F406673

General Info

Members Datasets Scaffolds Average Seq Length
322 236 304 133

Family's Representative Sequence

Representative Sequence 3300053091|Ga0500647_0164664|Ga0500647_0164664_394_798
Length 125
Sequence MLDHIFLSVSNVQRSIDFYVAALAPLGIAHQHDYDGKDGPPGHPDLKGFGANGRVFFWLREGFVDAHAVHVGFVATSTGAVDAAHDNGAPGARLYYDPRYYAANVLDPDGYSLEFVYKSWQQRPR

Samples

Sample ID Description Type Environment
1 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
2 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
3 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
4 2643221688 Rhizobium sp. Root482 Isolate Unclassified
5 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
6 2738541293 Rhizobium sp. GV031 Isolate Unclassified
7 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
8 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
9 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
10 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
11 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
12 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
13 2919150387 Rahnella aceris 1817 Isolate Unclassified
14 2927143783 Rahnella sp. 2050 Isolate Unclassified
15 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
16 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
17 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
18 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
222 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
225 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0.93
Rhizoplane 2.48
Rhizosphere 77.02
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002154 3300000545 Unclassified 1356
2 JGI25157J39369_1000560 3300002741 Bacteria 22273
3 rootH2_10026166 3300003320 Bacteria 12077
4 Ga0070670_100383699 3300005331 Bacteria 1238
5 Ga0070680_101820031 3300005336 Bacteria 528
6 Ga0070689_100010045 3300005340 Bacteria 6738
7 Ga0070668_100341185 3300005347 Bacteria 1266
8 Ga0070669_100049647 3300005353 Bacteria 3063
9 Ga0070669_100942100 3300005353 Bacteria 739
10 Ga0070674_100763491 3300005356 Unclassified 832
11 Ga0070688_100273610 3300005365 Unclassified 1211
12 Ga0070703_10331136 3300005406 Bacteria 644
13 Ga0070710_10309906 3300005437 Bacteria 1033
14 Ga0070710_10884975 3300005437 Unclassified 644
15 Ga0070711_100767693 3300005439 Bacteria 816
16 Ga0070700_100102905 3300005441 Bacteria 1885
17 Ga0070708_100214436 3300005445 Bacteria 1804
18 Ga0070708_100628145 3300005445 Bacteria 1012
19 Ga0070678_101526014 3300005456 Bacteria 626
20 Ga0070706_100481448 3300005467 Unclassified 1155
21 Ga0070707_101756181 3300005468 Bacteria 588
22 Ga0070698_100482603 3300005471 Bacteria 1176
23 Ga0070698_101791823 3300005471 Bacteria 567
24 Ga0070699_100483899 3300005518 Bacteria 1123
25 Ga0070697_100163629 3300005536 Unclassified 1880
26 Ga0070686_100024907 3300005544 Bacteria 3591
27 Ga0070693_101381696 3300005547 Bacteria 547
28 Ga0070665_100593489 3300005548 Bacteria 1121
29 Ga0070665_100975971 3300005548 Bacteria 860
30 Ga0068857_100227636 3300005577 Bacteria 1704
31 Ga0068852_102425730 3300005616 Unclassified 545
32 Ga0068859_100093535 3300005617 Bacteria 3058
33 Ga0068861_101026114 3300005719 Unclassified 789
34 Ga0068863_100113404 3300005841 Bacteria 2582
35 Ga0068863_101355333 3300005841 Unclassified 719
36 Ga0068858_100273116 3300005842 Bacteria 1609
37 Ga0070717_10023586 3300006028 Bacteria 4877
38 Ga0070715_10301284 3300006163 Bacteria 858
39 Ga0070715_10457459 3300006163 Bacteria 722
40 Ga0070712_100374677 3300006175 Bacteria 1170
41 Ga0070712_100593467 3300006175 Unclassified 937
42 Ga0075362_10054259 3300006177 Bacteria 1801
43 Ga0075434_100590380 3300006871 Bacteria 1130
44 Ga0097620_100093536 3300006931 Bacteria 3058
45 Ga0099795_10371151 3300007788 Unclassified 644
46 Ga0099795_10542739 3300007788 Bacteria 547
47 Ga0105244_10002466 3300009036 Bacteria 13925
48 Ga0105240_10148570 3300009093 Bacteria 2793
49 Ga0105240_11078250 3300009093 Unclassified 856
50 Ga0111539_11102112 3300009094 Bacteria 923
51 Ga0105245_11498088 3300009098 Unclassified 725
52 Ga0105243_10126148 3300009148 Unclassified 2165
53 Ga0105241_10319669 3300009174 Bacteria 1338
54 Ga0105242_11103758 3300009176 Bacteria 807
55 Ga0105237_11035291 3300009545 Unclassified 828
56 Ga0105238_10174802 3300009551 Bacteria 2124
57 Ga0099796_10140577 3300010159 Bacteria 943
58 Ga0105239_10326872 3300010375 Bacteria 1730
59 Ga0105239_11087794 3300010375 Bacteria 920
60 Ga0157371_10273507 3300013102 Bacteria 1219
61 Ga0157374_10224643 3300013296 Bacteria 1843
62 Ga0157374_10310355 3300013296 Bacteria 1561
63 Ga0157378_10582333 3300013297 Bacteria 1128
64 Ga0157372_11586233 3300013307 Unclassified 754
65 Ga0157379_10905387 3300014968 Unclassified 837
66 Ga0209026_1000025 3300025250 Bacteria 352548
67 Ga0209759_1000121 3300025256 Bacteria 138469
68 Ga0209673_1088149 3300025273 Bacteria 694
69 Ga0209676_1000670 3300025292 Bacteria 48733
70 Ga0209050_1001081 3300025298 Bacteria 33282
71 Ga0209256_1022814 3300025299 Bacteria 1885
72 Ga0207655_1022116 3300025728 Bacteria 3200
73 Ga0207692_10295843 3300025898 Bacteria 984
74 Ga0207685_10273358 3300025905 Unclassified 826
75 Ga0207699_10345486 3300025906 Bacteria 1049
76 Ga0207645_10041235 3300025907 Bacteria 2956
77 Ga0207684_10222076 3300025910 Unclassified 1630
78 Ga0207654_10160933 3300025911 Bacteria 1450
79 Ga0207695_10209216 3300025913 Bacteria 1862
80 Ga0207695_10361108 3300025913 Bacteria 1339
81 Ga0207693_10077533 3300025915 Bacteria 2602
82 Ga0207693_10438378 3300025915 Bacteria 1021
83 Ga0207693_10616737 3300025915 Unclassified 844
84 Ga0207652_10482122 3300025921 Unclassified 1117
85 Ga0207646_10037775 3300025922 Bacteria 4352
86 Ga0207681_10889918 3300025923 Bacteria 745
87 Ga0207694_10047137 3300025924 Bacteria 3333
88 Ga0207650_10605877 3300025925 Unclassified 921
89 Ga0207664_10790399 3300025929 Unclassified 854
90 Ga0207686_11052476 3300025934 Bacteria 662
91 Ga0207709_10194507 3300025935 Unclassified 1444
92 Ga0207670_10012726 3300025936 Bacteria 4931
93 Ga0207665_10151274 3300025939 Bacteria 1662
94 Ga0207712_10727003 3300025961 Bacteria 868
95 Ga0207677_10694136 3300026023 Unclassified 902
96 Ga0207708_10904364 3300026075 Bacteria 764
97 Ga0207675_100168852 3300026118 Bacteria 2090
98 Ga0209969_1042153 3300027360 Bacteria 710
99 Ga0209995_1071342 3300027471 Bacteria 594
100 Ga0209968_1052122 3300027526 Bacteria 712
101 Ga0210002_1006274 3300027617 Unclassified 1792
102 Ga0209588_1246667 3300027671 Bacteria 546
103 Ga0209966_1038531 3300027695 Bacteria 990
104 Ga0209974_10069109 3300027876 Bacteria 1203
105 Ga0207428_10959722 3300027907 Bacteria 602
106 Ga0268266_10097152 3300028379 Bacteria 2590
107 Ga0265338_10096471 3300028800 Unclassified 2426
108 Ga0265331_10551634 3300031250 Bacteria 520
109 Ga0265327_10000550 3300031251 Bacteria 64087
110 Ga0265327_10037712 3300031251 Bacteria 2643
111 Ga0307410_10392777 3300031852 Bacteria 1119
112 Ga0307412_10001031 3300031911 Bacteria 15911
113 Ga0307409_100425452 3300031995 Bacteria 1275
114 Ga0307416_100311412 3300032002 Bacteria 1571
115 Ga0307414_10057027 3300032004 Bacteria 2743
116 Ga0307414_10391705 3300032004 Bacteria 1204
117 Ga0373926_0051043 3300035083 Bacteria 1491
118 Ga0373923_0258162 3300035111 Bacteria 817
119 Ga0373935_0068427 3300035692 Bacteria 2285
120 Ga0373927_0095546 3300035695 Bacteria 1932
121 Ga0373937_1983875 3300036401 Unclassified 528
122 Ga0439455_0126680 3300042012 Bacteria 718
123 Ga0439464_0006534 3300042439 Bacteria 3039
124 Ga0495617_006211 3300046452 Bacteria 4205
125 Ga0495617_136718 3300046452 Bacteria 784
126 Ga0495627_065020 3300046453 Bacteria 1072
127 Ga0495590_0001069 3300046457 Bacteria 12072
128 Ga0495591_007483 3300046458 Bacteria 4638
129 Ga0495629_0170947 3300046459 Bacteria 1508
130 Ga0495629_0565507 3300046459 Bacteria 762
131 Ga0495638_0027111 3300046460 Bacteria 3710
132 Ga0495638_0029525 3300046460 Bacteria 3536
133 Ga0495651_0034079 3300046462 Bacteria 3970
134 Ga0495653_0001777 3300046463 Bacteria 17004
135 Ga0495653_0317809 3300046463 Bacteria 1010
136 Ga0495653_0322356 3300046463 Bacteria 1001
137 Ga0495653_0465792 3300046463 Unclassified 793
138 Ga0495650_0020063 3300046471 Bacteria 3269
139 Ga0495580_0024206 3300046472 Bacteria 4449
140 Ga0495605_0002485 3300046474 Bacteria 11401
141 Ga0495605_0381873 3300046474 Bacteria 588
142 Ga0495584_0661911 3300046491 Bacteria 532
143 Ga0495585_0018448 3300046492 Bacteria 4023
144 Ga0495594_0025074 3300046499 Bacteria 3205
145 Ga0495594_0078042 3300046499 Bacteria 1848
146 Ga0495596_0000704 3300046500 Bacteria 20713
147 Ga0495607_0047661 3300046501 Bacteria 2509
148 Ga0495607_0055887 3300046501 Bacteria 2268
149 Ga0495607_0075608 3300046501 Bacteria 1866
150 Ga0495583_0005342 3300046506 Bacteria 8756
151 Ga0495583_0036868 3300046506 Bacteria 2322
152 Ga0495606_0010524 3300046507 Bacteria 7661
153 Ga0495606_0025699 3300046507 Bacteria 4211
154 Ga0495608_0039399 3300046511 Bacteria 3167
155 Ga0495610_0000003 3300046512 Bacteria 1203910
156 Ga0495610_0002486 3300046512 Bacteria 15433
157 Ga0495610_0006889 3300046512 Bacteria 7698
158 Ga0495610_0050386 3300046512 Bacteria 2033
159 Ga0495610_0347665 3300046512 Bacteria 559
160 Ga0495616_0006055 3300046513 Bacteria 7371
161 Ga0495616_0058544 3300046513 Bacteria 1897
162 Ga0495618_0018320 3300046514 Bacteria 4299
163 Ga0495620_0039287 3300046515 Bacteria 2093
164 Ga0495620_0142960 3300046515 Bacteria 935
165 Ga0495628_0004262 3300046516 Bacteria 12718
166 Ga0495630_0019855 3300046517 Bacteria 4946
167 Ga0495631_0022160 3300046518 Bacteria 2954
168 Ga0495632_0000898 3300046519 Bacteria 26073
169 Ga0495637_0003703 3300046520 Bacteria 8077
170 Ga0495643_0039493 3300046522 Bacteria 2581
171 Ga0495643_0128179 3300046522 Bacteria 1276
172 Ga0495648_0009976 3300046524 Bacteria 7286
173 Ga0495648_0010855 3300046524 Bacteria 6912
174 Ga0495648_0024394 3300046524 Bacteria 4120
175 Ga0495648_0160713 3300046524 Bacteria 1162
176 Ga0495648_0265043 3300046524 Bacteria 822
177 Ga0495648_0367526 3300046524 Bacteria 652
178 Ga0495666_0020688 3300046526 Bacteria 3258
179 Ga0495652_0003067 3300046529 Bacteria 16747
180 Ga0495654_0000007 3300046530 Bacteria 403529
181 Ga0495654_0100079 3300046530 Bacteria 1335
182 Ga0495654_0132190 3300046530 Bacteria 1119
183 Ga0495665_0020108 3300046531 Bacteria 3587
184 Ga0495665_0210532 3300046531 Bacteria 1007
185 Ga0495586_0565440 3300046535 Bacteria 657
186 Ga0495598_0174527 3300046537 Bacteria 764
187 Ga0495609_0074444 3300046538 Bacteria 1489
188 Ga0495633_0010584 3300046558 Bacteria 5026
189 Ga0495668_0000031 3300046616 Bacteria 256576
190 Ga0495668_0005330 3300046616 Bacteria 8778
191 Ga0495668_0213541 3300046616 Bacteria 1056
192 Ga0495634_0006134 3300046642 Bacteria 9150
193 Ga0495611_0003805 3300046648 Bacteria 6584
194 Ga0495611_0122389 3300046648 Bacteria 1213
195 Ga0495625_0000115 3300046660 Bacteria 122861
196 Ga0495625_0021410 3300046660 Bacteria 4979
197 Ga0495625_0595587 3300046660 Bacteria 664
198 Ga0495635_0699158 3300046663 Bacteria 657
199 Ga0495635_0723405 3300046663 Bacteria 644
200 Ga0495659_0219437 3300046664 Bacteria 785
201 Ga0495661_0016423 3300046665 Bacteria 4907
202 Ga0495661_0026609 3300046665 Bacteria 3724
203 Ga0495588_0036098 3300046674 Bacteria 2506
204 Ga0495599_0247748 3300046678 Bacteria 1085
205 Ga0495623_0039988 3300046679 Bacteria 2995
206 Ga0495646_0028760 3300046680 Bacteria 3478
207 Ga0495669_0056894 3300046684 Bacteria 1763
208 Ga0495669_0559490 3300046684 Bacteria 556
209 Ga0495613_0038284 3300046689 Bacteria 3554
210 Ga0495624_0007028 3300046690 Bacteria 7934
211 Ga0495624_0036912 3300046690 Bacteria 3147
212 Ga0495670_0007088 3300046691 Bacteria 5521
213 Ga0495670_0009429 3300046691 Bacteria 4799
214 Ga0495671_0000010 3300046692 Bacteria 368641
215 Ga0495671_0252557 3300046692 Bacteria 851
216 Ga0495649_0013013 3300046694 Bacteria 4814
217 Ga0495589_0035229 3300046794 Bacteria 2510
218 Ga0495600_0323788 3300046809 Bacteria 969
219 Ga0495581_0051406 3300047315 Bacteria 2380
220 Ga0495604_0014672 3300047317 Bacteria 6245
221 Ga0495604_0112714 3300047317 Bacteria 1981
222 Ga0495604_0115365 3300047317 Bacteria 1952
223 Ga0495674_0003859 3300047319 Bacteria 14559
224 Ga0495672_0018409 3300047320 Bacteria 4638
225 Ga0495676_0023430 3300047321 Bacteria 5360
226 Ga0495680_0004194 3300047322 Bacteria 13843
227 Ga0495683_0027720 3300047323 Bacteria 2896
228 Ga0495687_042514 3300047443 Bacteria 1985
229 Ga0495675_0045622 3300047444 Bacteria 2791
230 Ga0495675_0313364 3300047444 Bacteria 929
231 Ga0495677_0011661 3300047445 Bacteria 3212
232 Ga0495673_0000008 3300047469 Bacteria 752462
233 Ga0495673_0000016 3300047469 Bacteria 580643
234 Ga0495673_0001796 3300047469 Bacteria 16266
235 Ga0495673_0009559 3300047469 Bacteria 5362
236 Ga0495681_0215956 3300047470 Bacteria 771
237 Ga0495686_0038075 3300047472 Bacteria 3077
238 Ga0495686_0105444 3300047472 Bacteria 1696
239 Ga0495686_0179418 3300047472 Bacteria 1228
240 Ga0495686_0678143 3300047472 Bacteria 527
241 Ga0495593_0037582 3300047673 Bacteria 2618
242 Ga0495593_0044478 3300047673 Bacteria 2375
243 Ga0495602_0004667 3300048088 Bacteria 14307
244 Ga0495614_0031292 3300048089 Bacteria 2290
245 Ga0495626_0091824 3300048091 Bacteria 1334
246 Ga0496100_1616725 3300048903 Unclassified 512
247 Ga0496102_0448176 3300048905 Unclassified 1211
248 Ga0496104_0000291 3300048907 Bacteria 44138
249 Ga0496106_0137807 3300048909 Bacteria 1918
250 Ga0496106_0785311 3300048909 Unclassified 756
251 Ga0496107_0437328 3300048910 Bacteria 972
252 Ga0496108_0394917 3300048911 Bacteria 1208
253 Ga0496116_0037188 3300048919 Bacteria 3397
254 Ga0496116_0038376 3300048919 Bacteria 3327
255 Ga0496116_0059193 3300048919 Bacteria 2493
256 Ga0496117_0098738 3300048920 Bacteria 1855
257 Ga0496119_0004711 3300048922 Bacteria 13417
258 Ga0496119_0165882 3300048922 Bacteria 1170
259 Ga0496119_0241678 3300048922 Bacteria 914
260 Ga0496119_0299836 3300048922 Bacteria 793
261 Ga0496121_0022067 3300048924 Bacteria 6199
262 Ga0496121_0040726 3300048924 Bacteria 4071
263 Ga0496121_0043539 3300048924 Bacteria 3886
264 Ga0496121_0165357 3300048924 Bacteria 1613
265 Ga0496122_0000182 3300048925 Bacteria 148360
266 Ga0496122_0020720 3300048925 Bacteria 5922
267 Ga0496122_0072800 3300048925 Bacteria 2441
268 Ga0496123_0003498 3300048926 Bacteria 17512
269 Ga0496123_0023029 3300048926 Bacteria 4781
270 Ga0496123_0326953 3300048926 Bacteria 721
271 Ga0496124_0014437 3300048927 Bacteria 7638
272 Ga0496124_0031398 3300048927 Bacteria 4703
273 Ga0496124_0086835 3300048927 Bacteria 2559
274 Ga0496124_0509034 3300048927 Bacteria 805
275 Ga0496125_0071800 3300048928 Bacteria 2702
276 Ga0496126_0348634 3300048929 Bacteria 1211
277 Ga0496126_0573711 3300048929 Bacteria 892
278 Ga0495678_019632 3300049459 Bacteria 3010
279 Ga0495678_063636 3300049459 Bacteria 1377
280 Ga0495682_0004170 3300049460 Bacteria 6260
281 Ga0501238_030192 3300049671 Bacteria 783
282 nmdc:mga03683_42284_c1 3300050489 Bacteria 1874
283 nmdc:mga06z11_94364_c1 3300050494 Bacteria 1630
284 nmdc:mga0a205_668370_c1 3300050515 Bacteria 889
285 Ga0500610_0143897 3300053079 Bacteria 1201
286 Ga0500643_007650 3300053087 Bacteria 4330
287 Ga0500647_0164664 3300053091 Bacteria 1027
288 Ga0500557_002614 3300053105 Bacteria 3356
289 Ga0500569_027519 3300053109 Bacteria 1567
290 Ga0500592_000447 3300053116 Bacteria 6893
291 Ga0500594_0002069 3300053118 Bacteria 4332
292 Ga0500595_015516 3300053119 Bacteria 2857
293 Ga0500608_001184 3300053122 Bacteria 9301
294 Ga0500618_004100 3300053125 Bacteria 4770
295 Ga0500618_009848 3300053125 Bacteria 2592
296 Ga0500618_015370 3300053125 Bacteria 1935
297 Ga0500655_048700 3300053133 Bacteria 842
298 Ga0500658_0004945 3300053134 Bacteria 4970
299 Ga0500573_0036277 3300053140 Bacteria 2846
300 Ga0500573_0134385 3300053140 Bacteria 1367
301 Ga0500586_000169 3300053145 Bacteria 12158
302 Ga0500604_0012197 3300053151 Bacteria 2318
303 Ga0500627_0000003 3300053158 Bacteria 178186
304 Ga0500636_0000238 3300053177 Bacteria 30209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053091 Ga0500647_0164664 Ga0500647_0164664_394_798 125
2 iso_pu_bacteria 2585427594 2585846360 127
3 iso_pu_bacteria 2643221688 2644492724 127
4 iso_pu_bacteria 2738541293 2738805656 127
5 iso_pu_bacteria 2821123053 2821125871 127
6 iso_pu_bacteria 2838736955 2838737654 127
7 iso_pu_bacteria 2841840854 2841841977 127
8 iso_pu_bacteria 2842140634 2842141756 127
9 iso_pu_bacteria 2857531043 2857532432 127
10 iso_pu_bacteria 2990703756 2990710797 127
11 3300009036 Ga0105244_10002466 Ga0105244_100024669 128
12 3300025728 Ga0207655_1022116 Ga0207655_10221162 128
13 iso_pu_bacteria 2510065055 2510294348 129
14 iso_pu_bacteria 2643221565 2643846066 129
15 iso_pu_bacteria 2931396565 2931402874 129
16 iso_pu_bacteria 2945961074 2945964363 129
17 iso_pu_bacteria 8056155041 8056159054 129
18 iso_pu_bacteria 2667528173 2671107718 130
19 iso_pu_bacteria 2904474040 2904476720 130
20 iso_pu_bacteria 2919150387 2919152889 130
21 iso_pu_bacteria 2927143783 2927146850 130
22 3300005353 Ga0070669_100942100 Ga0070669_1009421002 131
23 3300025273 Ga0209673_1088149 Ga0209673_10881492 131
24 3300025292 Ga0209676_1000670 Ga0209676_100067013 131
25 3300025298 Ga0209050_1001081 Ga0209050_10010816 131
26 3300025299 Ga0209256_1022814 Ga0209256_10228142 131
27 3300025923 Ga0207681_10889918 Ga0207681_108899181 131
28 3300028379 Ga0268266_10097152 Ga0268266_100971523 131
29 3300031911 Ga0307412_10001031 Ga0307412_100010316 131
30 3300032004 Ga0307414_10391705 Ga0307414_103917052 131
31 3300046452 Ga0495617_136718 Ga0495617_136718_38_433 131
32 3300046453 Ga0495627_065020 Ga0495627_065020_522_917 131
33 3300046457 Ga0495590_0001069 Ga0495590_0001069_11052_11447 131
34 3300046459 Ga0495629_0170947 Ga0495629_0170947_1042_1437 131
35 3300046459 Ga0495629_0565507 Ga0495629_0565507_325_720 131
36 3300046460 Ga0495638_0027111 Ga0495638_0027111_2202_2597 131
37 3300046460 Ga0495638_0029525 Ga0495638_0029525_2192_2587 131
38 3300046462 Ga0495651_0034079 Ga0495651_0034079_1557_1952 131
39 3300046463 Ga0495653_0001777 Ga0495653_0001777_2163_2558 131
40 3300046463 Ga0495653_0317809 Ga0495653_0317809_508_903 131
41 3300046463 Ga0495653_0322356 Ga0495653_0322356_420_815 131
42 3300046471 Ga0495650_0020063 Ga0495650_0020063_1020_1415 131
43 3300046472 Ga0495580_0024206 Ga0495580_0024206_2222_2617 131
44 3300046474 Ga0495605_0002485 Ga0495605_0002485_3106_3501 131
45 3300046474 Ga0495605_0381873 Ga0495605_0381873_61_456 131
46 3300046492 Ga0495585_0018448 Ga0495585_0018448_1663_2058 131
47 3300046499 Ga0495594_0025074 Ga0495594_0025074_1976_2371 131
48 3300046500 Ga0495596_0000704 Ga0495596_0000704_7668_8063 131
49 3300046501 Ga0495607_0047661 Ga0495607_0047661_2071_2466 131
50 3300046501 Ga0495607_0055887 Ga0495607_0055887_1511_1906 131
51 3300046501 Ga0495607_0075608 Ga0495607_0075608_91_486 131
52 3300046506 Ga0495583_0005342 Ga0495583_0005342_2212_2607 131
53 3300046506 Ga0495583_0036868 Ga0495583_0036868_620_1015 131
54 3300046507 Ga0495606_0010524 Ga0495606_0010524_5126_5521 131
55 3300046507 Ga0495606_0025699 Ga0495606_0025699_1620_2015 131
56 3300046511 Ga0495608_0039399 Ga0495608_0039399_161_556 131
57 3300046512 Ga0495610_0000003 Ga0495610_0000003_1003215_1003610 131
58 3300046512 Ga0495610_0002486 Ga0495610_0002486_6875_7270 131
59 3300046512 Ga0495610_0006889 Ga0495610_0006889_5011_5406 131
60 3300046512 Ga0495610_0050386 Ga0495610_0050386_1253_1648 131
61 3300046512 Ga0495610_0347665 Ga0495610_0347665_132_527 131
62 3300046513 Ga0495616_0006055 Ga0495616_0006055_5392_5787 131
63 3300046513 Ga0495616_0058544 Ga0495616_0058544_449_844 131
64 3300046514 Ga0495618_0018320 Ga0495618_0018320_2268_2663 131
65 3300046515 Ga0495620_0039287 Ga0495620_0039287_730_1125 131
66 3300046515 Ga0495620_0142960 Ga0495620_0142960_50_445 131
67 3300046516 Ga0495628_0004262 Ga0495628_0004262_11295_11690 131
68 3300046517 Ga0495630_0019855 Ga0495630_0019855_2422_2817 131
69 3300046518 Ga0495631_0022160 Ga0495631_0022160_512_907 131
70 3300046519 Ga0495632_0000898 Ga0495632_0000898_20823_21218 131
71 3300046520 Ga0495637_0003703 Ga0495637_0003703_5806_6201 131
72 3300046522 Ga0495643_0039493 Ga0495643_0039493_373_768 131
73 3300046522 Ga0495643_0128179 Ga0495643_0128179_356_751 131
74 3300046524 Ga0495648_0009976 Ga0495648_0009976_5254_5649 131
75 3300046524 Ga0495648_0010855 Ga0495648_0010855_4052_4447 131
76 3300046524 Ga0495648_0024394 Ga0495648_0024394_2212_2607 131
77 3300046524 Ga0495648_0160713 Ga0495648_0160713_24_419 131
78 3300046524 Ga0495648_0265043 Ga0495648_0265043_366_761 131
79 3300046524 Ga0495648_0367526 Ga0495648_0367526_112_507 131
80 3300046526 Ga0495666_0020688 Ga0495666_0020688_2114_2509 131
81 3300046529 Ga0495652_0003067 Ga0495652_0003067_14165_14560 131
82 3300046530 Ga0495654_0100079 Ga0495654_0100079_436_831 131
83 3300046530 Ga0495654_0132190 Ga0495654_0132190_563_958 131
84 3300046531 Ga0495665_0020108 Ga0495665_0020108_1512_1907 131
85 3300046531 Ga0495665_0210532 Ga0495665_0210532_132_527 131
86 3300046535 Ga0495586_0565440 Ga0495586_0565440_179_574 131
87 3300046538 Ga0495609_0074444 Ga0495609_0074444_676_1071 131
88 3300046558 Ga0495633_0010584 Ga0495633_0010584_2687_3082 131
89 3300046616 Ga0495668_0000031 Ga0495668_0000031_127332_127727 131
90 3300046616 Ga0495668_0005330 Ga0495668_0005330_5896_6291 131
91 3300046642 Ga0495634_0006134 Ga0495634_0006134_2174_2569 131
92 3300046648 Ga0495611_0003805 Ga0495611_0003805_1802_2197 131
93 3300046648 Ga0495611_0122389 Ga0495611_0122389_105_500 131
94 3300046660 Ga0495625_0000115 Ga0495625_0000115_116859_117254 131
95 3300046660 Ga0495625_0021410 Ga0495625_0021410_2019_2414 131
96 3300046660 Ga0495625_0595587 Ga0495625_0595587_184_579 131
97 3300046663 Ga0495635_0699158 Ga0495635_0699158_175_570 131
98 3300046665 Ga0495661_0016423 Ga0495661_0016423_2088_2483 131
99 3300046665 Ga0495661_0026609 Ga0495661_0026609_1268_1663 131
100 3300046674 Ga0495588_0036098 Ga0495588_0036098_895_1290 131
101 3300046678 Ga0495599_0247748 Ga0495599_0247748_342_737 131
102 3300046679 Ga0495623_0039988 Ga0495623_0039988_411_806 131
103 3300046680 Ga0495646_0028760 Ga0495646_0028760_2205_2600 131
104 3300046684 Ga0495669_0056894 Ga0495669_0056894_1086_1481 131
105 3300046684 Ga0495669_0559490 Ga0495669_0559490_143_538 131
106 3300046689 Ga0495613_0038284 Ga0495613_0038284_2471_2866 131
107 3300046690 Ga0495624_0007028 Ga0495624_0007028_5902_6297 131
108 3300046690 Ga0495624_0036912 Ga0495624_0036912_1549_1944 131
109 3300046691 Ga0495670_0007088 Ga0495670_0007088_3932_4327 131
110 3300046691 Ga0495670_0009429 Ga0495670_0009429_3850_4245 131
111 3300046692 Ga0495671_0000010 Ga0495671_0000010_252030_252425 131
112 3300046692 Ga0495671_0252557 Ga0495671_0252557_240_635 131
113 3300046694 Ga0495649_0013013 Ga0495649_0013013_1514_1909 131
114 3300046794 Ga0495589_0035229 Ga0495589_0035229_732_1127 131
115 3300046809 Ga0495600_0323788 Ga0495600_0323788_331_726 131
116 3300047315 Ga0495581_0051406 Ga0495581_0051406_1375_1770 131
117 3300047317 Ga0495604_0014672 Ga0495604_0014672_3239_3634 131
118 3300047317 Ga0495604_0112714 Ga0495604_0112714_505_900 131
119 3300047317 Ga0495604_0115365 Ga0495604_0115365_1534_1929 131
120 3300047319 Ga0495674_0003859 Ga0495674_0003859_2191_2586 131
121 3300047320 Ga0495672_0018409 Ga0495672_0018409_1968_2363 131
122 3300047321 Ga0495676_0023430 Ga0495676_0023430_2437_2832 131
123 3300047322 Ga0495680_0004194 Ga0495680_0004194_2191_2586 131
124 3300047323 Ga0495683_0027720 Ga0495683_0027720_703_1098 131
125 3300047443 Ga0495687_042514 Ga0495687_042514_432_827 131
126 3300047444 Ga0495675_0045622 Ga0495675_0045622_2004_2399 131
127 3300047444 Ga0495675_0313364 Ga0495675_0313364_74_469 131
128 3300047445 Ga0495677_0011661 Ga0495677_0011661_1982_2377 131
129 3300047469 Ga0495673_0000008 Ga0495673_0000008_71091_71486 131
130 3300047469 Ga0495673_0000016 Ga0495673_0000016_201647_202042 131
131 3300047469 Ga0495673_0001796 Ga0495673_0001796_3852_4247 131
132 3300047469 Ga0495673_0009559 Ga0495673_0009559_2782_3177 131
133 3300047470 Ga0495681_0215956 Ga0495681_0215956_253_648 131
134 3300047472 Ga0495686_0038075 Ga0495686_0038075_1935_2330 131
135 3300047472 Ga0495686_0105444 Ga0495686_0105444_82_477 131
136 3300047472 Ga0495686_0179418 Ga0495686_0179418_337_732 131
137 3300047472 Ga0495686_0678143 Ga0495686_0678143_121_516 131
138 3300047673 Ga0495593_0037582 Ga0495593_0037582_46_441 131
139 3300047673 Ga0495593_0044478 Ga0495593_0044478_1891_2286 131
140 3300048088 Ga0495602_0004667 Ga0495602_0004667_2165_2560 131
141 3300048089 Ga0495614_0031292 Ga0495614_0031292_1193_1588 131
142 3300048091 Ga0495626_0091824 Ga0495626_0091824_370_765 131
143 3300048907 Ga0496104_0000291 Ga0496104_0000291_23454_23849 131
144 3300048909 Ga0496106_0137807 Ga0496106_0137807_1187_1582 131
145 3300048910 Ga0496107_0437328 Ga0496107_0437328_300_695 131
146 3300048919 Ga0496116_0037188 Ga0496116_0037188_2164_2559 131
147 3300048919 Ga0496116_0038376 Ga0496116_0038376_1951_2346 131
148 3300048919 Ga0496116_0059193 Ga0496116_0059193_38_433 131
149 3300048920 Ga0496117_0098738 Ga0496117_0098738_182_577 131
150 3300048922 Ga0496119_0165882 Ga0496119_0165882_147_542 131
151 3300048922 Ga0496119_0241678 Ga0496119_0241678_61_456 131
152 3300048922 Ga0496119_0299836 Ga0496119_0299836_78_473 131
153 3300048924 Ga0496121_0022067 Ga0496121_0022067_5130_5525 131
154 3300048924 Ga0496121_0040726 Ga0496121_0040726_2783_3178 131
155 3300048924 Ga0496121_0043539 Ga0496121_0043539_2349_2744 131
156 3300048924 Ga0496121_0165357 Ga0496121_0165357_365_760 131
157 3300048925 Ga0496122_0000182 Ga0496122_0000182_38161_38556 131
158 3300048925 Ga0496122_0020720 Ga0496122_0020720_2349_2744 131
159 3300048925 Ga0496122_0072800 Ga0496122_0072800_730_1125 131
160 3300048926 Ga0496123_0003498 Ga0496123_0003498_8852_9247 131
161 3300048926 Ga0496123_0023029 Ga0496123_0023029_2059_2454 131
162 3300048926 Ga0496123_0326953 Ga0496123_0326953_222_617 131
163 3300048927 Ga0496124_0014437 Ga0496124_0014437_4898_5293 131
164 3300048927 Ga0496124_0031398 Ga0496124_0031398_2223_2618 131
165 3300048927 Ga0496124_0086835 Ga0496124_0086835_1924_2319 131
166 3300048928 Ga0496125_0071800 Ga0496125_0071800_280_675 131
167 3300048929 Ga0496126_0348634 Ga0496126_0348634_697_1092 131
168 3300048929 Ga0496126_0573711 Ga0496126_0573711_428_823 131
169 3300049459 Ga0495678_019632 Ga0495678_019632_969_1364 131
170 3300049459 Ga0495678_063636 Ga0495678_063636_931_1326 131
171 3300049460 Ga0495682_0004170 Ga0495682_0004170_2187_2582 131
172 3300049671 Ga0501238_030192 Ga0501238_030192_333_728 131
173 3300050494 nmdc:mga06z11_94364_c1 nmdc:mga06z11_94364_c1_548_943 131
174 3300053079 Ga0500610_0143897 Ga0500610_0143897_32_427 131
175 3300053105 Ga0500557_002614 Ga0500557_002614_835_1230 131
176 3300053109 Ga0500569_027519 Ga0500569_027519_969_1364 131
177 3300053116 Ga0500592_000447 Ga0500592_000447_4230_4625 131
178 3300053118 Ga0500594_0002069 Ga0500594_0002069_1514_1909 131
179 3300053122 Ga0500608_001184 Ga0500608_001184_4951_5346 131
180 3300053125 Ga0500618_004100 Ga0500618_004100_2385_2780 131
181 3300053125 Ga0500618_009848 Ga0500618_009848_846_1241 131
182 3300053125 Ga0500618_015370 Ga0500618_015370_926_1321 131
183 3300053133 Ga0500655_048700 Ga0500655_048700_312_707 131
184 3300053134 Ga0500658_0004945 Ga0500658_0004945_201_596 131
185 3300053140 Ga0500573_0036277 Ga0500573_0036277_1285_1680 131
186 3300053140 Ga0500573_0134385 Ga0500573_0134385_441_836 131
187 3300053145 Ga0500586_000169 Ga0500586_000169_291_686 131
188 3300053151 Ga0500604_0012197 Ga0500604_0012197_1366_1761 131
189 3300053158 Ga0500627_0000003 Ga0500627_0000003_70102_70497 131
190 3300053177 Ga0500636_0000238 Ga0500636_0000238_14369_14764 131
191 3300003320 rootH2_10026166 rootH2_1002616616 132
192 3300009148 Ga0105243_10126148 Ga0105243_101261482 132
193 3300025925 Ga0207650_10605877 Ga0207650_106058772 132
194 3300025935 Ga0207709_10194507 Ga0207709_101945072 132
195 3300031852 Ga0307410_10392777 Ga0307410_103927772 132
196 3300032002 Ga0307416_100311412 Ga0307416_1003114122 132
197 3300005437 Ga0070710_10884975 Ga0070710_108849751 133
198 3300005548 Ga0070665_100593489 Ga0070665_1005934891 133
199 3300006163 Ga0070715_10301284 Ga0070715_103012842 133
200 3300010375 Ga0105239_11087794 Ga0105239_110877942 133
201 3300046452 Ga0495617_006211 Ga0495617_006211_1410_1811 133
202 3300046458 Ga0495591_007483 Ga0495591_007483_486_887 133
203 3300046491 Ga0495584_0661911 Ga0495584_0661911_42_443 133
204 3300046530 Ga0495654_0000007 Ga0495654_0000007_45403_45804 133
205 3300046616 Ga0495668_0213541 Ga0495668_0213541_50_451 133
206 3300048922 Ga0496119_0004711 Ga0496119_0004711_11455_11856 133
207 3300048927 Ga0496124_0509034 Ga0496124_0509034_93_494 133
208 3300000545 CNXas_1002154 CNXas_10021542 134
209 3300002741 JGI25157J39369_1000560 JGI25157J39369_100056016 134
210 3300005331 Ga0070670_100383699 Ga0070670_1003836992 134
211 3300005336 Ga0070680_101820031 Ga0070680_1018200311 134
212 3300005340 Ga0070689_100010045 Ga0070689_1000100452 134
213 3300005347 Ga0070668_100341185 Ga0070668_1003411852 134
214 3300005353 Ga0070669_100049647 Ga0070669_1000496473 134
215 3300005356 Ga0070674_100763491 Ga0070674_1007634911 134
216 3300005365 Ga0070688_100273610 Ga0070688_1002736102 134
217 3300005406 Ga0070703_10331136 Ga0070703_103311361 134
218 3300005437 Ga0070710_10309906 Ga0070710_103099062 134
219 3300005439 Ga0070711_100767693 Ga0070711_1007676931 134
220 3300005441 Ga0070700_100102905 Ga0070700_1001029052 134
221 3300005445 Ga0070708_100214436 Ga0070708_1002144363 134
222 3300005445 Ga0070708_100628145 Ga0070708_1006281452 134
223 3300005456 Ga0070678_101526014 Ga0070678_1015260141 134
224 3300005467 Ga0070706_100481448 Ga0070706_1004814482 134
225 3300005468 Ga0070707_101756181 Ga0070707_1017561811 134
226 3300005471 Ga0070698_100482603 Ga0070698_1004826032 134
227 3300005471 Ga0070698_101791823 Ga0070698_1017918231 134
228 3300005518 Ga0070699_100483899 Ga0070699_1004838991 134
229 3300005536 Ga0070697_100163629 Ga0070697_1001636294 134
230 3300005544 Ga0070686_100024907 Ga0070686_1000249073 134
231 3300005547 Ga0070693_101381696 Ga0070693_1013816961 134
232 3300005548 Ga0070665_100975971 Ga0070665_1009759712 134
233 3300005577 Ga0068857_100227636 Ga0068857_1002276364 134
234 3300005616 Ga0068852_102425730 Ga0068852_1024257301 134
235 3300005617 Ga0068859_100093535 Ga0068859_1000935353 134
236 3300005719 Ga0068861_101026114 Ga0068861_1010261141 134
237 3300005841 Ga0068863_100113404 Ga0068863_1001134044 134
238 3300005841 Ga0068863_101355333 Ga0068863_1013553332 134
239 3300005842 Ga0068858_100273116 Ga0068858_1002731161 134
240 3300006028 Ga0070717_10023586 Ga0070717_100235867 134
241 3300006163 Ga0070715_10457459 Ga0070715_104574591 134
242 3300006175 Ga0070712_100374677 Ga0070712_1003746772 134
243 3300006175 Ga0070712_100593467 Ga0070712_1005934671 134
244 3300006177 Ga0075362_10054259 Ga0075362_100542592 134
245 3300006871 Ga0075434_100590380 Ga0075434_1005903802 134
246 3300006931 Ga0097620_100093536 Ga0097620_1000935365 134
247 3300007788 Ga0099795_10371151 Ga0099795_103711512 134
248 3300007788 Ga0099795_10542739 Ga0099795_105427391 134
249 3300009093 Ga0105240_10148570 Ga0105240_101485702 134
250 3300009093 Ga0105240_11078250 Ga0105240_110782502 134
251 3300009094 Ga0111539_11102112 Ga0111539_111021122 134
252 3300009098 Ga0105245_11498088 Ga0105245_114980881 134
253 3300009174 Ga0105241_10319669 Ga0105241_103196692 134
254 3300009176 Ga0105242_11103758 Ga0105242_111037582 134
255 3300009545 Ga0105237_11035291 Ga0105237_110352911 134
256 3300009551 Ga0105238_10174802 Ga0105238_101748022 134
257 3300010159 Ga0099796_10140577 Ga0099796_101405772 134
258 3300010375 Ga0105239_10326872 Ga0105239_103268722 134
259 3300013102 Ga0157371_10273507 Ga0157371_102735073 134
260 3300013296 Ga0157374_10224643 Ga0157374_102246433 134
261 3300013296 Ga0157374_10310355 Ga0157374_103103552 134
262 3300013297 Ga0157378_10582333 Ga0157378_105823331 134
263 3300013307 Ga0157372_11586233 Ga0157372_115862331 134
264 3300014968 Ga0157379_10905387 Ga0157379_109053871 134
265 3300025250 Ga0209026_1000025 Ga0209026_1000025198 134
266 3300025256 Ga0209759_1000121 Ga0209759_100012134 134
267 3300025898 Ga0207692_10295843 Ga0207692_102958432 134
268 3300025905 Ga0207685_10273358 Ga0207685_102733582 134
269 3300025906 Ga0207699_10345486 Ga0207699_103454862 134
270 3300025907 Ga0207645_10041235 Ga0207645_100412353 134
271 3300025910 Ga0207684_10222076 Ga0207684_102220762 134
272 3300025911 Ga0207654_10160933 Ga0207654_101609333 134
273 3300025913 Ga0207695_10209216 Ga0207695_102092162 134
274 3300025913 Ga0207695_10361108 Ga0207695_103611083 134
275 3300025915 Ga0207693_10077533 Ga0207693_100775332 134
276 3300025915 Ga0207693_10438378 Ga0207693_104383782 134
277 3300025915 Ga0207693_10616737 Ga0207693_106167371 134
278 3300025921 Ga0207652_10482122 Ga0207652_104821222 134
279 3300025922 Ga0207646_10037775 Ga0207646_100377755 134
280 3300025924 Ga0207694_10047137 Ga0207694_100471373 134
281 3300025929 Ga0207664_10790399 Ga0207664_107903992 134
282 3300025934 Ga0207686_11052476 Ga0207686_110524762 134
283 3300025936 Ga0207670_10012726 Ga0207670_100127267 134
284 3300025939 Ga0207665_10151274 Ga0207665_101512742 134
285 3300025961 Ga0207712_10727003 Ga0207712_107270031 134
286 3300026023 Ga0207677_10694136 Ga0207677_106941362 134
287 3300026075 Ga0207708_10904364 Ga0207708_109043642 134
288 3300026118 Ga0207675_100168852 Ga0207675_1001688523 134
289 3300027360 Ga0209969_1042153 Ga0209969_10421531 134
290 3300027471 Ga0209995_1071342 Ga0209995_10713421 134
291 3300027526 Ga0209968_1052122 Ga0209968_10521221 134
292 3300027617 Ga0210002_1006274 Ga0210002_10062741 134
293 3300027671 Ga0209588_1246667 Ga0209588_12466671 134
294 3300027695 Ga0209966_1038531 Ga0209966_10385311 134
295 3300027876 Ga0209974_10069109 Ga0209974_100691092 134
296 3300027907 Ga0207428_10959722 Ga0207428_109597221 134
297 3300028800 Ga0265338_10096471 Ga0265338_100964713 134
298 3300031250 Ga0265331_10551634 Ga0265331_105516341 134
299 3300031251 Ga0265327_10000550 Ga0265327_1000055016 134
300 3300031251 Ga0265327_10037712 Ga0265327_100377121 134
301 3300031995 Ga0307409_100425452 Ga0307409_1004254521 134
302 3300032004 Ga0307414_10057027 Ga0307414_100570272 134
303 3300035083 Ga0373926_0051043 Ga0373926_0051043_223_627 134
304 3300035111 Ga0373923_0258162 Ga0373923_0258162_332_736 134
305 3300035692 Ga0373935_0068427 Ga0373935_0068427_78_482 134
306 3300035695 Ga0373927_0095546 Ga0373927_0095546_176_580 134
307 3300036401 Ga0373937_1983875 Ga0373937_1983875_96_500 134
308 3300042012 Ga0439455_0126680 Ga0439455_0126680_180_584 134
309 3300042439 Ga0439464_0006534 Ga0439464_0006534_1557_1961 134
310 3300046463 Ga0495653_0465792 Ga0495653_0465792_182_586 134
311 3300046499 Ga0495594_0078042 Ga0495594_0078042_643_1047 134
312 3300046537 Ga0495598_0174527 Ga0495598_0174527_174_602 134
313 3300046663 Ga0495635_0723405 Ga0495635_0723405_112_516 134
314 3300046664 Ga0495659_0219437 Ga0495659_0219437_111_569 134
315 3300048903 Ga0496100_1616725 Ga0496100_1616725_38_481 134
316 3300048905 Ga0496102_0448176 Ga0496102_0448176_625_1029 134
317 3300048909 Ga0496106_0785311 Ga0496106_0785311_18_461 134
318 3300048911 Ga0496108_0394917 Ga0496108_0394917_147_551 134
319 3300050489 nmdc:mga03683_42284_c1 nmdc:mga03683_42284_c1_500_916 134
320 3300050515 nmdc:mga0a205_668370_c1 nmdc:mga0a205_668370_c1_83_487 134
321 3300053087 Ga0500643_007650 Ga0500643_007650_3379_3798 134
322 3300053119 Ga0500595_015516 Ga0500595_015516_1069_1473 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

115

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9105 1 126
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8686 1 126
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8506 4 127
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8399 4 127
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8396 4 127
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9105 1 126 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8801 69 126 3.30.720.110
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8686 1 126 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8389 70 125 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8244 1 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y8B6K7-F1-model_v4 deleted 1.003 70 131
AF-A0A0E1X199-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9902 70 126 GO:0051213
AF-A0A6M2X0B0-F1-model_v4 deleted 0.9899 71 128
AF-A0A0A8UMR2-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9895 73 128 GO:0051213
AF-A0A4U9Z0D5-F1-model_v4 deleted 0.9845 70 128

Feature Viewer

pLDDT pTM Quality
92.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map