190 2922361189 Bacteria 7436256
321 2922388062 2922386360 Bacteria 7017218
322 8056676455 8056673599 Bacteria 7871253
323 8057535283 8057529695 Bacteria 6306553
324 Ga0075428_100003200
325 JGI25151J46595_10079534
326 JGI25153J46596_10001062
327 rootH2_10170455
328 rootH1_10285701
329 Ga0065165_1000046
330 Ga0070677_10023729
331 Ga0068869_100050995
332 Ga0068868_100170117
333 Ga0068868_101082762
334 Ga0070687_100706670
335 Ga0070661_100158550
336 Ga0070668_100736747
337 Ga0070675_100961351
338 Ga0070671_100328443
339 Ga0070674_100638391
340 Ga0070688_100567734
341 Ga0070667_100440413
342 Ga0070663_100009362
343 Ga0070663_100455118
344 Ga0070678_100898232
345 Ga0070685_10866903
346 Ga0070698_100081500
347 Ga0070684_101190385
348 Ga0070672_101146308
349 Ga0070672_101958032
350 Ga0070665_100707542
351 Ga0070665_100954991
352 Ga0070664_102148506
353 Ga0070702_100738312
354 Ga0068859_100262811
355 Ga0068859_100811941
356 Ga0068870_10830653
357 Ga0068863_100402720
358 Ga0068858_100284211
359 Ga0068858_102520941
360 Ga0068860_100104330
361 Ga0081455_10082984
362 Ga0081538_10050360
363 Ga0081538_10351310
364 Ga0081540_1018628
365 Ga0081539_10042340
366 Ga0075365_10215141
367 Ga0075365_10326158
368 Ga0075365_10941197
369 Ga0075363_100019588
370 Ga0075364_10557619
371 Ga0075364_10597844
372 Ga0075362_10068697
373 Ga0075362_10137554
374 Ga0075367_10668109
375 Ga0075369_10294896
376 Ga0075369_10392123
377 Ga0075366_10711638
378 Ga0075370_10166552
379 Ga0075428_100063104
380 Ga0075428_100155141
381 Ga0075428_100832210
382 Ga0075428_101542065
383 Ga0075430_100045742
384 Ga0075430_100095267
385 Ga0075430_100371575
386 Ga0075431_100000003
387 Ga0075431_100087493
388 Ga0075431_100182947
389 Ga0075431_100447917
390 Ga0075429_100012151
391 Ga0075429_100127840
392 Ga0075429_101025964
393 Ga0097620_100262817
394 Ga0097620_100811961
395 Ga0105250_10090692
396 Ga0111539_10000504
397 Ga0111539_10835140
398 Ga0105247_10331107
399 Ga0105247_11828764
400 Ga0114129_10000062
401 Ga0114129_10012887
402 Ga0114129_10475928
403 Ga0114129_11138069
404 Ga0114129_11407798
405 Ga0105243_11944297
406 Ga0105248_10578732
407 Ga0105248_10789704
408 Ga0105249_10757184
409 Ga0105249_11766300
410 Ga0105249_12149479
411 Ga0105239_12790448
412 Ga0157374_11633521
413 Ga0163162_10759509
414 Ga0163162_11283080
415 Ga0163162_12092259
416 Ga0157375_10677323
417 Ga0163163_11846625
418 Ga0163163_12928474
419 Ga0157379_10385901
420 Ga0157376_10961799
421 Ga0182007_10208664
422 Ga0209130_1000703
423 Ga0209025_1002592
424 Ga0209758_1005146
425 Ga0207426_1072899
426 Ga0207710_10072175
427 Ga0207645_10190344
428 Ga0207705_10177096
429 Ga0207649_10106760
430 Ga0207650_10338054
431 Ga0207650_10402298
432 Ga0207644_10285640
433 Ga0207709_11604096
434 Ga0207704_10748287
435 Ga0207691_10261900
436 Ga0207691_11044516
437 Ga0207691_11689144
438 Ga0207689_10007547
439 Ga0207679_11776876
440 Ga0207667_10421331
441 Ga0207668_10467744
442 Ga0207668_10958467
443 Ga0207640_11948681
444 Ga0207658_11864468
445 Ga0207703_10774279
446 Ga0207703_11333062
447 Ga0207639_10493511
448 Ga0207678_10033249
449 Ga0207678_10196725
450 Ga0207641_10204038
451 Ga0207676_12327139
452 Ga0207683_10065313
453 Ga0207683_10892444
454 Ga0207428_10004077
455 Ga0268266_10000827
456 Ga0268266_10066869
457 Ga0268266_10122571
458 Ga0268266_10981739
459 Ga0268266_11969921
460 Ga0268264_10615970
461 Ga0307515_10864995
462 Ga0307512_10345841
463 Ga0307513_10370770
464 Ga0307513_10455003
465 Ga0307513_10557086
466 Ga0307408_101146971
467 Ga0307408_101186743
468 Ga0307408_102341856
469 Ga0307405_10049251
470 Ga0307405_10127917
471 Ga0307405_11459206
472 Ga0307413_10058820
473 Ga0307413_10062930
474 Ga0307413_11956121
475 Ga0307410_10229441
476 Ga0307410_10239566
477 Ga0307410_11189705
478 Ga0307406_10049130
479 Ga0307407_10092900
480 Ga0307407_10108503
481 Ga0307407_10788371
482 Ga0307409_100047659
483 Ga0307416_100483025
484 Ga0307416_100977586
485 Ga0307414_10511971
486 Ga0307411_10100468
487 Ga0307415_100287021
488 Ga0307415_101140520
489 Ga0373940_0260947
490 Ga0373952_0129480
491 Ga0373935_1263900
492 Ga0373927_0329514
493 Ga0237819_26748
494 Ga0439465_0379707
495 Ga0451791_1462769
496 Ga0451795_1341459
497 Ga0451798_0270381
498 Ga0451802_0142015
499 Ga0451807_2668894
500 Ga0451837_0270499
501 Ga0451837_0523816
502 Ga0451849_1143594
503 Ga0451855_0820861
504 Ga0451853_0150707
505 Ga0439455_0079198
506 Ga0439464_0069860
507 Ga0495617_114001
508 Ga0495603_0006264
509 Ga0495590_0029282
510 Ga0495590_0105471
511 Ga0495629_0323338
512 Ga0495638_0048277
513 Ga0495580_0247871
514 Ga0495605_0202956
515 Ga0495605_0316462
516 Ga0495605_0323220
517 Ga0495605_0400189
518 Ga0495585_0311605
519 Ga0495607_0342775
520 Ga0495610_0285637
521 Ga0495616_0374483
522 Ga0495632_0347291
523 Ga0495632_0449085
524 Ga0495648_0298486
525 Ga0495663_0106483
526 Ga0495598_0030493
527 Ga0495621_0018800
528 Ga0495621_0089528
529 Ga0495633_0088375
530 Ga0495656_0041092
531 Ga0495656_0395477
532 Ga0495656_0407458
533 Ga0495668_0172907
534 Ga0495611_0090456
535 Ga0495611_0249116
536 Ga0495625_0103431
537 Ga0495625_0809619
538 Ga0495659_0009063
539 Ga0495659_0117666
540 Ga0495661_0350071
541 Ga0495588_0102617
542 Ga0495669_0054167
543 Ga0495676_0058344
544 Ga0495677_0187010
545 Ga0495685_096768
546 Ga0495686_0187587
547 Ga0495593_0136167
548 Ga0495615_0017738
549 Ga0496100_0808992
550 Ga0496102_0187266
551 Ga0496102_0323074
552 Ga0496104_0151980
553 Ga0496106_0017139
554 Ga0496106_0448719
555 Ga0496107_0916986
556 Ga0496109_0316778
557 Ga0496109_0807500
558 Ga0496109_1398729
559 Ga0496110_1199924
560 Ga0496112_0496377
561 Ga0496114_0203652
562 Ga0496115_0534995
563 Ga0496118_0183341
564 Ga0496119_0098722
565 Ga0496121_0298895
566 Ga0496124_0296496
567 Ga0496125_0081591
568 Ga0496126_0166772
569 Ga0501033_0892141
570 Ga0501033_1000800
571 Ga0501034_0000374
572 Ga0501037_0766069
573 Ga0501067_0547965
574 Ga0501068_0331332
575 Ga0501071_0651082
576 Ga0501074_0627153
577 Ga0501075_0026878
578 Ga0501076_0102645
579 Ga0501076_0222726
580 Ga0501076_0547963
581 Ga0501076_1480012
582 Ga0501077_0694082
583 Ga0501080_1126849
584 Ga0501081_0911591
585 Ga0501083_0081366
586 Ga0501045_0209593
587 nmdc:mga03683_256571_c1
588 nmdc:mga03683_482657_c1
589 nmdc:mga03683_85100_c1
590 nmdc:mga03n38_125827_c1
591 nmdc:mga00v17_583158_c1
592 nmdc:mga00v17_81577_c1
593 nmdc:mga0yw44_21485_c1
594 nmdc:mga0yw44_400596_c1
595 nmdc:mga0yw44_52170_c1
596 nmdc:mga0yw44_589688_c1
597 nmdc:mga0k408_662892_c1
598 nmdc:mga0k408_739690_c1
599 nmdc:mga07m45_187981_c1
600 nmdc:mga05p37_19_c2
601 nmdc:mga05p37_311_c1
602 nmdc:mga05p37_590415_c1
603 nmdc:mga05p37_6624_c1
604 nmdc:mga09592_10686_c1
605 nmdc:mga09592_127594_c1
606 nmdc:mga09592_238_c1
607 nmdc:mga0qj67_153561_c1
608 nmdc:mga0qj67_259_c1
609 nmdc:mga0qj67_297362_c1
610 nmdc:mga0qj67_406988_c1
611 nmdc:mga06r32_2023_c1
612 nmdc:mga06r32_372583_c1
613 nmdc:mga06r32_653_c1
614 nmdc:mga08y16_165_c1
615 nmdc:mga08y16_2735_c1
616 nmdc:mga08y16_392387_c1
617 nmdc:mga0n895_394_c1
618 nmdc:mga0rr50_7115_c1
619 nmdc:mga08x19_114694_c1
620 nmdc:mga0a205_249_c1
621 nmdc:mga0sz30_249704_c1
622 Ga0495619_0842978
623 Ga0500583_0170856
624 Ga0500594_0042133
625 Ga0500658_0542266
626 Ga0500588_0040449
627 Ga0500634_0050705
628 Ga0500645_142865
629 Ga0501084_0239108
630 Ga0501082_0917948
631 Ga0530510_0106610
632 Ga0530510_0794699
633 2644746702
634 2793081139
635 2829749658
636 2841762661
637 2844110331
638 2851187103
639 2851251993
640 2876811869
641 2879118727
642 2889039121
643 2922362190
644 2922388062
645 8056676455
646 8057535283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fwt-assembly1.cif.gz_A crystal structure of dhc purified from rhodobacter sphaeroides 0.6744 48 107
5zh2-assembly1.cif.gz_B crystal structure of pfkrs with inhibitor clado-5 0.5243 75 105
1fwh-assembly1.cif.gz_C klebsiella aerogenes urease, c319y variant 0.5232 64 97
6kbf-assembly1.cif.gz_B crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 3 0.5203 75 105
4pg3-assembly2.cif.gz_D crystal structure of krs complexed with inhibitor 0.5197 75 105
ID Description Score Start End Superfamily
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.784 44 105 1.10.760.10
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7641 44 105 1.10.760.10
af_M0RC90_138_201_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6505 69 108 1.10.238.10
3f2dA05 Special;Helix non-globular;Insulin-like, subunit E; 0.6456 69 109 6.10.50.10
af_Q9NWM8_138_211_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5468 69 118 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A0M0I3H4-F1-model_v4 Cytochrome C 0.9451 40 106 GO:0009055
GO:0020037
GO:0046872
AF-A0A6M1R8W9-F1-model_v4 C-type cytochrome 0.9451 41 106 GO:0009055
GO:0020037
GO:0046872
AF-A0A090BUK6-F1-model_v4 Quinohemoprotein amine dehydrogenase alpha subunit haem binding domain-containing protein 0.9232 46 107 GO:0009055
GO:0020037
AF-A0A853I418-F1-model_v4 C-type cytochrome 0.919 37 106 GO:0009055
GO:0020037
GO:0046872
AF-A0A2Z3GC97-F1-model_v4 deleted 0.9061 41 109

Map