F406588

General Info

Members Datasets Scaffolds Average Seq Length
322 175 644 287

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000717|Ga0495648_0000717_29184_30155
Length 323
Sequence LRRKKKPSRFNAAPQLFVVSSGETDMVRHHGRFAWYELLTTDTVAARVFYTKVLGWGAQDASTPDLAYTLFTAGGASISGLMDLPEDARKMGATPRWMGYVGVNDVDTTADRIKRLGGAVYVPPTDTNIGRISVVADPQTATLALVTGLKHGQQQPDELDELGHVGWHELLAADWEKAFAFYGELFSWQKAGAEMGPTNTYQLFSARGRTIGGIFTKRPIEPVPYWLYYFNIGDIDAAAERVKTGGGKIFEGPIEVPGGSWIARCIDPQGAIFALQGERSQDGIGRIPVSEVGWSTEWGGFSSKGRLLVTRPRGKGRTSDSGH

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
167 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
171 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
172 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
173 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
174 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
175 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 14.29
Rhizosphere 72.67
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0000717 3300046524 Bacteria 35307
2 Ga0070680_100090726 3300005336 Bacteria 2530
3 Ga0070659_100166942 3300005366 Bacteria 1801
4 Ga0070709_10001849 3300005434 Bacteria 11478
5 Ga0070714_100011453 3300005435 Bacteria 7035
6 Ga0070714_100111783 3300005435 Bacteria 2420
7 Ga0070713_100001684 3300005436 Bacteria 14203
8 Ga0070713_100031771 3300005436 Bacteria 4209
9 Ga0070710_10054038 3300005437 Bacteria 2265
10 Ga0070710_10202881 3300005437 Bacteria 1253
11 Ga0070711_100006926 3300005439 Bacteria 6873
12 Ga0070711_100012073 3300005439 Bacteria 5386
13 Ga0070711_100119744 3300005439 Bacteria 1945
14 Ga0070706_100124625 3300005467 Bacteria 2402
15 Ga0070707_100127185 3300005468 Bacteria 2476
16 Ga0070707_100434888 3300005468 Unclassified 1272
17 Ga0070698_100100804 3300005471 Bacteria 2860
18 Ga0070697_100069484 3300005536 Bacteria 2885
19 Ga0068856_100000223 3300005614 Bacteria 61437
20 Ga0068856_100526898 3300005614 Bacteria 1203
21 Ga0068852_100004292 3300005616 Bacteria 10058
22 Ga0068860_100000738 3300005843 Bacteria 37292
23 Ga0081455_10034155 3300005937 Bacteria 4560
24 Ga0070717_10017930 3300006028 Bacteria 5520
25 Ga0070717_10101099 3300006028 Bacteria 2448
26 Ga0070717_10141012 3300006028 Bacteria 2079
27 Ga0075365_10003258 3300006038 Bacteria 8318
28 Ga0070716_100014627 3300006173 Bacteria 4023
29 Ga0070716_100243901 3300006173 Bacteria 1220
30 Ga0070712_100002853 3300006175 Bacteria 10698
31 Ga0070712_100035528 3300006175 Bacteria 3383
32 Ga0075428_100045124 3300006844 Bacteria 4843
33 Ga0075428_100346775 3300006844 Unclassified 1594
34 Ga0075431_100035366 3300006847 Bacteria 5143
35 Ga0075434_100183080 3300006871 Bacteria 2116
36 Ga0075436_100054245 3300006914 Bacteria 2767
37 Ga0075435_100152943 3300007076 Bacteria 1941
38 Ga0099794_10015423 3300007265 Bacteria 3373
39 Ga0099794_10060457 3300007265 Bacteria 1840
40 Ga0099795_10007646 3300007788 Bacteria 3030
41 Ga0114129_10002785 3300009147 Bacteria 24368
42 Ga0114129_10313371 3300009147 Unclassified 2088
43 Ga0099796_10059989 3300010159 Bacteria 1345
44 Ga0105239_10445358 3300010375 Bacteria 1469
45 Ga0105246_10244890 3300011119 Bacteria 1419
46 Ga0163162_10094032 3300013306 Bacteria 3083
47 Ga0163162_10143800 3300013306 Bacteria 2499
48 Ga0163163_10126470 3300014325 Bacteria 2594
49 Ga0213874_10019128 3300021377 Bacteria 1861
50 Ga0213876_10066093 3300021384 Bacteria 1909
51 Ga0213876_10090464 3300021384 Bacteria 1621
52 Ga0209677_100712 3300025253 Bacteria 16943
53 Ga0209455_1001313 3300025272 Bacteria 11517
54 Ga0207692_10002552 3300025898 Bacteria 6999
55 Ga0207692_10139085 3300025898 Bacteria 1379
56 Ga0207699_10000402 3300025906 Bacteria 22366
57 Ga0207699_10086002 3300025906 Bacteria 1963
58 Ga0207684_10092482 3300025910 Bacteria 2578
59 Ga0207693_10009257 3300025915 Bacteria 8041
60 Ga0207693_10013329 3300025915 Bacteria 6628
61 Ga0207693_10042857 3300025915 Bacteria 3562
62 Ga0207693_10051863 3300025915 Bacteria 3218
63 Ga0207663_10004664 3300025916 Bacteria 6840
64 Ga0207663_10020457 3300025916 Bacteria 3747
65 Ga0207663_10144144 3300025916 Bacteria 1663
66 Ga0207663_10409250 3300025916 Bacteria 1039
67 Ga0207663_10445597 3300025916 Bacteria 998
68 Ga0207660_10211535 3300025917 Bacteria 1519
69 Ga0207646_10034481 3300025922 Bacteria 4574
70 Ga0207650_10015472 3300025925 Bacteria 5314
71 Ga0207700_10149408 3300025928 Bacteria 1929
72 Ga0207700_10159471 3300025928 Unclassified 1872
73 Ga0207664_10003804 3300025929 Bacteria 10131
74 Ga0207664_10245331 3300025929 Bacteria 1561
75 Ga0207665_10018837 3300025939 Bacteria 4537
76 Ga0207665_10023254 3300025939 Bacteria 4082
77 Ga0207665_10201047 3300025939 Bacteria 1452
78 Ga0207702_10000252 3300026078 Bacteria 62099
79 Ga0209179_1003326 3300027512 Bacteria 2303
80 Ga0209588_1017915 3300027671 Bacteria 2201
81 Ga0209588_1028840 3300027671 Bacteria 1768
82 Ga0268264_10000043 3300028381 Bacteria 371761
83 Ga0307511_10063356 3300030521 Bacteria 2793
84 Ga0265330_10011970 3300031235 Bacteria 4061
85 Ga0265330_10019311 3300031235 Bacteria 3125
86 Ga0265330_10051613 3300031235 Bacteria 1803
87 Ga0265332_10087488 3300031238 Bacteria 1319
88 Ga0265325_10020234 3300031241 Bacteria 3670
89 Ga0265340_10006940 3300031247 Bacteria 6182
90 Ga0265339_10013055 3300031249 Bacteria 5046
91 Ga0265331_10183874 3300031250 Bacteria 944
92 Ga0265316_10125494 3300031344 Bacteria 1936
93 Ga0307509_10007300 3300031507 Bacteria 14505
94 Ga0265314_10019785 3300031711 Bacteria 5205
95 Ga0265314_10083162 3300031711 Bacteria 2105
96 Ga0265342_10012196 3300031712 Bacteria 5830
97 Ga0307516_10044576 3300031730 Bacteria 4386
98 Ga0373934_0000684 3300035086 Bacteria 12034
99 Ga0373923_0006405 3300035111 Bacteria 4068
100 Ga0373945_0105372 3300035116 Bacteria 1108
101 Ga0373953_0001571 3300035117 Bacteria 6674
102 Ga0373954_0000045 3300035118 Bacteria 43877
103 Ga0373956_0000635 3300035119 Bacteria 14416
104 Ga0373957_0002617 3300035120 Bacteria 5167
105 Ga0373943_0017509 3300035170 Bacteria 3279
106 Ga0373943_0060400 3300035170 Bacteria 1892
107 Ga0373943_0152409 3300035170 Bacteria 1253
108 Ga0373955_0000519 3300035172 Bacteria 16383
109 Ga0373955_0021855 3300035172 Bacteria 3237
110 Ga0373924_0012586 3300035410 Bacteria 3164
111 Ga0373935_0005625 3300035692 Bacteria 7396
112 Ga0373935_0024445 3300035692 Bacteria 3718
113 Ga0373935_0279990 3300035692 Bacteria 1174
114 Ga0373927_0005430 3300035695 Bacteria 8791
115 Ga0373927_0177846 3300035695 Bacteria 1395
116 Ga0373927_0179230 3300035695 Bacteria 1390
117 Ga0373927_0510012 3300035695 Bacteria 795
118 Ga0373933_0000309 3300035724 Bacteria 31558
119 Ga0373933_0001241 3300035724 Bacteria 15060
120 Ga0373933_0134156 3300035724 Bacteria 1559
121 Ga0373947_0001315 3300035725 Bacteria 15282
122 Ga0373947_0066645 3300035725 Bacteria 2198
123 Ga0373947_0126238 3300035725 Bacteria 1629
124 Ga0373947_0408113 3300035725 Bacteria 917
125 Ga0373937_0000742 3300036401 Bacteria 28122
126 Ga0373925_0011156 3300037068 Bacteria 6519
127 Ga0373925_0285269 3300037068 Bacteria 1330
128 Ga0395898_0084045 3300037466 Bacteria 3068
129 Ga0395898_0128334 3300037466 Bacteria 2429
130 Ga0436364_0842179 3300037853 Bacteria 2638
131 Ga0395901_0061904 3300038443 Bacteria 3894
132 Ga0395901_0468859 3300038443 Unclassified 1286
133 Ga0436365_0266325 3300039437 Bacteria 3378
134 Ga0436365_1544996 3300039437 Bacteria 1378
135 Ga0436360_0871242 3300039438 Bacteria 4560
136 Ga0436360_1048554 3300039438 Bacteria 1660
137 Ga0436361_0811173 3300039447 Bacteria 3334
138 Ga0436362_1080477 3300039453 Bacteria 3176
139 Ga0466957_0035515 3300044842 Bacteria 2991
140 Ga0466957_0181513 3300044842 Bacteria 1375
141 Ga0495592_0000436 3300046454 Bacteria 31448
142 Ga0495603_0000973 3300046455 Bacteria 16500
143 Ga0495603_0018025 3300046455 Bacteria 4272
144 Ga0495603_0297676 3300046455 Bacteria 927
145 Ga0495629_0000257 3300046459 Bacteria 46305
146 Ga0495629_0007812 3300046459 Bacteria 7872
147 Ga0495629_0043070 3300046459 Bacteria 3170
148 Ga0495641_0001299 3300046461 Bacteria 21378
149 Ga0495651_0003296 3300046462 Bacteria 12393
150 Ga0495651_0067689 3300046462 Bacteria 2724
151 Ga0495653_0000288 3300046463 Bacteria 40866
152 Ga0495580_0005912 3300046472 Bacteria 10032
153 Ga0495580_0084298 3300046472 Bacteria 2214
154 Ga0495580_0203532 3300046472 Bacteria 1363
155 Ga0495582_0000147 3300046473 Bacteria 38047
156 Ga0495582_0054225 3300046473 Bacteria 2211
157 Ga0495639_0000208 3300046475 Bacteria 30262
158 Ga0495662_0000481 3300046476 Bacteria 18127
159 Ga0495662_0251599 3300046476 Bacteria 870
160 Ga0495664_0030194 3300046477 Bacteria 3174
161 Ga0495664_0073535 3300046477 Bacteria 2044
162 Ga0495664_0150277 3300046477 Bacteria 1412
163 Ga0495584_0003274 3300046491 Bacteria 8975
164 Ga0495584_0004962 3300046491 Bacteria 7095
165 Ga0495594_0000210 3300046499 Bacteria 28417
166 Ga0495594_0124599 3300046499 Bacteria 1457
167 Ga0495594_0228727 3300046499 Bacteria 1060
168 Ga0495608_0001126 3300046511 Bacteria 18919
169 Ga0495618_0013659 3300046514 Bacteria 4942
170 Ga0495628_0006231 3300046516 Bacteria 10425
171 Ga0495628_0048779 3300046516 Bacteria 3355
172 Ga0495630_0001774 3300046517 Bacteria 15095
173 Ga0495630_0091184 3300046517 Bacteria 2303
174 Ga0495630_0399249 3300046517 Bacteria 1053
175 Ga0495648_0139978 3300046524 Bacteria 1275
176 Ga0495652_0027000 3300046529 Bacteria 5063
177 Ga0495665_0001062 3300046531 Bacteria 14587
178 Ga0495640_0006496 3300046533 Bacteria 9245
179 Ga0495640_0019430 3300046533 Bacteria 5014
180 Ga0495640_0047587 3300046533 Bacteria 2967
181 Ga0495640_0116609 3300046533 Bacteria 1739
182 Ga0495587_0000584 3300046536 Bacteria 25102
183 Ga0495645_0005968 3300046543 Bacteria 8423
184 Ga0495645_0029929 3300046543 Bacteria 3966
185 Ga0495622_0001415 3300046557 Bacteria 12122
186 Ga0495667_0000700 3300046559 Bacteria 21464
187 Ga0495667_0035025 3300046559 Bacteria 3357
188 Ga0495634_0032784 3300046642 Bacteria 3570
189 Ga0495634_0139805 3300046642 Bacteria 1538
190 Ga0495635_0000040 3300046663 Bacteria 86519
191 Ga0495635_0000783 3300046663 Bacteria 20722
192 Ga0495657_0001715 3300046675 Bacteria 18791
193 Ga0495599_0000120 3300046678 Bacteria 53081
194 Ga0495623_0006814 3300046679 Bacteria 7431
195 Ga0495646_0000362 3300046680 Bacteria 23481
196 Ga0495646_0032756 3300046680 Bacteria 3233
197 Ga0495647_0004778 3300046681 Bacteria 4421
198 Ga0495658_0002502 3300046683 Bacteria 9245
199 Ga0495658_0037156 3300046683 Bacteria 2691
200 Ga0495658_0225887 3300046683 Bacteria 1173
201 Ga0495613_0004507 3300046689 Bacteria 10440
202 Ga0495613_0045370 3300046689 Bacteria 3251
203 Ga0495613_0054128 3300046689 Bacteria 2951
204 Ga0495624_0003723 3300046690 Bacteria 11277
205 Ga0495600_0000074 3300046809 Bacteria 55182
206 Ga0495600_0046094 3300046809 Bacteria 2845
207 Ga0495581_0008477 3300047315 Bacteria 5960
208 Ga0495581_0106941 3300047315 Bacteria 1626
209 Ga0495604_0001303 3300047317 Bacteria 20381
210 Ga0495604_0147620 3300047317 Bacteria 1674
211 Ga0495674_0001793 3300047319 Bacteria 21161
212 Ga0495674_0008952 3300047319 Bacteria 9513
213 Ga0495674_0031296 3300047319 Bacteria 4835
214 Ga0495674_0031844 3300047319 Bacteria 4785
215 Ga0495674_0309050 3300047319 Bacteria 1290
216 Ga0495680_0001054 3300047322 Bacteria 30518
217 Ga0495680_0096968 3300047322 Bacteria 2201
218 Ga0495675_0000382 3300047444 Bacteria 30557
219 Ga0495675_0218090 3300047444 Unclassified 1156
220 Ga0495684_0000134 3300047471 Bacteria 54180
221 Ga0495593_0000093 3300047673 Bacteria 39845
222 Ga0495593_0000328 3300047673 Bacteria 26353
223 Ga0495593_0139478 3300047673 Unclassified 1228
224 Ga0495602_0002953 3300048088 Bacteria 17450
225 Ga0496100_0059690 3300048903 Bacteria 2507
226 Ga0496100_0308103 3300048903 Bacteria 1187
227 Ga0496101_0308873 3300048904 Bacteria 1239
228 Ga0496101_0356236 3300048904 Bacteria 1150
229 Ga0496102_0018894 3300048905 Bacteria 6064
230 Ga0496103_0323716 3300048906 Bacteria 991
231 Ga0496104_0003725 3300048907 Bacteria 13166
232 Ga0496104_0077707 3300048907 Bacteria 3162
233 Ga0496104_0283077 3300048907 Bacteria 1571
234 Ga0496104_0311043 3300048907 Bacteria 1488
235 Ga0496105_0002639 3300048908 Bacteria 13052
236 Ga0496105_0003904 3300048908 Bacteria 11146
237 Ga0496105_0007955 3300048908 Bacteria 8242
238 Ga0496105_0146744 3300048908 Bacteria 1940
239 Ga0496105_0425533 3300048908 Bacteria 1051
240 Ga0496106_0001834 3300048909 Bacteria 15911
241 Ga0496106_0002531 3300048909 Bacteria 13611
242 Ga0496106_0030056 3300048909 Bacteria 4051
243 Ga0496107_0054602 3300048910 Bacteria 2883
244 Ga0496107_0116997 3300048910 Bacteria 1963
245 Ga0496108_0000324 3300048911 Bacteria 40566
246 Ga0496108_0000420 3300048911 Bacteria 34749
247 Ga0496108_0003526 3300048911 Bacteria 12545
248 Ga0496108_0365148 3300048911 Bacteria 1260
249 Ga0496109_0000729 3300048912 Bacteria 27409
250 Ga0496109_0002441 3300048912 Bacteria 15568
251 Ga0496109_0002651 3300048912 Bacteria 15007
252 Ga0496109_0443040 3300048912 Bacteria 1227
253 Ga0496109_0700639 3300048912 Unclassified 950
254 Ga0496110_0009764 3300048913 Bacteria 7773
255 Ga0496110_0013672 3300048913 Bacteria 6722
256 Ga0496110_0043747 3300048913 Bacteria 3910
257 Ga0496111_0008945 3300048914 Bacteria 6660
258 Ga0496111_0085781 3300048914 Bacteria 2303
259 Ga0496111_0092654 3300048914 Unclassified 2215
260 Ga0496111_0147389 3300048914 Bacteria 1745
261 Ga0496112_0005359 3300048915 Bacteria 11081
262 Ga0496112_0016560 3300048915 Bacteria 6910
263 Ga0496112_0081057 3300048915 Bacteria 3209
264 Ga0496113_0000230 3300048916 Bacteria 26363
265 Ga0496113_0050634 3300048916 Bacteria 3097
266 Ga0496113_0083654 3300048916 Bacteria 2449
267 Ga0496113_0433689 3300048916 Bacteria 1056
268 Ga0496114_0029416 3300048917 Bacteria 4515
269 Ga0496114_0226064 3300048917 Bacteria 1644
270 Ga0496115_0063712 3300048918 Bacteria 2974
271 Ga0496117_0013461 3300048920 Bacteria 7135
272 Ga0496117_0074565 3300048920 Bacteria 2258
273 Ga0496118_0004967 3300048921 Bacteria 15383
274 Ga0496121_0000328 3300048924 Bacteria 99421
275 Ga0496121_0042729 3300048924 Bacteria 3937
276 Ga0496121_0051955 3300048924 Bacteria 3447
277 Ga0496124_0000405 3300048927 Bacteria 78090
278 Ga0496125_0098782 3300048928 Bacteria 2159
279 Ga0496126_0002961 3300048929 Bacteria 22065
280 Ga0496126_0008935 3300048929 Bacteria 10730
281 Ga0496126_0139507 3300048929 Bacteria 2088
282 nmdc:mga0yw44_3124_c1 3300050492 Bacteria 7270
283 nmdc:mga05p37_291019_c1 3300050507 Bacteria 1944
284 nmdc:mga05p37_30701_c1 3300050507 Bacteria 6031
285 nmdc:mga09592_138807_c1 3300050508 Unclassified 2094
286 nmdc:mga06r32_160156_c1 3300050510 Bacteria 2233
287 nmdc:mga0n895_11697_c1 3300050512 Bacteria 7842
288 nmdc:mga0n895_310874_c1 3300050512 Bacteria 1597
289 nmdc:mga0n895_438922_c1 3300050512 Bacteria 1319
290 nmdc:mga08x19_25968_c1 3300050514 Bacteria 3652
291 Ga0495601_0000951 3300053077 Bacteria 15792
292 Ga0495601_0016673 3300053077 Bacteria 4454
293 Ga0495612_0008624 3300053078 Bacteria 4134
294 Ga0495612_0035604 3300053078 Bacteria 2018
295 Ga0495612_0072392 3300053078 Unclassified 1439
296 Ga0495612_0193847 3300053078 Bacteria 895
297 Ga0495595_0000064 3300053084 Bacteria 54079
298 Ga0495595_0186748 3300053084 Bacteria 1029
299 Ga0495619_0000395 3300053085 Bacteria 29741
300 Ga0495619_0010188 3300053085 Bacteria 5921
301 Ga0495619_0013619 3300053085 Bacteria 5125
302 Ga0495619_0036110 3300053085 Bacteria 3217
303 Ga0495619_0080885 3300053085 Bacteria 2187
304 Ga0495619_0153736 3300053085 Bacteria 1587
305 Ga0500647_0012475 3300053091 Bacteria 3827
306 Ga0500566_0000010 3300053094 Bacteria 119976
307 Ga0500566_0028136 3300053094 Bacteria 3286
308 Ga0500640_000247 3300053095 Bacteria 11954
309 Ga0500572_000031 3300053111 Bacteria 43489
310 Ga0500572_000438 3300053111 Bacteria 14626
311 Ga0500595_035178 3300053119 Bacteria 1651
312 Ga0500559_0000408 3300053136 Bacteria 30885
313 Ga0500603_000083 3300053150 Bacteria 21978
314 Ga0500603_005739 3300053150 Bacteria 2681
315 Ga0500630_001852 3300053159 Bacteria 10168
316 Ga0500639_000084 3300053163 Bacteria 44199
317 Ga0500636_0003076 3300053177 Bacteria 9352
318 Ga0500636_0093142 3300053177 Bacteria 1723
319 Ga0500636_0161662 3300053177 Bacteria 1220
320 Ga0500657_083164 3300053728 Bacteria 1369
321 Ga0500596_000468 3300053735 Bacteria 7527
322 Ga0500596_002753 3300053735 Bacteria 3442
323 Ga0495648_0000717
324 Ga0070680_100090726
325 Ga0070659_100166942
326 Ga0070709_10001849
327 Ga0070714_100011453
328 Ga0070714_100111783
329 Ga0070713_100001684
330 Ga0070713_100031771
331 Ga0070710_10054038
332 Ga0070710_10202881
333 Ga0070711_100006926
334 Ga0070711_100012073
335 Ga0070711_100119744
336 Ga0070706_100124625
337 Ga0070707_100127185
338 Ga0070707_100434888
339 Ga0070698_100100804
340 Ga0070697_100069484
341 Ga0068856_100000223
342 Ga0068856_100526898
343 Ga0068852_100004292
344 Ga0068860_100000738
345 Ga0081455_10034155
346 Ga0070717_10017930
347 Ga0070717_10101099
348 Ga0070717_10141012
349 Ga0075365_10003258
350 Ga0070716_100014627
351 Ga0070716_100243901
352 Ga0070712_100002853
353 Ga0070712_100035528
354 Ga0075428_100045124
355 Ga0075428_100346775
356 Ga0075431_100035366
357 Ga0075434_100183080
358 Ga0075436_100054245
359 Ga0075435_100152943
360 Ga0099794_10015423
361 Ga0099794_10060457
362 Ga0099795_10007646
363 Ga0114129_10002785
364 Ga0114129_10313371
365 Ga0099796_10059989
366 Ga0105239_10445358
367 Ga0105246_10244890
368 Ga0163162_10094032
369 Ga0163162_10143800
370 Ga0163163_10126470
371 Ga0213874_10019128
372 Ga0213876_10066093
373 Ga0213876_10090464
374 Ga0209677_100712
375 Ga0209455_1001313
376 Ga0207692_10002552
377 Ga0207692_10139085
378 Ga0207699_10000402
379 Ga0207699_10086002
380 Ga0207684_10092482
381 Ga0207693_10009257
382 Ga0207693_10013329
383 Ga0207693_10042857
384 Ga0207693_10051863
385 Ga0207663_10004664
386 Ga0207663_10020457
387 Ga0207663_10144144
388 Ga0207663_10409250
389 Ga0207663_10445597
390 Ga0207660_10211535
391 Ga0207646_10034481
392 Ga0207650_10015472
393 Ga0207700_10149408
394 Ga0207700_10159471
395 Ga0207664_10003804
396 Ga0207664_10245331
397 Ga0207665_10018837
398 Ga0207665_10023254
399 Ga0207665_10201047
400 Ga0207702_10000252
401 Ga0209179_1003326
402 Ga0209588_1017915
403 Ga0209588_1028840
404 Ga0268264_10000043
405 Ga0307511_10063356
406 Ga0265330_10011970
407 Ga0265330_10019311
408 Ga0265330_10051613
409 Ga0265332_10087488
410 Ga0265325_10020234
411 Ga0265340_10006940
412 Ga0265339_10013055
413 Ga0265331_10183874
414 Ga0265316_10125494
415 Ga0307509_10007300
416 Ga0265314_10019785
417 Ga0265314_10083162
418 Ga0265342_10012196
419 Ga0307516_10044576
420 Ga0373934_0000684
421 Ga0373923_0006405
422 Ga0373945_0105372
423 Ga0373953_0001571
424 Ga0373954_0000045
425 Ga0373956_0000635
426 Ga0373957_0002617
427 Ga0373943_0017509
428 Ga0373943_0060400
429 Ga0373943_0152409
430 Ga0373955_0000519
431 Ga0373955_0021855
432 Ga0373924_0012586
433 Ga0373935_0005625
434 Ga0373935_0024445
435 Ga0373935_0279990
436 Ga0373927_0005430
437 Ga0373927_0177846
438 Ga0373927_0179230
439 Ga0373927_0510012
440 Ga0373933_0000309
441 Ga0373933_0001241
442 Ga0373933_0134156
443 Ga0373947_0001315
444 Ga0373947_0066645
445 Ga0373947_0126238
446 Ga0373947_0408113
447 Ga0373937_0000742
448 Ga0373925_0011156
449 Ga0373925_0285269
450 Ga0395898_0084045
451 Ga0395898_0128334
452 Ga0436364_0842179
453 Ga0395901_0061904
454 Ga0395901_0468859
455 Ga0436365_0266325
456 Ga0436365_1544996
457 Ga0436360_0871242
458 Ga0436360_1048554
459 Ga0436361_0811173
460 Ga0436362_1080477
461 Ga0466957_0035515
462 Ga0466957_0181513
463 Ga0495592_0000436
464 Ga0495603_0000973
465 Ga0495603_0018025
466 Ga0495603_0297676
467 Ga0495629_0000257
468 Ga0495629_0007812
469 Ga0495629_0043070
470 Ga0495641_0001299
471 Ga0495651_0003296
472 Ga0495651_0067689
473 Ga0495653_0000288
474 Ga0495580_0005912
475 Ga0495580_0084298
476 Ga0495580_0203532
477 Ga0495582_0000147
478 Ga0495582_0054225
479 Ga0495639_0000208
480 Ga0495662_0000481
481 Ga0495662_0251599
482 Ga0495664_0030194
483 Ga0495664_0073535
484 Ga0495664_0150277
485 Ga0495584_0003274
486 Ga0495584_0004962
487 Ga0495594_0000210
488 Ga0495594_0124599
489 Ga0495594_0228727
490 Ga0495608_0001126
491 Ga0495618_0013659
492 Ga0495628_0006231
493 Ga0495628_0048779
494 Ga0495630_0001774
495 Ga0495630_0091184
496 Ga0495630_0399249
497 Ga0495648_0139978
498 Ga0495652_0027000
499 Ga0495665_0001062
500 Ga0495640_0006496
501 Ga0495640_0019430
502 Ga0495640_0047587
503 Ga0495640_0116609
504 Ga0495587_0000584
505 Ga0495645_0005968
506 Ga0495645_0029929
507 Ga0495622_0001415
508 Ga0495667_0000700
509 Ga0495667_0035025
510 Ga0495634_0032784
511 Ga0495634_0139805
512 Ga0495635_0000040
513 Ga0495635_0000783
514 Ga0495657_0001715
515 Ga0495599_0000120
516 Ga0495623_0006814
517 Ga0495646_0000362
518 Ga0495646_0032756
519 Ga0495647_0004778
520 Ga0495658_0002502
521 Ga0495658_0037156
522 Ga0495658_0225887
523 Ga0495613_0004507
524 Ga0495613_0045370
525 Ga0495613_0054128
526 Ga0495624_0003723
527 Ga0495600_0000074
528 Ga0495600_0046094
529 Ga0495581_0008477
530 Ga0495581_0106941
531 Ga0495604_0001303
532 Ga0495604_0147620
533 Ga0495674_0001793
534 Ga0495674_0008952
535 Ga0495674_0031296
536 Ga0495674_0031844
537 Ga0495674_0309050
538 Ga0495680_0001054
539 Ga0495680_0096968
540 Ga0495675_0000382
541 Ga0495675_0218090
542 Ga0495684_0000134
543 Ga0495593_0000093
544 Ga0495593_0000328
545 Ga0495593_0139478
546 Ga0495602_0002953
547 Ga0496100_0059690
548 Ga0496100_0308103
549 Ga0496101_0308873
550 Ga0496101_0356236
551 Ga0496102_0018894
552 Ga0496103_0323716
553 Ga0496104_0003725
554 Ga0496104_0077707
555 Ga0496104_0283077
556 Ga0496104_0311043
557 Ga0496105_0002639
558 Ga0496105_0003904
559 Ga0496105_0007955
560 Ga0496105_0146744
561 Ga0496105_0425533
562 Ga0496106_0001834
563 Ga0496106_0002531
564 Ga0496106_0030056
565 Ga0496107_0054602
566 Ga0496107_0116997
567 Ga0496108_0000324
568 Ga0496108_0000420
569 Ga0496108_0003526
570 Ga0496108_0365148
571 Ga0496109_0000729
572 Ga0496109_0002441
573 Ga0496109_0002651
574 Ga0496109_0443040
575 Ga0496109_0700639
576 Ga0496110_0009764
577 Ga0496110_0013672
578 Ga0496110_0043747
579 Ga0496111_0008945
580 Ga0496111_0085781
581 Ga0496111_0092654
582 Ga0496111_0147389
583 Ga0496112_0005359
584 Ga0496112_0016560
585 Ga0496112_0081057
586 Ga0496113_0000230
587 Ga0496113_0050634
588 Ga0496113_0083654
589 Ga0496113_0433689
590 Ga0496114_0029416
591 Ga0496114_0226064
592 Ga0496115_0063712
593 Ga0496117_0013461
594 Ga0496117_0074565
595 Ga0496118_0004967
596 Ga0496121_0000328
597 Ga0496121_0042729
598 Ga0496121_0051955
599 Ga0496124_0000405
600 Ga0496125_0098782
601 Ga0496126_0002961
602 Ga0496126_0008935
603 Ga0496126_0139507
604 nmdc:mga0yw44_3124_c1
605 nmdc:mga05p37_291019_c1
606 nmdc:mga05p37_30701_c1
607 nmdc:mga09592_138807_c1
608 nmdc:mga06r32_160156_c1
609 nmdc:mga0n895_11697_c1
610 nmdc:mga0n895_310874_c1
611 nmdc:mga0n895_438922_c1
612 nmdc:mga08x19_25968_c1
613 Ga0495601_0000951
614 Ga0495601_0016673
615 Ga0495612_0008624
616 Ga0495612_0035604
617 Ga0495612_0072392
618 Ga0495612_0193847
619 Ga0495595_0000064
620 Ga0495595_0186748
621 Ga0495619_0000395
622 Ga0495619_0010188
623 Ga0495619_0013619
624 Ga0495619_0036110
625 Ga0495619_0080885
626 Ga0495619_0153736
627 Ga0500647_0012475
628 Ga0500566_0000010
629 Ga0500566_0028136
630 Ga0500640_000247
631 Ga0500572_000031
632 Ga0500572_000438
633 Ga0500595_035178
634 Ga0500559_0000408
635 Ga0500603_000083
636 Ga0500603_005739
637 Ga0500630_001852
638 Ga0500639_000084
639 Ga0500636_0003076
640 Ga0500636_0093142
641 Ga0500636_0161662
642 Ga0500657_083164
643 Ga0500596_000468
644 Ga0500596_002753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

161

275

0.92

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

145

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9116 31 280
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8564 31 280
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7726 163 278
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7517 157 278
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.7359 165 275
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9239 32 152 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9093 32 152 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8991 32 149 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.881 32 157 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8732 32 147 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q4CU26-F1-model_v4 VOC family protein 0.9501 30 124
AF-A0A2S9H2Q0-F1-model_v4 Glyoxalase-like domain 0.9494 34 280
AF-A0A7Z6L6H8-F1-model_v4 deleted 0.9454 31 279
AF-A5PBN1-F1-model_v4 VOC domain-containing protein 0.9403 31 280
AF-A0A522HD40-F1-model_v4 VOC family protein 0.9382 31 279

Map