F406678

General Info

Members Datasets Scaffolds Average Seq Length
322 256 303 179

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_045770|Ga0500586_045770_153_794
Length 213
Sequence LSGERPASVPWITATIGSLPQWIPAATRMLXSXTPEPAAAPQNPSVRPPIKRPTARFMLSHPAHCIALGFGSGLSPIAPGTAGTLWAWLAYIVLQSRLDTAQIGWVILGSFFVGWWACTVCAKNMRVADPGAIVWDEVIAFWLVLWLVMPAGFWAQLVAFVLFRVFDAVKPGPVAWADQAFKGFNARGGFGIIFDDLVAAFCTLFVIAVWRFW

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221717 Acidovorax sp. Root267 Isolate Unclassified
6 2738543012 Acidovorax sp. CF301 Isolate Unclassified
7 2816332133 Acidovorax radicis 2721A Isolate Unclassified
8 2818991450 Burkholderia sp. 604 Isolate Unclassified
9 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
10 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
11 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
12 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
13 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
14 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
15 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
16 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
17 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
166 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
167 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
168 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
173 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
174 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
175 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
176 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
177 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
178 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
179 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
256 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.1
Metatranscriptomes 0
Isolates 5.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.09
Nodule 0.62
Rhizoplane 2.17
Rhizosphere 58.39
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019224 3300001989 Bacteria 2448
2 JGI24735J21928_10016550 3300002067 Bacteria 2286
3 JGI25156J39149_1000024 3300002705 Bacteria 141748
4 JGI25156J39149_1001737 3300002705 Bacteria 8730
5 JGI25156J39149_1003156 3300002705 Bacteria 5548
6 JGI25154J39366_1000043 3300002738 Bacteria 142417
7 JGI25157J39369_1000031 3300002741 Bacteria 141953
8 JGI25150J39212_1008390 3300002774 Bacteria 2024
9 JGI25159J45721_1000583 3300002987 Bacteria 16414
10 JGI25159J45721_1003958 3300002987 Bacteria 5055
11 JGI25151J46595_10023217 3300003187 Bacteria 2560
12 JGI25151J46595_10041822 3300003187 Bacteria 1659
13 JGI25151J46595_10080871 3300003187 Bacteria 941
14 JGI25165J46597_1001563 3300003214 Bacteria 11303
15 JGI25160J50197_1000276 3300003354 Bacteria 37602
16 JGI25161J50226_1000021 3300003374 Bacteria 163584
17 Ga0055533_1000322 3300003756 Bacteria 21867
18 Ga0055532_1000147 3300003758 Bacteria 68782
19 Ga0055527_1000093 3300003760 Bacteria 68782
20 Ga0055535_1000094 3300003761 Bacteria 97073
21 Ga0055542_1000131 3300003762 Bacteria 97073
22 Ga0055529_1000238 3300003763 Bacteria 68782
23 Ga0055526_1023556 3300003771 Bacteria 2050
24 Ga0055526_1055426 3300003771 Bacteria 875
25 Ga0055537_1000418 3300003773 Bacteria 27742
26 Ga0055537_1000444 3300003773 Bacteria 26376
27 Ga0055524_1000039 3300003775 Bacteria 159897
28 Ga0055534_1000417 3300003784 Bacteria 25632
29 Ga0055528_1001025 3300003790 Bacteria 18500
30 Ga0055530_10000457 3300003791 Bacteria 36104
31 Ga0055530_10035129 3300003791 Bacteria 1274
32 Ga0055530_10075827 3300003791 Bacteria 716
33 Ga0055540_1000047 3300003792 Bacteria 146914
34 Ga0055531_10000433 3300003794 Bacteria 39688
35 Ga0055543_1001013 3300004625 Bacteria 12503
36 Ga0065165_1005063 3300005262 Bacteria 7672
37 Ga0065165_1013878 3300005262 Bacteria 3166
38 Ga0065165_1013935 3300005262 Bacteria 3153
39 Ga0070658_10976417 3300005327 Bacteria 737
40 Ga0070683_100585004 3300005329 Bacteria 1068
41 Ga0070670_100209311 3300005331 Bacteria 1695
42 Ga0070677_10043615 3300005333 Bacteria 1782
43 Ga0070666_10231243 3300005335 Bacteria 1306
44 Ga0070660_100890147 3300005339 Bacteria 750
45 Ga0070661_100168211 3300005344 Bacteria 1664
46 Ga0070661_100324865 3300005344 Bacteria 1202
47 Ga0070671_100083904 3300005355 Bacteria 2664
48 Ga0070674_100352856 3300005356 Bacteria 1189
49 Ga0070659_100096695 3300005366 Bacteria 2372
50 Ga0070667_100487579 3300005367 Bacteria 1129
51 Ga0070663_100000177 3300005455 Bacteria 32482
52 Ga0070662_100295796 3300005457 Bacteria 1314
53 Ga0068867_100000279 3300005459 Bacteria 33713
54 Ga0070698_100128274 3300005471 Bacteria 2493
55 Ga0068853_100544128 3300005539 Bacteria 1099
56 Ga0070672_100098047 3300005543 Bacteria 2373
57 Ga0070693_100100065 3300005547 Bacteria 1765
58 Ga0070664_100083264 3300005564 Bacteria 2760
59 Ga0070664_100086514 3300005564 Bacteria 2708
60 Ga0070664_100364362 3300005564 Bacteria 1317
61 Ga0068857_101656017 3300005577 Bacteria 625
62 Ga0068864_100479385 3300005618 Bacteria 1194
63 Ga0068861_100532847 3300005719 Bacteria 1067
64 Ga0075364_10010307 3300006051 Bacteria 5641
65 Ga0097621_100351628 3300006237 Bacteria 1311
66 Ga0068865_100771598 3300006881 Bacteria 827
67 Ga0105251_10000756 3300009011 Bacteria 29516
68 Ga0105250_10000479 3300009092 Bacteria 28089
69 Ga0105243_10000513 3300009148 Bacteria 39564
70 Ga0105243_10001721 3300009148 Bacteria 18834
71 Ga0105243_10004102 3300009148 Bacteria 11584
72 Ga0105243_10671791 3300009148 Bacteria 1006
73 Ga0105242_11039434 3300009176 Bacteria 829
74 Ga0105248_10296069 3300009177 Bacteria 1822
75 Ga0105239_11753707 3300010375 Bacteria 719
76 Ga0105246_10251771 3300011119 Bacteria 1402
77 Ga0163162_10457077 3300013306 Bacteria 1409
78 Ga0163163_11380956 3300014325 Bacteria 766
79 Ga0182008_10369029 3300014497 Bacteria 765
80 Ga0157377_10000006 3300014745 Bacteria 419853
81 Ga0157379_10248987 3300014968 Bacteria 1613
82 Ga0182007_10000740 3300015262 Bacteria 18468
83 Ga0213872_10000191 3300021361 Bacteria 54643
84 Ga0209435_100008 3300025206 Bacteria 503644
85 Ga0209436_105218 3300025208 Bacteria 3025
86 Ga0209566_111628 3300025225 Bacteria 857
87 Ga0209674_100013 3300025226 Bacteria 813140
88 Ga0209672_100010 3300025228 Bacteria 873151
89 Ga0209147_100006 3300025229 Bacteria 873276
90 Ga0209563_100906 3300025230 Bacteria 8756
91 Ga0209258_100010 3300025242 Bacteria 873276
92 Ga0207425_1001141 3300025245 Bacteria 11958
93 Ga0207425_1004892 3300025245 Bacteria 3921
94 Ga0209646_1000079 3300025246 Bacteria 207677
95 Ga0209026_1000067 3300025250 Bacteria 207677
96 Ga0209148_1000189 3300025254 Bacteria 116838
97 Ga0209759_1000056 3300025256 Bacteria 207677
98 Ga0209759_1000192 3300025256 Bacteria 97685
99 Ga0209759_1000406 3300025256 Bacteria 53034
100 Ga0209129_1022449 3300025258 Bacteria 1140
101 Ga0209233_1000244 3300025261 Bacteria 90133
102 Ga0209565_1000080 3300025263 Bacteria 156999
103 Ga0209565_1002434 3300025263 Bacteria 6717
104 Ga0209455_1000162 3300025272 Bacteria 116963
105 Ga0209673_1000088 3300025273 Bacteria 204629
106 Ga0209130_1000103 3300025284 Bacteria 137115
107 Ga0209130_1000238 3300025284 Bacteria 70723
108 Ga0209675_1000209 3300025291 Bacteria 61674
109 Ga0209675_1000888 3300025291 Bacteria 19234
110 Ga0209676_1000073 3300025292 Bacteria 305947
111 Ga0209025_1000415 3300025294 Bacteria 85512
112 Ga0209025_1001659 3300025294 Bacteria 27402
113 Ga0209025_1003871 3300025294 Bacteria 13550
114 Ga0209025_1012906 3300025294 Bacteria 5308
115 Ga0209025_1013190 3300025294 Bacteria 5217
116 Ga0209564_1001646 3300025295 Bacteria 21553
117 Ga0209564_1003481 3300025295 Bacteria 10728
118 Ga0209564_1005469 3300025295 Bacteria 7240
119 Ga0209050_1000008 3300025298 Bacteria 1144179
120 Ga0209050_1004740 3300025298 Bacteria 8991
121 Ga0209050_1030414 3300025298 Bacteria 1705
122 Ga0209256_1000096 3300025299 Bacteria 204629
123 Ga0209256_1031644 3300025299 Bacteria 1444
124 Ga0207426_1000731 3300025302 Bacteria 37628
125 Ga0207426_1001996 3300025302 Bacteria 14430
126 Ga0209051_1000005 3300025303 Bacteria 1142353
127 Ga0209257_1000031 3300025304 Bacteria 688770
128 Ga0207656_10204610 3300025321 Bacteria 954
129 Ga0207696_1000661 3300025711 Bacteria 24577
130 Ga0207713_1000041 3300025735 Bacteria 244768
131 Ga0207682_10045541 3300025893 Bacteria 1801
132 Ga0207680_10163836 3300025903 Bacteria 1493
133 Ga0207647_10008831 3300025904 Bacteria 7192
134 Ga0207705_10137699 3300025909 Bacteria 1821
135 Ga0207684_10189706 3300025910 Bacteria 1773
136 Ga0207649_10295330 3300025920 Bacteria 1183
137 Ga0207646_10194425 3300025922 Bacteria 1832
138 Ga0207650_10612549 3300025925 Bacteria 916
139 Ga0207650_10655242 3300025925 Bacteria 885
140 Ga0207644_10208179 3300025931 Bacteria 1545
141 Ga0207690_10321549 3300025932 Bacteria 1216
142 Ga0207709_10000398 3300025935 Bacteria 42657
143 Ga0207709_10651819 3300025935 Bacteria 838
144 Ga0207669_10099782 3300025937 Bacteria 1916
145 Ga0207704_10659023 3300025938 Bacteria 863
146 Ga0207691_10084603 3300025940 Bacteria 2847
147 Ga0207711_10671633 3300025941 Bacteria 966
148 Ga0207679_10001217 3300025945 Bacteria 16366
149 Ga0207679_10112039 3300025945 Bacteria 2155
150 Ga0207679_10134248 3300025945 Bacteria 1990
151 Ga0207651_10125381 3300025960 Bacteria 1956
152 Ga0207651_10136405 3300025960 Bacteria 1888
153 Ga0207658_10110620 3300025986 Bacteria 2171
154 Ga0207658_10491474 3300025986 Bacteria 1092
155 Ga0207677_10857133 3300026023 Bacteria 817
156 Ga0207639_10874577 3300026041 Bacteria 839
157 Ga0207678_10000060 3300026067 Bacteria 85708
158 Ga0207702_10730074 3300026078 Bacteria 977
159 Ga0207648_10000873 3300026089 Bacteria 33984
160 Ga0207698_10724016 3300026142 Bacteria 992
161 Ga0209281_1000002 3300027111 Bacteria 1924012
162 Ga0209974_10007492 3300027876 Bacteria 3758
163 Ga0307515_10174964 3300028794 Bacteria 2121
164 Ga0316177_1009730 3300030731 Bacteria 1302
165 Ga0316183_1080347 3300030742 Bacteria 1990
166 Ga0307513_10000256 3300031456 Bacteria 76296
167 Ga0307513_10001864 3300031456 Bacteria 29946
168 Ga0307408_100014879 3300031548 Bacteria 5174
169 Ga0307408_100019603 3300031548 Bacteria 4555
170 Ga0307514_10041670 3300031649 Bacteria 3614
171 Ga0307514_10221170 3300031649 Bacteria 1161
172 Ga0307516_10009359 3300031730 Bacteria 10932
173 Ga0307410_10640081 3300031852 Bacteria 891
174 Ga0307406_10000837 3300031901 Bacteria 17272
175 Ga0307406_10007263 3300031901 Bacteria 6136
176 Ga0307412_10247152 3300031911 Bacteria 1383
177 Ga0373956_0299016 3300035119 Bacteria 767
178 Ga0395899_0016372 3300037312 Bacteria 5650
179 Ga0395900_0102595 3300037418 Bacteria 2938
180 Ga0395898_0015142 3300037466 Bacteria 7916
181 Ga0395905_0001925 3300037471 Bacteria 23836
182 Ga0395901_0065244 3300038443 Bacteria 3790
183 Ga0436361_0063474 3300039447 Bacteria 40373
184 Ga0436361_0788745 3300039447 Bacteria 34906
185 Ga0439436_0017736 3300041404 Bacteria 2130
186 Ga0439466_0005289 3300041411 Bacteria 4938
187 Ga0439465_0009654 3300041413 Bacteria 3040
188 Ga0451789_1195632 3300041443 Bacteria 658
189 Ga0451797_1288428 3300041453 Bacteria 616
190 Ga0451795_1662861 3300041456 Bacteria 932
191 Ga0439445_0007198 3300042004 Bacteria 2576
192 Ga0450911_000311 3300042115 Bacteria 17566
193 Ga0450919_010561 3300042121 Bacteria 1053
194 Ga0450920_002630 3300042122 Bacteria 3070
195 Ga0450921_000138 3300042123 Bacteria 2569
196 Ga0450923_014213 3300042125 Bacteria 1475
197 Ga0450890_045873 3300042127 Bacteria 657
198 Ga0450898_001598 3300042134 Bacteria 3029
199 Ga0450899_016861 3300042135 Bacteria 839
200 Ga0450900_018127 3300042136 Bacteria 964
201 Ga0450902_017583 3300042137 Bacteria 1169
202 Ga0450906_001760 3300042145 Bacteria 4743
203 Ga0450907_011227 3300042146 Bacteria 1488
204 Ga0450910_005482 3300042147 Bacteria 1731
205 Ga0450908_003166 3300042184 Bacteria 3203
206 Ga0450909_002838 3300042185 Bacteria 2462
207 Ga0439434_0003281 3300042435 Bacteria 4751
208 Ga0450918_002019 3300042531 Bacteria 3890
209 Ga0450893_0006706 3300042532 Bacteria 1865
210 Ga0466969_0002495 3300044656 Bacteria 9827
211 Ga0466966_0042023 3300044684 Bacteria 2936
212 Ga0466961_0045725 3300044693 Bacteria 2800
213 Ga0453684_0073747 3300044712 Bacteria 4301
214 Ga0466970_0030097 3300044765 Bacteria 2862
215 Ga0466959_0252980 3300045049 Bacteria 1215
216 Ga0466959_0339184 3300045049 Bacteria 1025
217 Ga0451576_0424944 3300045051 Bacteria 1394
218 Ga0495592_0023582 3300046454 Bacteria 4681
219 Ga0495629_0037839 3300046459 Bacteria 3400
220 Ga0495641_0065945 3300046461 Bacteria 1629
221 Ga0495653_0115560 3300046463 Bacteria 1920
222 Ga0495650_0007605 3300046471 Bacteria 6473
223 Ga0495650_0023444 3300046471 Bacteria 2938
224 Ga0495650_0047206 3300046471 Bacteria 1802
225 Ga0495580_0051615 3300046472 Bacteria 2907
226 Ga0495582_0059894 3300046473 Bacteria 2100
227 Ga0495664_0017316 3300046477 Bacteria 4117
228 Ga0495664_0601545 3300046477 Bacteria 653
229 Ga0495596_0120990 3300046500 Bacteria 1016
230 Ga0495608_0042382 3300046511 Bacteria 3044
231 Ga0495618_0010465 3300046514 Bacteria 5610
232 Ga0495620_0108252 3300046515 Bacteria 1103
233 Ga0495628_0018530 3300046516 Bacteria 5764
234 Ga0495628_0074468 3300046516 Bacteria 2644
235 Ga0495628_0203066 3300046516 Bacteria 1492
236 Ga0495630_0033189 3300046517 Bacteria 3849
237 Ga0495666_0022614 3300046526 Bacteria 3113
238 Ga0495652_0027876 3300046529 Bacteria 4974
239 Ga0495640_0002727 3300046533 Bacteria 14198
240 Ga0495586_0090272 3300046535 Bacteria 1692
241 Ga0495597_0061820 3300046542 Bacteria 1631
242 Ga0495645_0101383 3300046543 Bacteria 2047
243 Ga0495645_0114557 3300046543 Bacteria 1905
244 Ga0495633_0004749 3300046558 Bacteria 8529
245 Ga0495667_0061006 3300046559 Bacteria 2473
246 Ga0495634_0010412 3300046642 Bacteria 6814
247 Ga0495635_0097505 3300046663 Bacteria 2009
248 Ga0495588_0263234 3300046674 Bacteria 909
249 Ga0495623_0010546 3300046679 Bacteria 5978
250 Ga0495646_0042740 3300046680 Bacteria 2779
251 Ga0495624_0008013 3300046690 Bacteria 7400
252 Ga0495600_0060935 3300046809 Bacteria 2464
253 Ga0495660_0108828 3300046810 Bacteria 1416
254 Ga0495581_0003794 3300047315 Bacteria 8696
255 Ga0495604_0029157 3300047317 Bacteria 4390
256 Ga0495604_0161742 3300047317 Bacteria 1581
257 Ga0495604_0200609 3300047317 Bacteria 1384
258 Ga0495604_0265029 3300047317 Bacteria 1166
259 Ga0495604_0353175 3300047317 Bacteria 976
260 Ga0495674_0040898 3300047319 Bacteria 4143
261 Ga0495674_0057326 3300047319 Bacteria 3409
262 Ga0495674_0082560 3300047319 Bacteria 2755
263 Ga0495676_0025321 3300047321 Bacteria 5125
264 Ga0495676_0529856 3300047321 Bacteria 771
265 Ga0495680_0026925 3300047322 Bacteria 4732
266 Ga0495683_0113978 3300047323 Bacteria 1288
267 Ga0495675_0012892 3300047444 Bacteria 5266
268 Ga0495684_0292803 3300047471 Bacteria 1171
269 Ga0495593_0029384 3300047673 Bacteria 3013
270 Ga0495602_0056656 3300048088 Bacteria 3444
271 Ga0495602_0684121 3300048088 Bacteria 698
272 Ga0495614_0018013 3300048089 Bacteria 3061
273 Ga0496100_0196590 3300048903 Bacteria 1467
274 Ga0496101_0641207 3300048904 Bacteria 839
275 Ga0496114_0306916 3300048917 Bacteria 1401
276 Ga0496115_0372828 3300048918 Bacteria 1162
277 Ga0496116_0026979 3300048919 Bacteria 4188
278 Ga0496117_0048096 3300048920 Bacteria 3051
279 Ga0496118_0009234 3300048921 Bacteria 10015
280 Ga0496121_0038202 3300048924 Bacteria 4256
281 Ga0496121_0184992 3300048924 Bacteria 1499
282 Ga0496121_0449508 3300048924 Bacteria 831
283 Ga0496125_0011069 3300048928 Bacteria 9053
284 Ga0496125_0014241 3300048928 Bacteria 7752
285 Ga0496125_0017635 3300048928 Bacteria 6797
286 Ga0496126_0167075 3300048929 Bacteria 1877
287 Ga0496126_1101648 3300048929 Bacteria 590
288 Ga0501046_0602590 3300049580 Bacteria 779
289 Ga0501035_0225611 3300049822 Bacteria 1598
290 nmdc:mga03683_25805_c2 3300050489 Bacteria 1646
291 nmdc:mga0yw44_209390_c1 3300050492 Bacteria 1289
292 nmdc:mga0k408_562640_c1 3300050493 Bacteria 673
293 nmdc:mga07m45_461556_c1 3300050496 Bacteria 736
294 Ga0500578_0026110 3300053086 Bacteria 3749
295 Ga0500644_0002107 3300053088 Bacteria 5049
296 Ga0500644_0100705 3300053088 Bacteria 1097
297 Ga0500593_001588 3300053117 Bacteria 8179
298 Ga0500628_002110 3300053129 Bacteria 3332
299 Ga0500586_045770 3300053145 Bacteria 1498
300 Ga0500604_0150288 3300053151 Bacteria 790
301 Ga0500616_0250896 3300053153 Bacteria 756
302 Ga0500645_002194 3300053730 Bacteria 8924
303 Ga0500645_003150 3300053730 Bacteria 6864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042135 Ga0450899_016861 Ga0450899_016861_23_481 141
2 3300048929 Ga0496126_1101648 Ga0496126_1101648_73_540 151
3 3300046516 Ga0495628_0018530 Ga0495628_0018530_3867_4325 152
4 3300046543 Ga0495645_0101383 Ga0495645_0101383_690_1148 152
5 3300047317 Ga0495604_0200609 Ga0495604_0200609_869_1327 152
6 3300047317 Ga0495604_0353175 Ga0495604_0353175_351_809 152
7 3300047319 Ga0495674_0057326 Ga0495674_0057326_2534_2992 152
8 3300047321 Ga0495676_0529856 Ga0495676_0529856_15_473 152
9 3300048918 Ga0496115_0372828 Ga0496115_0372828_333_791 152
10 iso_pu_bacteria 2945972063 2945975114 160
11 3300002774 JGI25150J39212_1008390 JGI25150J39212_10083902 163
12 3300003187 JGI25151J46595_10023217 JGI25151J46595_100232173 163
13 3300003187 JGI25151J46595_10080871 JGI25151J46595_100808712 163
14 3300003773 Ga0055537_1000418 Ga0055537_100041827 163
15 3300003773 Ga0055537_1000444 Ga0055537_100044415 163
16 3300003775 Ga0055524_1000039 Ga0055524_1000039124 163
17 3300003784 Ga0055534_1000417 Ga0055534_100041714 163
18 3300003790 Ga0055528_1001025 Ga0055528_10010252 163
19 3300025245 Ga0207425_1001141 Ga0207425_100114113 163
20 3300025263 Ga0209565_1000080 Ga0209565_1000080119 163
21 3300025273 Ga0209673_1000088 Ga0209673_100008827 163
22 3300025291 Ga0209675_1000209 Ga0209675_100020914 163
23 3300025294 Ga0209025_1013190 Ga0209025_10131903 163
24 3300025295 Ga0209564_1003481 Ga0209564_10034818 163
25 3300025299 Ga0209256_1000096 Ga0209256_1000096180 163
26 3300002705 JGI25156J39149_1000024 JGI25156J39149_1000024101 164
27 3300002738 JGI25154J39366_1000043 JGI25154J39366_1000043102 164
28 3300002741 JGI25157J39369_1000031 JGI25157J39369_100003127 164
29 3300002987 JGI25159J45721_1000583 JGI25159J45721_100058316 164
30 3300002987 JGI25159J45721_1003958 JGI25159J45721_10039583 164
31 3300003354 JGI25160J50197_1000276 JGI25160J50197_100027616 164
32 3300003374 JGI25161J50226_1000021 JGI25161J50226_100002128 164
33 3300003771 Ga0055526_1023556 Ga0055526_10235562 164
34 3300003791 Ga0055530_10000457 Ga0055530_1000045723 164
35 3300003791 Ga0055530_10035129 Ga0055530_100351292 164
36 3300003792 Ga0055540_1000047 Ga0055540_1000047114 164
37 3300003794 Ga0055531_10000433 Ga0055531_1000043323 164
38 3300004625 Ga0055543_1001013 Ga0055543_10010136 164
39 3300005262 Ga0065165_1013935 Ga0065165_10139353 164
40 3300025206 Ga0209435_100008 Ga0209435_100008431 164
41 3300025208 Ga0209436_105218 Ga0209436_1052183 164
42 3300025246 Ga0209646_1000079 Ga0209646_1000079154 164
43 3300025250 Ga0209026_1000067 Ga0209026_1000067154 164
44 3300025256 Ga0209759_1000056 Ga0209759_1000056154 164
45 3300025284 Ga0209130_1000103 Ga0209130_1000103136 164
46 3300025284 Ga0209130_1000238 Ga0209130_100023864 164
47 3300025292 Ga0209676_1000073 Ga0209676_1000073137 164
48 3300025294 Ga0209025_1012906 Ga0209025_10129064 164
49 3300025295 Ga0209564_1001646 Ga0209564_100164620 164
50 3300025298 Ga0209050_1000008 Ga0209050_1000008926 164
51 3300025298 Ga0209050_1004740 Ga0209050_10047404 164
52 3300025299 Ga0209256_1031644 Ga0209256_10316442 164
53 3300025302 Ga0207426_1000731 Ga0207426_100073129 164
54 3300025302 Ga0207426_1001996 Ga0207426_100199615 164
55 3300025303 Ga0209051_1000005 Ga0209051_1000005926 164
56 3300025304 Ga0209257_1000031 Ga0209257_1000031516 164
57 3300031548 Ga0307408_100014879 Ga0307408_1000148792 164
58 3300031548 Ga0307408_100019603 Ga0307408_1000196036 164
59 3300031649 Ga0307514_10041670 Ga0307514_100416705 164
60 3300031649 Ga0307514_10221170 Ga0307514_102211702 164
61 3300031901 Ga0307406_10000837 Ga0307406_100008372 164
62 3300031901 Ga0307406_10007263 Ga0307406_100072632 164
63 3300031911 Ga0307412_10247152 Ga0307412_102471521 164
64 3300041404 Ga0439436_0017736 Ga0439436_0017736_770_1297 164
65 3300041411 Ga0439466_0005289 Ga0439466_0005289_1863_2390 164
66 3300041413 Ga0439465_0009654 Ga0439465_0009654_712_1239 164
67 3300042121 Ga0450919_010561 Ga0450919_010561_282_809 164
68 3300042122 Ga0450920_002630 Ga0450920_002630_919_1446 164
69 3300042123 Ga0450921_000138 Ga0450921_000138_1000_1527 164
70 3300042125 Ga0450923_014213 Ga0450923_014213_415_942 164
71 3300042134 Ga0450898_001598 Ga0450898_001598_1429_1956 164
72 3300042145 Ga0450906_001760 Ga0450906_001760_2278_2805 164
73 3300042146 Ga0450907_011227 Ga0450907_011227_28_555 164
74 3300042147 Ga0450910_005482 Ga0450910_005482_517_1044 164
75 3300042184 Ga0450908_003166 Ga0450908_003166_1603_2130 164
76 3300042185 Ga0450909_002838 Ga0450909_002838_314_841 164
77 3300042435 Ga0439434_0003281 Ga0439434_0003281_2501_3028 164
78 3300042531 Ga0450918_002019 Ga0450918_002019_2673_3200 164
79 3300042532 Ga0450893_0006706 Ga0450893_0006706_432_959 164
80 3300053088 Ga0500644_0100705 Ga0500644_0100705_307_825 164
81 3300053117 Ga0500593_001588 Ga0500593_001588_4437_4955 164
82 3300053129 Ga0500628_002110 Ga0500628_002110_2761_3279 164
83 3300053151 Ga0500604_0150288 Ga0500604_0150288_114_632 164
84 3300003771 Ga0055526_1055426 Ga0055526_10554261 165
85 3300003791 Ga0055530_10075827 Ga0055530_100758271 165
86 3300005262 Ga0065165_1005063 Ga0065165_10050636 165
87 3300005262 Ga0065165_1013878 Ga0065165_10138782 165
88 3300006051 Ga0075364_10010307 Ga0075364_100103073 165
89 3300006881 Ga0068865_100771598 Ga0068865_1007715982 165
90 3300025245 Ga0207425_1004892 Ga0207425_10048922 165
91 3300025258 Ga0209129_1022449 Ga0209129_10224492 165
92 3300025263 Ga0209565_1002434 Ga0209565_10024346 165
93 3300025291 Ga0209675_1000888 Ga0209675_100088811 165
94 3300025294 Ga0209025_1001659 Ga0209025_10016595 165
95 3300025294 Ga0209025_1003871 Ga0209025_10038717 165
96 3300025295 Ga0209564_1005469 Ga0209564_10054695 165
97 3300025298 Ga0209050_1030414 Ga0209050_10304142 165
98 3300025938 Ga0207704_10659023 Ga0207704_106590232 165
99 3300030731 Ga0316177_1009730 Ga0316177_10097302 165
100 3300050489 nmdc:mga03683_25805_c2 nmdc:mga03683_25805_c2_897_1418 165
101 3300050492 nmdc:mga0yw44_209390_c1 nmdc:mga0yw44_209390_c1_425_946 165
102 3300050496 nmdc:mga07m45_461556_c1 nmdc:mga07m45_461556_c1_165_689 165
103 3300021361 Ga0213872_10000191 Ga0213872_100001916 166
104 3300027876 Ga0209974_10007492 Ga0209974_100074922 166
105 3300039447 Ga0436361_0788745 Ga0436361_0788745_1241_1759 166
106 3300044656 Ga0466969_0002495 Ga0466969_0002495_8857_9402 166
107 3300044684 Ga0466966_0042023 Ga0466966_0042023_880_1425 166
108 3300044693 Ga0466961_0045725 Ga0466961_0045725_937_1482 166
109 3300044765 Ga0466970_0030097 Ga0466970_0030097_2122_2667 166
110 3300045049 Ga0466959_0339184 Ga0466959_0339184_385_930 166
111 3300049580 Ga0501046_0602590 Ga0501046_0602590_190_717 166
112 iso_pu_bacteria 2643221603 2644026876 166
113 3300031456 Ga0307513_10001864 Ga0307513_100018645 167
114 3300041443 Ga0451789_1195632 Ga0451789_1195632_95_622 167
115 3300050493 nmdc:mga0k408_562640_c1 nmdc:mga0k408_562640_c1_106_633 167
116 iso_pu_bacteria 2547132374 2548501466 167
117 iso_pu_bacteria 2643221717 2644648989 167
118 3300053086 Ga0500578_0026110 Ga0500578_0026110_1718_2278 168
119 3300053730 Ga0500645_002194 Ga0500645_002194_6239_6769 168
120 3300053730 Ga0500645_003150 Ga0500645_003150_1569_2129 168
121 3300005471 Ga0070698_100128274 Ga0070698_1001282742 169
122 3300025910 Ga0207684_10189706 Ga0207684_101897062 169
123 3300025922 Ga0207646_10194425 Ga0207646_101944253 169
124 3300030742 Ga0316183_1080347 Ga0316183_10803472 169
125 3300041456 Ga0451795_1662861 Ga0451795_1662861_34_570 169
126 3300048903 Ga0496100_0196590 Ga0496100_0196590_171_692 169
127 3300048904 Ga0496101_0641207 Ga0496101_0641207_141_662 169
128 iso_pu_bacteria 2954767861 2954770296 169
129 3300009148 Ga0105243_10671791 Ga0105243_106717912 170
130 3300014497 Ga0182008_10369029 Ga0182008_103690292 170
131 3300025935 Ga0207709_10651819 Ga0207709_106518192 170
132 3300031852 Ga0307410_10640081 Ga0307410_106400812 170
133 3300039447 Ga0436361_0063474 Ga0436361_0063474_10770_11321 170
134 3300005327 Ga0070658_10976417 Ga0070658_109764171 171
135 3300005455 Ga0070663_100000177 Ga0070663_1000001776 171
136 3300005459 Ga0068867_100000279 Ga0068867_10000027923 171
137 3300005539 Ga0068853_100544128 Ga0068853_1005441282 171
138 3300005577 Ga0068857_101656017 Ga0068857_1016560171 171
139 3300009148 Ga0105243_10000513 Ga0105243_100005136 171
140 3300014745 Ga0157377_10000006 Ga0157377_1000000653 171
141 3300025935 Ga0207709_10000398 Ga0207709_100003985 171
142 3300026041 Ga0207639_10874577 Ga0207639_108745772 171
143 3300026067 Ga0207678_10000060 Ga0207678_1000006015 171
144 3300026089 Ga0207648_10000873 Ga0207648_1000087325 171
145 3300045049 Ga0466959_0252980 Ga0466959_0252980_423_956 171
146 3300047317 Ga0495604_0265029 Ga0495604_0265029_207_752 171
147 iso_pu_bacteria 2643221611 2644074967 171
148 3300005339 Ga0070660_100890147 Ga0070660_1008901472 172
149 3300005344 Ga0070661_100324865 Ga0070661_1003248652 172
150 3300005564 Ga0070664_100083264 Ga0070664_1000832643 172
151 3300013306 Ga0163162_10457077 Ga0163162_104570772 172
152 3300025945 Ga0207679_10112039 Ga0207679_101120392 172
153 3300044712 Ga0453684_0073747 Ga0453684_0073747_2191_2742 172
154 3300048924 Ga0496121_0184992 Ga0496121_0184992_792_1334 172
155 3300048928 Ga0496125_0011069 Ga0496125_0011069_3184_3729 172
156 3300048929 Ga0496126_0167075 Ga0496126_0167075_438_983 172
157 3300053088 Ga0500644_0002107 Ga0500644_0002107_808_1449 172
158 iso_pu_bacteria 2643221609 2644061436 172
159 iso_pu_bacteria 2738543012 2739243133 172
160 iso_pu_bacteria 2816332133 2816473705 172
161 3300005329 Ga0070683_100585004 Ga0070683_1005850042 173
162 3300005331 Ga0070670_100209311 Ga0070670_1002093112 173
163 3300005333 Ga0070677_10043615 Ga0070677_100436152 173
164 3300005335 Ga0070666_10231243 Ga0070666_102312433 173
165 3300005344 Ga0070661_100168211 Ga0070661_1001682112 173
166 3300005355 Ga0070671_100083904 Ga0070671_1000839043 173
167 3300005356 Ga0070674_100352856 Ga0070674_1003528562 173
168 3300005366 Ga0070659_100096695 Ga0070659_1000966952 173
169 3300005457 Ga0070662_100295796 Ga0070662_1002957962 173
170 3300005543 Ga0070672_100098047 Ga0070672_1000980473 173
171 3300005547 Ga0070693_100100065 Ga0070693_1001000651 173
172 3300005564 Ga0070664_100086514 Ga0070664_1000865143 173
173 3300005564 Ga0070664_100364362 Ga0070664_1003643622 173
174 3300005618 Ga0068864_100479385 Ga0068864_1004793852 173
175 3300005719 Ga0068861_100532847 Ga0068861_1005328472 173
176 3300006237 Ga0097621_100351628 Ga0097621_1003516283 173
177 3300009176 Ga0105242_11039434 Ga0105242_110394341 173
178 3300009177 Ga0105248_10296069 Ga0105248_102960693 173
179 3300014325 Ga0163163_11380956 Ga0163163_113809562 173
180 3300014968 Ga0157379_10248987 Ga0157379_102489873 173
181 3300025321 Ga0207656_10204610 Ga0207656_102046102 173
182 3300025893 Ga0207682_10045541 Ga0207682_100455412 173
183 3300025903 Ga0207680_10163836 Ga0207680_101638363 173
184 3300025920 Ga0207649_10295330 Ga0207649_102953302 173
185 3300025925 Ga0207650_10612549 Ga0207650_106125492 173
186 3300025925 Ga0207650_10655242 Ga0207650_106552422 173
187 3300025931 Ga0207644_10208179 Ga0207644_102081792 173
188 3300025932 Ga0207690_10321549 Ga0207690_103215492 173
189 3300025937 Ga0207669_10099782 Ga0207669_100997822 173
190 3300025940 Ga0207691_10084603 Ga0207691_100846033 173
191 3300025941 Ga0207711_10671633 Ga0207711_106716332 173
192 3300025945 Ga0207679_10001217 Ga0207679_1000121716 173
193 3300025945 Ga0207679_10134248 Ga0207679_101342483 173
194 3300025960 Ga0207651_10125381 Ga0207651_101253813 173
195 3300025960 Ga0207651_10136405 Ga0207651_101364052 173
196 3300025986 Ga0207658_10491474 Ga0207658_104914741 173
197 3300026023 Ga0207677_10857133 Ga0207677_108571332 173
198 3300026078 Ga0207702_10730074 Ga0207702_107300742 173
199 3300026142 Ga0207698_10724016 Ga0207698_107240162 173
200 3300028794 Ga0307515_10174964 Ga0307515_101749643 173
201 3300031730 Ga0307516_10009359 Ga0307516_100093593 173
202 3300035119 Ga0373956_0299016 Ga0373956_0299016_178_729 173
203 3300037312 Ga0395899_0016372 Ga0395899_0016372_3695_4240 173
204 3300037418 Ga0395900_0102595 Ga0395900_0102595_1618_2163 173
205 3300037466 Ga0395898_0015142 Ga0395898_0015142_775_1320 173
206 3300037471 Ga0395905_0001925 Ga0395905_0001925_3222_3767 173
207 3300038443 Ga0395901_0065244 Ga0395901_0065244_1746_2291 173
208 3300041453 Ga0451797_1288428 Ga0451797_1288428_14_571 173
209 3300042004 Ga0439445_0007198 Ga0439445_0007198_1330_1878 173
210 3300042115 Ga0450911_000311 Ga0450911_000311_425_973 173
211 3300042127 Ga0450890_045873 Ga0450890_045873_71_619 173
212 3300042136 Ga0450900_018127 Ga0450900_018127_134_682 173
213 3300042137 Ga0450902_017583 Ga0450902_017583_468_1016 173
214 3300045051 Ga0451576_0424944 Ga0451576_0424944_220_771 173
215 3300046558 Ga0495633_0004749 Ga0495633_0004749_6742_7299 173
216 3300048917 Ga0496114_0306916 Ga0496114_0306916_715_1266 173
217 3300048924 Ga0496121_0038202 Ga0496121_0038202_3359_3907 173
218 3300048928 Ga0496125_0014241 Ga0496125_0014241_4094_4642 173
219 3300048928 Ga0496125_0017635 Ga0496125_0017635_1341_1889 173
220 3300053145 Ga0500586_045770 Ga0500586_045770_153_794 173
221 3300053153 Ga0500616_0250896 Ga0500616_0250896_59_616 173
222 iso_pu_bacteria 2904479285 2904482771 173
223 3300031456 Ga0307513_10000256 Ga0307513_100002568 174
224 3300003187 JGI25151J46595_10041822 JGI25151J46595_100418222 175
225 3300025294 Ga0209025_1000415 Ga0209025_100041567 175
226 3300046471 Ga0495650_0047206 Ga0495650_0047206_1058_1630 175
227 3300047319 Ga0495674_0082560 Ga0495674_0082560_1802_2374 175
228 3300048088 Ga0495602_0684121 Ga0495602_0684121_83_649 175
229 3300049822 Ga0501035_0225611 Ga0501035_0225611_462_1031 175
230 3300009148 Ga0105243_10001721 Ga0105243_100017213 176
231 3300002705 JGI25156J39149_1003156 JGI25156J39149_10031562 180
232 3300025256 Ga0209759_1000192 Ga0209759_100019233 180
233 iso_pu_bacteria 2818991450 2819623436 181
234 iso_pu_bacteria 2900634093 2900637304 181
235 iso_pu_bacteria 2904483920 2904487866 181
236 iso_pu_bacteria 2919527303 2919529170 181
237 iso_pu_bacteria 2928108538 2928113581 181
238 iso_pu_bacteria 2928135762 2928140706 181
239 iso_pu_bacteria 2928503688 2928506177 181
240 iso_pu_bacteria 642555113 642622974 181
241 iso_pu_bacteria 8055301274 8055308219 181
242 3300001989 JGI24739J22299_10019224 JGI24739J22299_100192242 185
243 3300002067 JGI24735J21928_10016550 JGI24735J21928_100165503 185
244 3300002705 JGI25156J39149_1001737 JGI25156J39149_10017379 185
245 3300003214 JGI25165J46597_1001563 JGI25165J46597_100156310 185
246 3300003756 Ga0055533_1000322 Ga0055533_10003223 185
247 3300003758 Ga0055532_1000147 Ga0055532_100014740 185
248 3300003760 Ga0055527_1000093 Ga0055527_100009340 185
249 3300003761 Ga0055535_1000094 Ga0055535_100009421 185
250 3300003762 Ga0055542_1000131 Ga0055542_100013121 185
251 3300003763 Ga0055529_1000238 Ga0055529_100023821 185
252 3300005367 Ga0070667_100487579 Ga0070667_1004875791 185
253 3300009011 Ga0105251_10000756 Ga0105251_1000075615 185
254 3300009092 Ga0105250_10000479 Ga0105250_1000047917 185
255 3300009148 Ga0105243_10004102 Ga0105243_100041028 185
256 3300010375 Ga0105239_11753707 Ga0105239_117537072 185
257 3300011119 Ga0105246_10251771 Ga0105246_102517712 185
258 3300015262 Ga0182007_10000740 Ga0182007_100007405 185
259 3300025225 Ga0209566_111628 Ga0209566_1116282 185
260 3300025226 Ga0209674_100013 Ga0209674_100013687 185
261 3300025228 Ga0209672_100010 Ga0209672_100010740 185
262 3300025229 Ga0209147_100006 Ga0209147_100006740 185
263 3300025230 Ga0209563_100906 Ga0209563_1009066 185
264 3300025242 Ga0209258_100010 Ga0209258_100010740 185
265 3300025254 Ga0209148_1000189 Ga0209148_100018921 185
266 3300025256 Ga0209759_1000406 Ga0209759_100040640 185
267 3300025261 Ga0209233_1000244 Ga0209233_100024464 185
268 3300025272 Ga0209455_1000162 Ga0209455_100016288 185
269 3300025711 Ga0207696_1000661 Ga0207696_100066116 185
270 3300025735 Ga0207713_1000041 Ga0207713_10000418 185
271 3300025904 Ga0207647_10008831 Ga0207647_100088317 185
272 3300025909 Ga0207705_10137699 Ga0207705_101376992 185
273 3300025986 Ga0207658_10110620 Ga0207658_101106203 185
274 3300027111 Ga0209281_1000002 Ga0209281_100000255 185
275 3300046454 Ga0495592_0023582 Ga0495592_0023582_2308_2865 185
276 3300046459 Ga0495629_0037839 Ga0495629_0037839_1246_1803 185
277 3300046461 Ga0495641_0065945 Ga0495641_0065945_400_957 185
278 3300046463 Ga0495653_0115560 Ga0495653_0115560_1317_1874 185
279 3300046471 Ga0495650_0007605 Ga0495650_0007605_3336_3908 185
280 3300046471 Ga0495650_0023444 Ga0495650_0023444_1629_2186 185
281 3300046472 Ga0495580_0051615 Ga0495580_0051615_161_718 185
282 3300046473 Ga0495582_0059894 Ga0495582_0059894_1486_2043 185
283 3300046477 Ga0495664_0017316 Ga0495664_0017316_1247_1804 185
284 3300046477 Ga0495664_0601545 Ga0495664_0601545_26_583 185
285 3300046500 Ga0495596_0120990 Ga0495596_0120990_94_651 185
286 3300046511 Ga0495608_0042382 Ga0495608_0042382_2039_2596 185
287 3300046514 Ga0495618_0010465 Ga0495618_0010465_5007_5564 185
288 3300046515 Ga0495620_0108252 Ga0495620_0108252_393_950 185
289 3300046516 Ga0495628_0074468 Ga0495628_0074468_583_1140 185
290 3300046516 Ga0495628_0203066 Ga0495628_0203066_129_686 185
291 3300046517 Ga0495630_0033189 Ga0495630_0033189_1374_1931 185
292 3300046526 Ga0495666_0022614 Ga0495666_0022614_1424_1981 185
293 3300046529 Ga0495652_0027876 Ga0495652_0027876_2000_2557 185
294 3300046533 Ga0495640_0002727 Ga0495640_0002727_1765_2322 185
295 3300046535 Ga0495586_0090272 Ga0495586_0090272_888_1445 185
296 3300046542 Ga0495597_0061820 Ga0495597_0061820_132_689 185
297 3300046543 Ga0495645_0114557 Ga0495645_0114557_77_634 185
298 3300046559 Ga0495667_0061006 Ga0495667_0061006_806_1363 185
299 3300046642 Ga0495634_0010412 Ga0495634_0010412_1260_1817 185
300 3300046663 Ga0495635_0097505 Ga0495635_0097505_1383_1940 185
301 3300046674 Ga0495588_0263234 Ga0495588_0263234_280_837 185
302 3300046679 Ga0495623_0010546 Ga0495623_0010546_1692_2249 185
303 3300046680 Ga0495646_0042740 Ga0495646_0042740_1577_2134 185
304 3300046690 Ga0495624_0008013 Ga0495624_0008013_2145_2702 185
305 3300046809 Ga0495600_0060935 Ga0495600_0060935_997_1554 185
306 3300046810 Ga0495660_0108828 Ga0495660_0108828_362_919 185
307 3300047315 Ga0495581_0003794 Ga0495581_0003794_1414_1971 185
308 3300047317 Ga0495604_0029157 Ga0495604_0029157_1544_2101 185
309 3300047317 Ga0495604_0161742 Ga0495604_0161742_137_694 185
310 3300047319 Ga0495674_0040898 Ga0495674_0040898_3435_3992 185
311 3300047321 Ga0495676_0025321 Ga0495676_0025321_1006_1563 185
312 3300047322 Ga0495680_0026925 Ga0495680_0026925_869_1426 185
313 3300047323 Ga0495683_0113978 Ga0495683_0113978_23_580 185
314 3300047444 Ga0495675_0012892 Ga0495675_0012892_3194_3751 185
315 3300047471 Ga0495684_0292803 Ga0495684_0292803_157_714 185
316 3300047673 Ga0495593_0029384 Ga0495593_0029384_1919_2476 185
317 3300048088 Ga0495602_0056656 Ga0495602_0056656_152_709 185
318 3300048089 Ga0495614_0018013 Ga0495614_0018013_818_1375 185
319 3300048919 Ga0496116_0026979 Ga0496116_0026979_710_1267 185
320 3300048920 Ga0496117_0048096 Ga0496117_0048096_1559_2116 185
321 3300048921 Ga0496118_0009234 Ga0496118_0009234_2118_2675 185
322 3300048924 Ga0496121_0449508 Ga0496121_0449508_69_626 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04608

PgpA

Phosphatidylglycerophosphatase A

65

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rfz-assembly1.cif.gz_D structure of protein of unknown function from bacillus stearothermophilus 0.4364 63 171
5cwc-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr5 0.3767 54 174
5cwg-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr10 0.3544 54 171
1rfz-assembly1.cif.gz_D structure of protein of unknown function from bacillus stearothermophilus 0.3309 63 171
8e0m-assembly3.cif.gz_I homotrimeric variant of tctrp9, bgl15 0.31 39 176
ID Description Score Start End Superfamily
af_Q54UP5_23_813_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4608 32 127 1.25.10.10
af_C0H4L1_5_663_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4102 32 175 1.25.10.10
af_Q4DJR4_7_349_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3911 29 174 1.25.10.10
af_Q86AP4_1_277_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.3833 21 182 1.10.3430.10
5cmwA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.3731 36 181 1.25.40.90
ID Description Score Start End GO Terms
AF-A0A522B789-F1-model_v4 Phosphatidylglycerophosphatase A 0.9494 54 184 GO:0006629
GO:0008962
GO:0016020
AF-A0A2W6RZ22-F1-model_v4 deleted 0.9494 55 185
AF-F0GCW2-F1-model_v4 Phosphatidylglycerophosphatase 0.9436 66 184 GO:0006629
GO:0008962
GO:0016020
AF-W7WD71-F1-model_v4 deleted 0.9372 67 182
AF-A0A2W6RZ22-F1-model_v4 deleted 0.9289 55 185

Feature Viewer

pLDDT pTM Quality
71.04 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map