F406549

General Info

Members Datasets Scaffolds Average Seq Length
322 213 645 169

Family's Representative Sequence

Representative Sequence 3300042128|Ga0450897_016664|Ga0450897_016664_109_705
Length 198
Sequence VREFRILITQLFRGKAFLIFIKLIHLKFMIMTSIELKNLQAPLKEQYKLQPDSAIITLKAQGKIGEGISCKVETGRAIVEAGLHPATGGDGLFACSGDLLLEALVACAGVTLRAVATAIGVEIKDGIIKAEGDLDFKGTLGVSKEVPVGFKAIRLEFFIESNAEQEQMDSLMKLTERYCVVYQTLNKGVKIETFLTTH

Samples

Sample ID Description Type Environment
1 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
159 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 1.55
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 13.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450897_016664 3300042128 Bacteria 759
2 rootH1_10078002 3300003316 Bacteria 1800
3 rootH1_10078002 3300003323 Bacteria 1175
4 rootH2_10075009 3300003320 Bacteria 6859
5 rootL2_10198541 3300003322 Bacteria 3298
6 Ga0065707_10196211 3300005295 Bacteria 1321
7 Ga0070658_10001278 3300005327 Bacteria 21502
8 Ga0070658_11132957 3300005327 Unclassified 680
9 Ga0070676_10001633 3300005328 Bacteria 11402
10 Ga0070683_101285224 3300005329 Bacteria 703
11 Ga0070677_10164330 3300005333 Bacteria 1044
12 Ga0068869_100008785 3300005334 Bacteria 6533
13 Ga0068869_100017344 3300005334 Unclassified 4878
14 Ga0070666_10000107 3300005335 Bacteria 57059
15 Ga0070666_10139502 3300005335 Bacteria 1688
16 Ga0068868_100000401 3300005338 Bacteria 29470
17 Ga0068868_100560116 3300005338 Bacteria 1008
18 Ga0070660_100000286 3300005339 Bacteria 33602
19 Ga0070660_100077693 3300005339 Bacteria 2602
20 Ga0070661_100255026 3300005344 Bacteria 1355
21 Ga0070668_100000017 3300005347 Bacteria 100828
22 Ga0070668_101211956 3300005347 Bacteria 684
23 Ga0070675_100504538 3300005354 Bacteria 1090
24 Ga0070675_101307038 3300005354 Unclassified 668
25 Ga0070673_100001453 3300005364 Bacteria 13877
26 Ga0070673_100029016 3300005364 Unclassified 4122
27 Ga0070688_100425028 3300005365 Bacteria 988
28 Ga0070659_100007778 3300005366 Bacteria 7796
29 Ga0070659_100012277 3300005366 Bacteria 6352
30 Ga0070659_100304386 3300005366 Bacteria 1330
31 Ga0070667_100000376 3300005367 Bacteria 48890
32 Ga0070667_100045192 3300005367 Unclassified 3702
33 Ga0070667_100403084 3300005367 Bacteria 1245
34 Ga0070667_100750862 3300005367 Unclassified 904
35 Ga0070705_100208569 3300005440 Bacteria 1345
36 Ga0070694_100097942 3300005444 Bacteria 2070
37 Ga0070694_100363352 3300005444 Bacteria 1125
38 Ga0070678_100095030 3300005456 Unclassified 2296
39 Ga0070678_100193859 3300005456 Bacteria 1672
40 Ga0070678_100766379 3300005456 Bacteria 874
41 Ga0070662_100021882 3300005457 Bacteria 4370
42 Ga0070681_10940312 3300005458 Bacteria 783
43 Ga0068867_100149873 3300005459 Bacteria 1831
44 Ga0070706_101415013 3300005467 Bacteria 636
45 Ga0070699_100556902 3300005518 Bacteria 1044
46 Ga0070679_100088872 3300005530 Bacteria 3076
47 Ga0070679_100162812 3300005530 Bacteria 2205
48 Ga0070684_100134748 3300005535 Unclassified 2230
49 Ga0070684_100179722 3300005535 Unclassified 1923
50 Ga0070684_100634343 3300005535 Unclassified 994
51 Ga0068853_100006075 3300005539 Bacteria 9560
52 Ga0068853_100125980 3300005539 Unclassified 2288
53 Ga0068853_100326318 3300005539 Unclassified 1424
54 Ga0070672_100000053 3300005543 Bacteria 51215
55 Ga0070686_100062476 3300005544 Unclassified 2410
56 Ga0070695_100363480 3300005545 Bacteria 1087
57 Ga0070693_100257189 3300005547 Bacteria 1160
58 Ga0070665_100002783 3300005548 Bacteria 18963
59 Ga0070665_100276415 3300005548 Bacteria 1681
60 Ga0068855_100029785 3300005563 Bacteria 6527
61 Ga0068855_100102646 3300005563 Unclassified 3291
62 Ga0068855_100173670 3300005563 Bacteria 2439
63 Ga0070664_100082886 3300005564 Bacteria 2766
64 Ga0070664_100086822 3300005564 Bacteria 2703
65 Ga0070664_100215094 3300005564 Bacteria 1718
66 Ga0070664_101123930 3300005564 Unclassified 740
67 Ga0068857_100069247 3300005577 Bacteria 3142
68 Ga0068857_100304501 3300005577 Bacteria 1470
69 Ga0068854_100124008 3300005578 Bacteria 1965
70 Ga0068852_100040205 3300005616 Bacteria 3944
71 Ga0068852_100051046 3300005616 Bacteria 3547
72 Ga0068852_101506514 3300005616 Bacteria 695
73 Ga0068859_100001552 3300005617 Bacteria 23438
74 Ga0068859_100198419 3300005617 Bacteria 2091
75 Ga0068864_100001989 3300005618 Bacteria 16826
76 Ga0068851_10000292 3300005834 Bacteria 22862
77 Ga0068863_100053805 3300005841 Bacteria 3816
78 Ga0068863_100316305 3300005841 Bacteria 1516
79 Ga0068863_101048278 3300005841 Unclassified 819
80 Ga0068858_100000305 3300005842 Bacteria 52454
81 Ga0068860_100001538 3300005843 Bacteria 24844
82 Ga0070716_100266453 3300006173 Bacteria 1175
83 Ga0097621_100007912 3300006237 Bacteria 7625
84 Ga0097621_100016339 3300006237 Bacteria 5608
85 Ga0068871_100013764 3300006358 Bacteria 6015
86 Ga0075428_100004699 3300006844 Bacteria 15119
87 Ga0075430_100679410 3300006846 Bacteria 849
88 Ga0075431_100126778 3300006847 Bacteria 2634
89 Ga0075433_10531892 3300006852 Bacteria 1034
90 Ga0075429_100000786 3300006880 Bacteria 24972
91 Ga0068865_100013537 3300006881 Bacteria 5158
92 Ga0097620_100001552 3300006931 Bacteria 23438
93 Ga0097620_100198435 3300006931 Bacteria 2091
94 Ga0105240_10013917 3300009093 Bacteria 11012
95 Ga0105240_10030162 3300009093 Bacteria 7053
96 Ga0105240_10575178 3300009093 Bacteria 1243
97 Ga0111539_10050994 3300009094 Bacteria 4929
98 Ga0105245_11164810 3300009098 Bacteria 818
99 Ga0105247_10039634 3300009101 Bacteria 2878
100 Ga0114129_10001051 3300009147 Bacteria 36178
101 Ga0105241_10021094 3300009174 Bacteria 4816
102 Ga0105241_10346968 3300009174 Bacteria 1288
103 Ga0105242_10267981 3300009176 Bacteria 1546
104 Ga0105242_10519528 3300009176 Bacteria 1136
105 Ga0105242_11091742 3300009176 Bacteria 811
106 Ga0105248_10082290 3300009177 Bacteria 3619
107 Ga0105237_10105387 3300009545 Bacteria 2811
108 Ga0105238_10143385 3300009551 Bacteria 2365
109 Ga0105249_10018197 3300009553 Bacteria 6246
110 Ga0105239_10044768 3300010375 Bacteria 4850
111 Ga0105239_10076404 3300010375 Bacteria 3684
112 Ga0105239_10339699 3300010375 Bacteria 1695
113 Ga0105239_10795273 3300010375 Bacteria 1084
114 Ga0105246_10079047 3300011119 Bacteria 2338
115 Ga0157320_1025717 3300012481 Bacteria 566
116 Ga0157373_10035823 3300013100 Bacteria 3562
117 Ga0157371_10100740 3300013102 Bacteria 2049
118 Ga0157369_10038056 3300013105 Bacteria 5262
119 Ga0157369_10191113 3300013105 Bacteria 2151
120 Ga0157374_10000356 3300013296 Bacteria 42356
121 Ga0157374_10174636 3300013296 Unclassified 2097
122 Ga0157374_10193487 3300013296 Unclassified 1989
123 Ga0157378_10037109 3300013297 Bacteria 4315
124 Ga0157378_10182533 3300013297 Bacteria 1975
125 Ga0157378_10318727 3300013297 Bacteria 1510
126 Ga0157378_10574160 3300013297 Unclassified 1136
127 Ga0157378_10703697 3300013297 Bacteria 1030
128 Ga0163162_10000417 3300013306 Bacteria 39158
129 Ga0163162_10152343 3300013306 Unclassified 2430
130 Ga0163162_10698591 3300013306 Bacteria 1136
131 Ga0157372_10137689 3300013307 Bacteria 2812
132 Ga0157372_10177086 3300013307 Bacteria 2469
133 Ga0157372_10757220 3300013307 Bacteria 1129
134 Ga0157372_11082898 3300013307 Bacteria 927
135 Ga0157372_11471319 3300013307 Bacteria 785
136 Ga0157375_10000248 3300013308 Bacteria 49146
137 Ga0157375_10004916 3300013308 Bacteria 11625
138 Ga0163163_10000496 3300014325 Bacteria 35448
139 Ga0163163_10322126 3300014325 Unclassified 1599
140 Ga0163163_10445673 3300014325 Bacteria 1354
141 Ga0163163_10549617 3300014325 Bacteria 1217
142 Ga0157380_10217509 3300014326 Bacteria 1707
143 Ga0157377_10054728 3300014745 Bacteria 2260
144 Ga0157379_10000096 3300014968 Bacteria 59172
145 Ga0157379_10054656 3300014968 Bacteria 3568
146 Ga0157376_10000196 3300014969 Bacteria 42092
147 Ga0157376_10042206 3300014969 Bacteria 3738
148 Ga0157376_10591208 3300014969 Bacteria 1104
149 Ga0163161_10039490 3300017792 Bacteria 3389
150 Ga0163161_10053236 3300017792 Unclassified 2935
151 Ga0207697_10034167 3300025315 Bacteria 2082
152 Ga0207656_10001444 3300025321 Bacteria 7878
153 Ga0207682_10091795 3300025893 Bacteria 1317
154 Ga0207710_10020720 3300025900 Bacteria 2812
155 Ga0207680_10000571 3300025903 Bacteria 17448
156 Ga0207680_10106616 3300025903 Bacteria 1810
157 Ga0207680_10532038 3300025903 Bacteria 838
158 Ga0207647_10003048 3300025904 Bacteria 12593
159 Ga0207647_10049839 3300025904 Bacteria 2596
160 Ga0207647_10102490 3300025904 Bacteria 1697
161 Ga0207645_10000231 3300025907 Bacteria 46287
162 Ga0207645_10194159 3300025907 Bacteria 1335
163 Ga0207705_10015134 3300025909 Bacteria 5546
164 Ga0207654_10005886 3300025911 Bacteria 6180
165 Ga0207654_10082751 3300025911 Bacteria 1936
166 Ga0207695_10038151 3300025913 Bacteria 5176
167 Ga0207695_10044742 3300025913 Bacteria 4706
168 Ga0207695_10428107 3300025913 Bacteria 1207
169 Ga0207671_10079987 3300025914 Bacteria 2449
170 Ga0207657_10003805 3300025919 Bacteria 16041
171 Ga0207657_10030054 3300025919 Bacteria 4936
172 Ga0207652_10426838 3300025921 Bacteria 1195
173 Ga0207650_10251470 3300025925 Bacteria 1431
174 Ga0207650_10881734 3300025925 Bacteria 759
175 Ga0207659_10925697 3300025926 Bacteria 750
176 Ga0207644_10330985 3300025931 Bacteria 1233
177 Ga0207644_10654944 3300025931 Bacteria 874
178 Ga0207690_10006995 3300025932 Bacteria 6687
179 Ga0207690_10028725 3300025932 Bacteria 3527
180 Ga0207706_10008470 3300025933 Bacteria 9485
181 Ga0207706_10272634 3300025933 Unclassified 1476
182 Ga0207686_10615312 3300025934 Bacteria 856
183 Ga0207670_11022998 3300025936 Bacteria 696
184 Ga0207665_10270108 3300025939 Bacteria 1262
185 Ga0207691_10000185 3300025940 Bacteria 59033
186 Ga0207689_10019348 3300025942 Bacteria 5739
187 Ga0207689_10044306 3300025942 Bacteria 3678
188 Ga0207679_10065181 3300025945 Bacteria 2725
189 Ga0207679_10201168 3300025945 Bacteria 1664
190 Ga0207679_10226134 3300025945 Bacteria 1577
191 Ga0207667_10051649 3300025949 Bacteria 4332
192 Ga0207667_10176765 3300025949 Bacteria 2193
193 Ga0207651_10001155 3300025960 Bacteria 11797
194 Ga0207651_10349137 3300025960 Bacteria 1245
195 Ga0207712_10009306 3300025961 Bacteria 6214
196 Ga0207668_10001345 3300025972 Bacteria 14564
197 Ga0207640_10056196 3300025981 Unclassified 2582
198 Ga0207640_10223489 3300025981 Bacteria 1443
199 Ga0207640_10420913 3300025981 Bacteria 1093
200 Ga0207658_10000883 3300025986 Bacteria 24963
201 Ga0207658_10037129 3300025986 Bacteria 3498
202 Ga0207658_10310910 3300025986 Bacteria 1361
203 Ga0207677_10947523 3300026023 Bacteria 778
204 Ga0207703_10002120 3300026035 Bacteria 17465
205 Ga0207639_10005712 3300026041 Bacteria 8422
206 Ga0207639_10093364 3300026041 Bacteria 2413
207 Ga0207678_10053661 3300026067 Bacteria 3473
208 Ga0207678_10814363 3300026067 Bacteria 825
209 Ga0207641_10039492 3300026088 Bacteria 3947
210 Ga0207641_10940776 3300026088 Unclassified 859
211 Ga0207641_10968937 3300026088 Bacteria 846
212 Ga0207648_10003092 3300026089 Bacteria 17582
213 Ga0207676_10001327 3300026095 Bacteria 18391
214 Ga0207676_10081049 3300026095 Bacteria 2636
215 Ga0207674_10308420 3300026116 Bacteria 1532
216 Ga0207674_10653063 3300026116 Bacteria 1016
217 Ga0207683_10079771 3300026121 Bacteria 2902
218 Ga0207683_10223668 3300026121 Unclassified 1715
219 Ga0207683_10671858 3300026121 Bacteria 960
220 Ga0207698_10249269 3300026142 Bacteria 1624
221 Ga0207698_10426165 3300026142 Bacteria 1274
222 Ga0207428_10000624 3300027907 Bacteria 41590
223 Ga0268266_10592983 3300028379 Bacteria 1064
224 Ga0268266_11369804 3300028379 Bacteria 683
225 Ga0268265_11094476 3300028380 Bacteria 791
226 Ga0268264_10008634 3300028381 Bacteria 8464
227 Ga0307515_10000092 3300028794 Bacteria 212425
228 Ga0265340_10138216 3300031247 Bacteria 1115
229 Ga0307509_10040059 3300031507 Bacteria 5098
230 Ga0307509_10357162 3300031507 Bacteria 1182
231 Ga0307408_100005867 3300031548 Bacteria 8174
232 Ga0307408_100008309 3300031548 Bacteria 6853
233 Ga0316576_10249853 3300031727 Bacteria 1332
234 Ga0307412_10004949 3300031911 Bacteria 7444
235 Ga0373928_0020051 3300035084 Bacteria 1399
236 Ga0373940_0067530 3300035088 Bacteria 1034
237 Ga0373951_0079790 3300035091 Bacteria 845
238 Ga0373932_0046432 3300035112 Bacteria 1273
239 Ga0373941_0099511 3300035115 Bacteria 1010
240 Ga0373954_0441972 3300035118 Bacteria 644
241 Ga0373957_0155292 3300035120 Unclassified 941
242 Ga0373942_0023575 3300035207 Bacteria 1572
243 Ga0316574_0109388 3300035398 Bacteria 1771
244 Ga0316574_0130686 3300035398 Bacteria 1616
245 Ga0316574_0206492 3300035398 Bacteria 1261
246 Ga0373931_0117988 3300035691 Bacteria 1513
247 Ga0373933_0105358 3300035724 Bacteria 1754
248 Ga0373937_0185431 3300036401 Bacteria 1954
249 Ga0395899_0004492 3300037312 Bacteria 10873
250 Ga0395900_0020562 3300037418 Bacteria 6740
251 Ga0395898_0016900 3300037466 Bacteria 7449
252 Ga0395901_0014935 3300038443 Bacteria 7890
253 Ga0436362_0540189 3300039453 Bacteria 779
254 Ga0439439_0008831 3300041406 Unclassified 2385
255 Ga0439431_0036555 3300041997 Bacteria 1237
256 Ga0439442_003988 3300042002 Bacteria 2924
257 Ga0439445_0048609 3300042004 Bacteria 1141
258 Ga0439462_0007181 3300042015 Bacteria 2787
259 Ga0450923_065153 3300042125 Bacteria 800
260 Ga0450899_006152 3300042135 Bacteria 1296
261 Ga0439446_0047920 3300042156 Bacteria 1272
262 Ga0439434_0032020 3300042435 Unclassified 1600
263 Ga0453684_0027126 3300044712 Bacteria 8231
264 Ga0466971_0188999 3300044719 Bacteria 970
265 Ga0451576_0011347 3300045051 Bacteria 10138
266 Ga0466958_0028435 3300045836 Bacteria 3315
267 Ga0466958_0051869 3300045836 Bacteria 2485
268 Ga0466967_0159941 3300045976 Bacteria 2113
269 Ga0495592_0296493 3300046454 Unclassified 1052
270 Ga0495651_0181499 3300046462 Bacteria 1489
271 Ga0495628_0057112 3300046516 Bacteria 3071
272 Ga0495630_0268995 3300046517 Bacteria 1302
273 Ga0495652_0763445 3300046529 Bacteria 646
274 Ga0495586_0212102 3300046535 Bacteria 1099
275 Ga0495587_0365126 3300046536 Bacteria 804
276 Ga0495667_0368400 3300046559 Unclassified 907
277 Ga0496101_0809633 3300048904 Bacteria 739
278 Ga0496107_0725778 3300048910 Bacteria 730
279 Ga0496109_0063200 3300048912 Bacteria 3386
280 Ga0496110_0224182 3300048913 Bacteria 1710
281 Ga0496114_0259899 3300048917 Bacteria 1529
282 Ga0501031_0201025 3300049568 Unclassified 1300
283 Ga0501032_0010337 3300049569 Bacteria 6728
284 Ga0501034_0003753 3300049571 Bacteria 17156
285 Ga0501034_0144341 3300049571 Unclassified 2358
286 Ga0501034_0342871 3300049571 Bacteria 1424
287 Ga0501036_0214874 3300049572 Unclassified 1615
288 Ga0501037_0031742 3300049573 Unclassified 3900
289 Ga0501039_0050266 3300049575 Bacteria 3225
290 Ga0501042_0357603 3300049578 Bacteria 1057
291 Ga0501043_0066609 3300049579 Unclassified 2828
292 Ga0501043_0290992 3300049579 Bacteria 1250
293 Ga0501046_0062416 3300049580 Bacteria 2911
294 Ga0501047_0009817 3300049581 Bacteria 9044
295 Ga0501048_0550739 3300049582 Unclassified 827
296 Ga0501067_0255128 3300049583 Unclassified 976
297 Ga0501070_0063446 3300049586 Bacteria 3060
298 Ga0501070_1034285 3300049586 Unclassified 636
299 Ga0501073_0009285 3300049589 Bacteria 7254
300 Ga0501073_0625741 3300049589 Bacteria 743
301 Ga0501074_0027509 3300049590 Bacteria 4123
302 Ga0501074_0577606 3300049590 Bacteria 795
303 Ga0501076_0088699 3300049592 Bacteria 2486
304 Ga0501077_0117364 3300049593 Bacteria 1687
305 Ga0501080_0323109 3300049742 Bacteria 1397
306 Ga0501080_0510423 3300049742 Unclassified 1073
307 Ga0501081_0368177 3300049743 Bacteria 1061
308 Ga0501083_0022608 3300049744 Bacteria 4363
309 Ga0501035_0007553 3300049822 Bacteria 10159
310 Ga0501044_0246244 3300049823 Unclassified 1730
311 Ga0501045_0064411 3300049824 Bacteria 2691
312 nmdc:mga05p37_2159_c1 3300050507 Bacteria 22932
313 nmdc:mga09592_1272_c1 3300050508 Bacteria 20245
314 nmdc:mga0qj67_496782_c1 3300050509 Bacteria 981
315 nmdc:mga06r32_77595_c1 3300050510 Bacteria 3227
316 nmdc:mga08y16_6286_c1 3300050511 Bacteria 12456
317 nmdc:mga0a205_795032_c1 3300050515 Bacteria 794
318 Ga0500611_000037 3300053727 Bacteria 72513
319 Ga0501084_0551000 3300054114 Unclassified 974
320 Ga0501082_0214219 3300060353 Bacteria 1676
321 Ga0466962_0049839 3300061719 Bacteria 2002
322 Ga0466962_0289623 3300061719 Bacteria 809
323 2645722702 2643221961 Bacteria 3919167
324 Ga0450897_016664
325 rootH1_10078002
326 rootH2_10075009
327 rootL2_10198541
328 Ga0065707_10196211
329 Ga0070658_10001278
330 Ga0070658_11132957
331 Ga0070676_10001633
332 Ga0070683_101285224
333 Ga0070677_10164330
334 Ga0068869_100008785
335 Ga0068869_100017344
336 Ga0070666_10000107
337 Ga0070666_10139502
338 Ga0068868_100000401
339 Ga0068868_100560116
340 Ga0070660_100000286
341 Ga0070660_100077693
342 Ga0070661_100255026
343 Ga0070668_100000017
344 Ga0070668_101211956
345 Ga0070675_100504538
346 Ga0070675_101307038
347 Ga0070673_100001453
348 Ga0070673_100029016
349 Ga0070688_100425028
350 Ga0070659_100007778
351 Ga0070659_100012277
352 Ga0070659_100304386
353 Ga0070667_100000376
354 Ga0070667_100045192
355 Ga0070667_100403084
356 Ga0070667_100750862
357 Ga0070705_100208569
358 Ga0070694_100097942
359 Ga0070694_100363352
360 Ga0070678_100095030
361 Ga0070678_100193859
362 Ga0070678_100766379
363 Ga0070662_100021882
364 Ga0070681_10940312
365 Ga0068867_100149873
366 Ga0070706_101415013
367 Ga0070699_100556902
368 Ga0070679_100088872
369 Ga0070679_100162812
370 Ga0070684_100134748
371 Ga0070684_100179722
372 Ga0070684_100634343
373 Ga0068853_100006075
374 Ga0068853_100125980
375 Ga0068853_100326318
376 Ga0070672_100000053
377 Ga0070686_100062476
378 Ga0070695_100363480
379 Ga0070693_100257189
380 Ga0070665_100002783
381 Ga0070665_100276415
382 Ga0068855_100029785
383 Ga0068855_100102646
384 Ga0068855_100173670
385 Ga0070664_100082886
386 Ga0070664_100086822
387 Ga0070664_100215094
388 Ga0070664_101123930
389 Ga0068857_100069247
390 Ga0068857_100304501
391 Ga0068854_100124008
392 Ga0068852_100040205
393 Ga0068852_100051046
394 Ga0068852_101506514
395 Ga0068859_100001552
396 Ga0068859_100198419
397 Ga0068864_100001989
398 Ga0068851_10000292
399 Ga0068863_100053805
400 Ga0068863_100316305
401 Ga0068863_101048278
402 Ga0068858_100000305
403 Ga0068860_100001538
404 Ga0070716_100266453
405 Ga0097621_100007912
406 Ga0097621_100016339
407 Ga0068871_100013764
408 Ga0075428_100004699
409 Ga0075430_100679410
410 Ga0075431_100126778
411 Ga0075433_10531892
412 Ga0075429_100000786
413 Ga0068865_100013537
414 Ga0097620_100001552
415 Ga0097620_100198435
416 Ga0105240_10013917
417 Ga0105240_10030162
418 Ga0105240_10575178
419 Ga0111539_10050994
420 Ga0105245_11164810
421 Ga0105247_10039634
422 Ga0114129_10001051
423 Ga0105241_10021094
424 Ga0105241_10346968
425 Ga0105242_10267981
426 Ga0105242_10519528
427 Ga0105242_11091742
428 Ga0105248_10082290
429 Ga0105237_10105387
430 Ga0105238_10143385
431 Ga0105249_10018197
432 Ga0105239_10044768
433 Ga0105239_10076404
434 Ga0105239_10339699
435 Ga0105239_10795273
436 Ga0105246_10079047
437 Ga0157320_1025717
438 Ga0157373_10035823
439 Ga0157371_10100740
440 Ga0157369_10038056
441 Ga0157369_10191113
442 Ga0157374_10000356
443 Ga0157374_10174636
444 Ga0157374_10193487
445 Ga0157378_10037109
446 Ga0157378_10182533
447 Ga0157378_10318727
448 Ga0157378_10574160
449 Ga0157378_10703697
450 Ga0163162_10000417
451 Ga0163162_10152343
452 Ga0163162_10698591
453 Ga0157372_10137689
454 Ga0157372_10177086
455 Ga0157372_10757220
456 Ga0157372_11082898
457 Ga0157372_11471319
458 Ga0157375_10000248
459 Ga0157375_10004916
460 Ga0163163_10000496
461 Ga0163163_10322126
462 Ga0163163_10445673
463 Ga0163163_10549617
464 Ga0157380_10217509
465 Ga0157377_10054728
466 Ga0157379_10000096
467 Ga0157379_10054656
468 Ga0157376_10000196
469 Ga0157376_10042206
470 Ga0157376_10591208
471 Ga0163161_10039490
472 Ga0163161_10053236
473 Ga0207697_10034167
474 Ga0207656_10001444
475 Ga0207682_10091795
476 Ga0207710_10020720
477 Ga0207680_10000571
478 Ga0207680_10106616
479 Ga0207680_10532038
480 Ga0207647_10003048
481 Ga0207647_10049839
482 Ga0207647_10102490
483 Ga0207645_10000231
484 Ga0207645_10194159
485 Ga0207705_10015134
486 Ga0207654_10005886
487 Ga0207654_10082751
488 Ga0207695_10038151
489 Ga0207695_10044742
490 Ga0207695_10428107
491 Ga0207671_10079987
492 Ga0207657_10003805
493 Ga0207657_10030054
494 Ga0207652_10426838
495 Ga0207650_10251470
496 Ga0207650_10881734
497 Ga0207659_10925697
498 Ga0207644_10330985
499 Ga0207644_10654944
500 Ga0207690_10006995
501 Ga0207690_10028725
502 Ga0207706_10008470
503 Ga0207706_10272634
504 Ga0207686_10615312
505 Ga0207670_11022998
506 Ga0207665_10270108
507 Ga0207691_10000185
508 Ga0207689_10019348
509 Ga0207689_10044306
510 Ga0207679_10065181
511 Ga0207679_10201168
512 Ga0207679_10226134
513 Ga0207667_10051649
514 Ga0207667_10176765
515 Ga0207651_10001155
516 Ga0207651_10349137
517 Ga0207712_10009306
518 Ga0207668_10001345
519 Ga0207640_10056196
520 Ga0207640_10223489
521 Ga0207640_10420913
522 Ga0207658_10000883
523 Ga0207658_10037129
524 Ga0207658_10310910
525 Ga0207677_10947523
526 Ga0207703_10002120
527 Ga0207639_10005712
528 Ga0207639_10093364
529 Ga0207678_10053661
530 Ga0207678_10814363
531 Ga0207641_10039492
532 Ga0207641_10940776
533 Ga0207641_10968937
534 Ga0207648_10003092
535 Ga0207676_10001327
536 Ga0207676_10081049
537 Ga0207674_10308420
538 Ga0207674_10653063
539 Ga0207683_10079771
540 Ga0207683_10223668
541 Ga0207683_10671858
542 Ga0207698_10249269
543 Ga0207698_10426165
544 Ga0207428_10000624
545 Ga0268266_10592983
546 Ga0268266_11369804
547 Ga0268265_11094476
548 Ga0268264_10008634
549 Ga0307515_10000092
550 Ga0265340_10138216
551 Ga0307509_10040059
552 Ga0307509_10357162
553 Ga0307408_100005867
554 Ga0307408_100008309
555 Ga0316576_10249853
556 Ga0307412_10004949
557 Ga0373928_0020051
558 Ga0373940_0067530
559 Ga0373951_0079790
560 Ga0373932_0046432
561 Ga0373941_0099511
562 Ga0373954_0441972
563 Ga0373957_0155292
564 Ga0373942_0023575
565 Ga0316574_0109388
566 Ga0316574_0130686
567 Ga0316574_0206492
568 Ga0373931_0117988
569 Ga0373933_0105358
570 Ga0373937_0185431
571 Ga0395899_0004492
572 Ga0395900_0020562
573 Ga0395898_0016900
574 Ga0395901_0014935
575 Ga0436362_0540189
576 Ga0439439_0008831
577 Ga0439431_0036555
578 Ga0439442_003988
579 Ga0439445_0048609
580 Ga0439462_0007181
581 Ga0450923_065153
582 Ga0450899_006152
583 Ga0439446_0047920
584 Ga0439434_0032020
585 Ga0453684_0027126
586 Ga0466971_0188999
587 Ga0451576_0011347
588 Ga0466958_0028435
589 Ga0466958_0051869
590 Ga0466967_0159941
591 Ga0495592_0296493
592 Ga0495651_0181499
593 Ga0495628_0057112
594 Ga0495630_0268995
595 Ga0495652_0763445
596 Ga0495586_0212102
597 Ga0495587_0365126
598 Ga0495667_0368400
599 Ga0496101_0809633
600 Ga0496107_0725778
601 Ga0496109_0063200
602 Ga0496110_0224182
603 Ga0496114_0259899
604 Ga0501031_0201025
605 Ga0501032_0010337
606 Ga0501034_0003753
607 Ga0501034_0144341
608 Ga0501034_0342871
609 Ga0501036_0214874
610 Ga0501037_0031742
611 Ga0501039_0050266
612 Ga0501042_0357603
613 Ga0501043_0066609
614 Ga0501043_0290992
615 Ga0501046_0062416
616 Ga0501047_0009817
617 Ga0501048_0550739
618 Ga0501067_0255128
619 Ga0501070_0063446
620 Ga0501070_1034285
621 Ga0501073_0009285
622 Ga0501073_0625741
623 Ga0501074_0027509
624 Ga0501074_0577606
625 Ga0501076_0088699
626 Ga0501077_0117364
627 Ga0501080_0323109
628 Ga0501080_0510423
629 Ga0501081_0368177
630 Ga0501083_0022608
631 Ga0501035_0007553
632 Ga0501044_0246244
633 Ga0501045_0064411
634 nmdc:mga05p37_2159_c1
635 nmdc:mga09592_1272_c1
636 nmdc:mga0qj67_496782_c1
637 nmdc:mga06r32_77595_c1
638 nmdc:mga08y16_6286_c1
639 nmdc:mga0a205_795032_c1
640 Ga0500611_000037
641 Ga0501084_0551000
642 Ga0501082_0214219
643 Ga0466962_0049839
644 Ga0466962_0289623
645 2645722702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

89

194

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.9085 68 168
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.8742 64 167
1ml8-assembly1.cif.gz_A-2 structural genomics 0.865 68 168
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.856 64 167
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8472 64 167
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9045 68 168 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8779 65 168 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8756 65 168 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8696 65 168 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8674 65 168 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2H0QIT4-F1-model_v4 Osmotically inducible protein C 0.933 63 168
AF-A0A062UQD6-F1-model_v4 Osmotically inducible protein C 0.9315 68 165
AF-A0A1J5QC51-F1-model_v4 OsmC-like protein 0.9306 67 168
AF-A0A7W5BN33-F1-model_v4 VIT1/CCC1 family predicted Fe2+/Mn2+ transporter/uncharacterized OsmC-like protein 0.9295 68 168 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A7Y5RIZ1-F1-model_v4 OsmC family protein 0.9272 50 155

Map