F406544

General Info

Members Datasets Scaffolds Average Seq Length
322 200 644 181

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0890448|Ga0436362_0890448_86_640
Length 184
Sequence MQRVKKITIDSATGKAKELLEVAKKATGAELNIFTAFANAPAALEGYLGLMGALGKGKLDPKLREQLAVVTAGYNGCNYCASAHTYLGDKAGVAKDELAQNLEGRSSNAKTQAALTFATRLIAQRGHVSDADVQAARIAGFSDEEIIEILAHVAMNTFTNYFNETFKVEVDFPLVSTDRARKAS

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
193 2643221586 Lysobacter sp. Root667 Isolate Unclassified
194 2643221612 Lysobacter sp. Root76 Isolate Unclassified
195 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
196 2643221727 Lysobacter sp. Root96 Isolate Unclassified
197 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
198 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
199 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
200 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 0
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 5.59
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0890448 3300039453 Unclassified 1720
2 SwRhRL2b_contig_605036 2162886007 Bacteria 4461
3 JGI24740J21852_10002695 3300001979 Bacteria 7969
4 JGI24739J22299_10001308 3300001989 Bacteria 9345
5 JGI24737J22298_10000688 3300001990 Bacteria 11863
6 JGI24738J21930_10002093 3300002075 Bacteria 5342
7 Ga0070658_10042782 3300005327 Bacteria 3659
8 Ga0070658_10053211 3300005327 Bacteria 3285
9 Ga0070658_10555335 3300005327 Bacteria 994
10 Ga0070690_101100040 3300005330 Bacteria 630
11 Ga0070666_10041702 3300005335 Bacteria 3068
12 Ga0070666_10141091 3300005335 Bacteria 1678
13 Ga0070682_100012546 3300005337 Bacteria 4860
14 Ga0070682_100767644 3300005337 Bacteria 780
15 Ga0070660_100051761 3300005339 Bacteria 3163
16 Ga0070660_100182786 3300005339 Bacteria 1697
17 Ga0070661_100007329 3300005344 Bacteria 7609
18 Ga0070661_100274595 3300005344 Unclassified 1306
19 Ga0070692_10242839 3300005345 Bacteria 1074
20 Ga0070669_100009487 3300005353 Bacteria 6933
21 Ga0070671_100017121 3300005355 Bacteria 5864
22 Ga0070673_100565132 3300005364 Bacteria 1034
23 Ga0070659_100013294 3300005366 Bacteria 6124
24 Ga0070667_100000682 3300005367 Bacteria 32889
25 Ga0070667_100005293 3300005367 Bacteria 10781
26 Ga0070694_100135251 3300005444 Bacteria 1785
27 Ga0070663_100009201 3300005455 Bacteria 6109
28 Ga0070663_100034690 3300005455 Bacteria 3495
29 Ga0070678_100038831 3300005456 Bacteria 3354
30 Ga0070678_100248008 3300005456 Bacteria 1492
31 Ga0070681_10031188 3300005458 Bacteria 5349
32 Ga0068867_100364432 3300005459 Bacteria 1210
33 Ga0070679_100117854 3300005530 Bacteria 2640
34 Ga0070679_100120779 3300005530 Bacteria 2605
35 Ga0070684_100492381 3300005535 Bacteria 1135
36 Ga0068853_100009675 3300005539 Bacteria 7770
37 Ga0068853_100104899 3300005539 Bacteria 2503
38 Ga0068853_100171865 3300005539 Bacteria 1961
39 Ga0070686_100083471 3300005544 Bacteria 2121
40 Ga0070695_100084358 3300005545 Bacteria 2107
41 Ga0070665_100005638 3300005548 Bacteria 12871
42 Ga0070665_100024582 3300005548 Bacteria 6070
43 Ga0070665_100024929 3300005548 Bacteria 6028
44 Ga0070665_100039011 3300005548 Bacteria 4776
45 Ga0070665_100269141 3300005548 Bacteria 1705
46 Ga0068855_100006938 3300005563 Bacteria 13738
47 Ga0068855_100013681 3300005563 Bacteria 9785
48 Ga0068855_100019874 3300005563 Bacteria 8068
49 Ga0068855_100594333 3300005563 Bacteria 1194
50 Ga0070664_100010648 3300005564 Bacteria 7453
51 Ga0068857_100011063 3300005577 Bacteria 7853
52 Ga0068857_100092156 3300005577 Bacteria 2713
53 Ga0068857_100453740 3300005577 Bacteria 1199
54 Ga0068854_100004531 3300005578 Bacteria 8763
55 Ga0068856_100109058 3300005614 Bacteria 2764
56 Ga0068852_100005725 3300005616 Bacteria 8915
57 Ga0068852_100492158 3300005616 Bacteria 1220
58 Ga0068852_101008801 3300005616 Bacteria 851
59 Ga0068859_100032054 3300005617 Bacteria 5279
60 Ga0068859_102382257 3300005617 Bacteria 583
61 Ga0068864_100006145 3300005618 Bacteria 9849
62 Ga0068851_10002914 3300005834 Bacteria 7559
63 Ga0068870_10741137 3300005840 Bacteria 681
64 Ga0068863_100000005 3300005841 Bacteria 269757
65 Ga0068863_100167913 3300005841 Bacteria 2104
66 Ga0068863_100193759 3300005841 Bacteria 1954
67 Ga0068858_100002024 3300005842 Bacteria 20688
68 Ga0068858_100066755 3300005842 Bacteria 3331
69 Ga0068858_101694985 3300005842 Bacteria 624
70 Ga0068860_100000028 3300005843 Bacteria 266461
71 Ga0068860_100605367 3300005843 Bacteria 1101
72 Ga0068862_100050156 3300005844 Bacteria 3566
73 Ga0075369_10406018 3300006186 Bacteria 642
74 Ga0075366_10131048 3300006195 Bacteria 1513
75 Ga0097621_100100160 3300006237 Bacteria 2437
76 Ga0097621_100205868 3300006237 Bacteria 1710
77 Ga0097621_100268681 3300006237 Bacteria 1498
78 Ga0068871_100016277 3300006358 Bacteria 5595
79 Ga0068871_100113073 3300006358 Bacteria 2286
80 Ga0068871_100151688 3300006358 Bacteria 1977
81 Ga0068865_100003644 3300006881 Bacteria 9249
82 Ga0097620_100032053 3300006931 Bacteria 5279
83 Ga0097620_102382154 3300006931 Bacteria 583
84 Ga0105251_10000028 3300009011 Bacteria 126517
85 Ga0105244_10024668 3300009036 Bacteria 3279
86 Ga0105240_10046116 3300009093 Bacteria 5524
87 Ga0105240_10163223 3300009093 Bacteria 2644
88 Ga0105240_10177418 3300009093 Bacteria 2518
89 Ga0105240_10503046 3300009093 Bacteria 1347
90 Ga0111539_10354558 3300009094 Bacteria 1707
91 Ga0105247_10078004 3300009101 Bacteria 2083
92 Ga0105247_10485400 3300009101 Bacteria 897
93 Ga0105241_10033266 3300009174 Bacteria 3869
94 Ga0105242_10064988 3300009176 Bacteria 3009
95 Ga0105248_10098184 3300009177 Bacteria 3300
96 Ga0105248_10102066 3300009177 Bacteria 3233
97 Ga0105248_11201125 3300009177 Bacteria 857
98 Ga0105237_10003341 3300009545 Bacteria 19100
99 Ga0105237_10025735 3300009545 Bacteria 6016
100 Ga0105238_10010038 3300009551 Bacteria 9496
101 Ga0105238_10548240 3300009551 Bacteria 1160
102 Ga0105249_10043108 3300009553 Bacteria 4104
103 Ga0105249_10922238 3300009553 Bacteria 941
104 Ga0105239_10017555 3300010375 Bacteria 7915
105 Ga0105239_10036293 3300010375 Bacteria 5412
106 Ga0157373_10005229 3300013100 Bacteria 9743
107 Ga0157373_10800382 3300013100 Bacteria 695
108 Ga0157371_10036053 3300013102 Bacteria 3542
109 Ga0157370_10011230 3300013104 Bacteria 9390
110 Ga0157370_10070008 3300013104 Bacteria 3312
111 Ga0157370_10655111 3300013104 Bacteria 960
112 Ga0157369_10013398 3300013105 Bacteria 9272
113 Ga0157374_10062634 3300013296 Bacteria 3487
114 Ga0163162_10008296 3300013306 Bacteria 10135
115 Ga0163162_10013809 3300013306 Bacteria 7889
116 Ga0163162_10043266 3300013306 Bacteria 4510
117 Ga0163162_10044822 3300013306 Bacteria 4430
118 Ga0163162_11124565 3300013306 Bacteria 890
119 Ga0157372_10012744 3300013307 Bacteria 8956
120 Ga0157375_10013542 3300013308 Bacteria 7263
121 Ga0157375_10612563 3300013308 Bacteria 1247
122 Ga0163163_11962826 3300014325 Bacteria 645
123 Ga0157376_10000564 3300014969 Bacteria 23965
124 Ga0157376_10039291 3300014969 Bacteria 3858
125 Ga0157376_10222682 3300014969 Bacteria 1748
126 Ga0157376_10498967 3300014969 Bacteria 1196
127 Ga0157376_10853746 3300014969 Bacteria 926
128 Ga0182007_10052698 3300015262 Bacteria 1340
129 Ga0163161_10070174 3300017792 Bacteria 2562
130 Ga0209563_107736 3300025230 Bacteria 1743
131 Ga0209759_1002873 3300025256 Bacteria 7263
132 Ga0209759_1005398 3300025256 Bacteria 4489
133 Ga0207696_1033710 3300025711 Bacteria 1534
134 Ga0207655_1010367 3300025728 Bacteria 5654
135 Ga0207713_1001226 3300025735 Bacteria 21389
136 Ga0207713_1016366 3300025735 Bacteria 3766
137 Ga0207680_10016963 3300025903 Bacteria 3837
138 Ga0207647_10005728 3300025904 Bacteria 9073
139 Ga0207705_10043004 3300025909 Bacteria 3244
140 Ga0207654_10010414 3300025911 Bacteria 4734
141 Ga0207707_10029714 3300025912 Bacteria 4779
142 Ga0207695_10073746 3300025913 Bacteria 3477
143 Ga0207695_10240357 3300025913 Bacteria 1712
144 Ga0207695_10586320 3300025913 Bacteria 996
145 Ga0207695_10614242 3300025913 Bacteria 968
146 Ga0207695_10769196 3300025913 Bacteria 843
147 Ga0207671_10258168 3300025914 Bacteria 1371
148 Ga0207671_10343592 3300025914 Bacteria 1183
149 Ga0207657_10020666 3300025919 Bacteria 6217
150 Ga0207657_10036064 3300025919 Bacteria 4429
151 Ga0207652_10090529 3300025921 Bacteria 2688
152 Ga0207681_10000626 3300025923 Bacteria 23658
153 Ga0207694_10003358 3300025924 Bacteria 12741
154 Ga0207644_10011330 3300025931 Bacteria 5898
155 Ga0207644_10460991 3300025931 Bacteria 1045
156 Ga0207686_10132241 3300025934 Bacteria 1713
157 Ga0207686_10621762 3300025934 Bacteria 852
158 Ga0207704_10015289 3300025938 Bacteria 3906
159 Ga0207691_10067082 3300025940 Bacteria 3245
160 Ga0207711_10056000 3300025941 Bacteria 3387
161 Ga0207711_10373082 3300025941 Bacteria 1323
162 Ga0207711_10375420 3300025941 Bacteria 1319
163 Ga0207711_10925713 3300025941 Bacteria 810
164 Ga0207689_10216688 3300025942 Bacteria 1582
165 Ga0207679_10021232 3300025945 Bacteria 4398
166 Ga0207667_10015443 3300025949 Bacteria 8673
167 Ga0207667_10057818 3300025949 Bacteria 4069
168 Ga0207667_10133875 3300025949 Bacteria 2553
169 Ga0207667_11646445 3300025949 Bacteria 610
170 Ga0207651_10377605 3300025960 Bacteria 1200
171 Ga0207712_10154380 3300025961 Bacteria 1776
172 Ga0207712_10632729 3300025961 Bacteria 928
173 Ga0207668_10127633 3300025972 Bacteria 1937
174 Ga0207668_10457268 3300025972 Bacteria 1091
175 Ga0207640_10010053 3300025981 Bacteria 5318
176 Ga0207658_10008179 3300025986 Bacteria 7122
177 Ga0207658_10008663 3300025986 Bacteria 6912
178 Ga0207703_10011484 3300026035 Bacteria 6890
179 Ga0207703_10035917 3300026035 Bacteria 3941
180 Ga0207703_10149138 3300026035 Bacteria 2037
181 Ga0207639_10000083 3300026041 Bacteria 81290
182 Ga0207639_10082075 3300026041 Bacteria 2555
183 Ga0207678_10000186 3300026067 Bacteria 53291
184 Ga0207678_10050782 3300026067 Bacteria 3582
185 Ga0207702_10000882 3300026078 Bacteria 31209
186 Ga0207641_10000326 3300026088 Bacteria 58336
187 Ga0207641_10047639 3300026088 Bacteria 3615
188 Ga0207641_10159707 3300026088 Bacteria 2048
189 Ga0207648_10009535 3300026089 Bacteria 9287
190 Ga0207676_10199581 3300026095 Bacteria 1766
191 Ga0207674_10014836 3300026116 Bacteria 8593
192 Ga0207674_10080014 3300026116 Bacteria 3271
193 Ga0207674_10132349 3300026116 Bacteria 2457
194 Ga0207683_10007556 3300026121 Bacteria 9314
195 Ga0207683_10261632 3300026121 Bacteria 1580
196 Ga0207698_10013752 3300026142 Bacteria 5353
197 Ga0207698_10617045 3300026142 Bacteria 1071
198 Ga0268266_10008562 3300028379 Bacteria 9089
199 Ga0268266_10020788 3300028379 Bacteria 5597
200 Ga0268266_10158029 3300028379 Bacteria 2049
201 Ga0268264_10000066 3300028381 Bacteria 285125
202 Ga0268264_10152104 3300028381 Bacteria 2076
203 Ga0307515_10403815 3300028794 Bacteria 991
204 Ga0307511_10053050 3300030521 Bacteria 3220
205 Ga0307513_10316367 3300031456 Bacteria 1321
206 Ga0307509_10194067 3300031507 Bacteria 1877
207 Ga0307408_100233971 3300031548 Bacteria 1506
208 Ga0307405_10287850 3300031731 Bacteria 1240
209 Ga0307413_10178427 3300031824 Bacteria 1511
210 Ga0307413_10223828 3300031824 Bacteria 1376
211 Ga0307518_10144877 3300031838 Bacteria 1651
212 Ga0307406_10008912 3300031901 Bacteria 5609
213 Ga0307409_100586847 3300031995 Bacteria 1099
214 Ga0307416_100151280 3300032002 Bacteria 2129
215 Ga0307416_100971807 3300032002 Bacteria 952
216 Ga0307416_101446947 3300032002 Bacteria 793
217 Ga0307411_10015816 3300032005 Bacteria 4251
218 Ga0373934_0030079 3300035086 Bacteria 2123
219 Ga0373937_0069834 3300036401 Bacteria 3239
220 Ga0373937_1737768 3300036401 Bacteria 570
221 Ga0373925_0810614 3300037068 Bacteria 772
222 Ga0395899_0127042 3300037312 Bacteria 1823
223 Ga0395898_0008823 3300037466 Bacteria 10624
224 Ga0395905_0000130 3300037471 Bacteria 123719
225 Ga0395901_0000986 3300038443 Bacteria 30762
226 Ga0400488_14008 3300038741 Unclassified 1084
227 Ga0436365_1881686 3300039437 Bacteria 641
228 Ga0451797_0735208 3300041453 Bacteria 1185
229 Ga0439464_0001109 3300042439 Bacteria 6208
230 Ga0439460_0007753 3300042461 Bacteria 2694
231 Ga0451577_0001826 3300042876 Bacteria 27188
232 Ga0451577_0271752 3300042876 Bacteria 1535
233 Ga0451577_0800051 3300042876 Bacteria 852
234 Ga0451577_1015273 3300042876 Bacteria 744
235 Ga0453684_0209220 3300044712 Bacteria 2268
236 Ga0453684_0306981 3300044712 Bacteria 1802
237 Ga0453684_0910243 3300044712 Unclassified 941
238 Ga0451576_0000364 3300045051 Bacteria 108727
239 Ga0451576_0037412 3300045051 Bacteria 5141
240 Ga0451576_0043166 3300045051 Bacteria 4758
241 Ga0451576_0150983 3300045051 Bacteria 2423
242 Ga0451576_0203418 3300045051 Bacteria 2068
243 Ga0495638_0223979 3300046460 Bacteria 1050
244 Ga0495650_0010101 3300046471 Bacteria 5300
245 Ga0495594_0151488 3300046499 Unclassified 1317
246 Ga0495583_0000071 3300046506 Bacteria 183691
247 Ga0495606_0003888 3300046507 Bacteria 15398
248 Ga0495606_0102904 3300046507 Bacteria 1736
249 Ga0495616_0006479 3300046513 Bacteria 7083
250 Ga0495663_0014705 3300046525 Bacteria 2196
251 Ga0495625_0026646 3300046660 Bacteria 4365
252 Ga0495625_0202039 3300046660 Unclassified 1311
253 Ga0495649_0000286 3300046694 Bacteria 44673
254 Ga0495589_0051481 3300046794 Bacteria 2036
255 Ga0495686_0119561 3300047472 Bacteria 1572
256 Ga0496100_0399496 3300048903 Bacteria 1046
257 Ga0496101_0004728 3300048904 Bacteria 8629
258 Ga0496101_0219975 3300048904 Bacteria 1473
259 Ga0496102_0001484 3300048905 Bacteria 20725
260 Ga0496102_0349412 3300048905 Bacteria 1392
261 Ga0496102_0940925 3300048905 Bacteria 785
262 Ga0496102_1308954 3300048905 Bacteria 644
263 Ga0496103_0000111 3300048906 Bacteria 89596
264 Ga0496104_0005088 3300048907 Bacteria 11475
265 Ga0496105_0006588 3300048908 Bacteria 8940
266 Ga0496105_0006966 3300048908 Bacteria 8709
267 Ga0496106_0001624 3300048909 Bacteria 16888
268 Ga0496107_0000624 3300048910 Bacteria 19844
269 Ga0496110_0092934 3300048913 Bacteria 2700
270 Ga0496111_0183393 3300048914 Bacteria 1556
271 Ga0496112_0006155 3300048915 Bacteria 10491
272 Ga0496113_0000042 3300048916 Bacteria 53513
273 Ga0496116_0045466 3300048919 Bacteria 2971
274 Ga0496117_0000414 3300048920 Bacteria 71876
275 Ga0496117_0066127 3300048920 Bacteria 2454
276 Ga0496118_0006842 3300048921 Bacteria 12373
277 Ga0496118_0045095 3300048921 Bacteria 3446
278 Ga0496119_0000838 3300048922 Bacteria 40796
279 Ga0496119_0079179 3300048922 Bacteria 1899
280 Ga0496120_0054687 3300048923 Bacteria 2260
281 Ga0496121_0002175 3300048924 Bacteria 30701
282 Ga0496121_0124302 3300048924 Bacteria 1942
283 Ga0496121_0369980 3300048924 Bacteria 948
284 Ga0496121_0403755 3300048924 Bacteria 894
285 Ga0496122_0000269 3300048925 Bacteria 116292
286 Ga0496122_0001370 3300048925 Bacteria 39655
287 Ga0496122_0003699 3300048925 Bacteria 19801
288 Ga0496123_0000712 3300048926 Bacteria 54440
289 Ga0496123_0001175 3300048926 Bacteria 38651
290 Ga0496123_0002913 3300048926 Bacteria 20012
291 Ga0496123_0121095 3300048926 Bacteria 1472
292 Ga0496124_0001811 3300048927 Bacteria 29573
293 Ga0496125_0002079 3300048928 Bacteria 26983
294 Ga0496125_0034730 3300048928 Bacteria 4439
295 Ga0496125_0054751 3300048928 Bacteria 3257
296 Ga0496126_0000219 3300048929 Bacteria 125157
297 Ga0501031_0005382 3300049568 Bacteria 8336
298 Ga0501031_0008498 3300049568 Bacteria 6681
299 Ga0501032_0022059 3300049569 Bacteria 4420
300 Ga0501033_0002163 3300049570 Bacteria 17005
301 Ga0501034_0348487 3300049571 Bacteria 1409
302 Ga0501036_0015994 3300049572 Bacteria 6266
303 Ga0501038_0029039 3300049574 Bacteria 4905
304 Ga0501039_0795007 3300049575 Bacteria 738
305 Ga0501043_0043557 3300049579 Bacteria 3527
306 Ga0501047_0015065 3300049581 Bacteria 7358
307 Ga0501035_0000549 3300049822 Bacteria 41807
308 Ga0501044_0000476 3300049823 Bacteria 48806
309 nmdc:mga00v17_78198_c1 3300050491 Bacteria 2061
310 nmdc:mga0k408_162657_c1 3300050493 Bacteria 1330
311 nmdc:mga08y16_40533_c1 3300050511 Bacteria 4881
312 nmdc:mga0sz30_378907_c1 3300050516 Bacteria 633
313 Ga0500642_0071477 3300053130 Bacteria 1580
314 Ga0500619_000064 3300053154 Bacteria 32285
315 2643941385 2643221586 Bacteria 4446529
316 2644080370 2643221612 Bacteria 4361984
317 2644219687 2643221639 Bacteria 6649903
318 2644696983 2643221727 Bacteria 4415595
319 2819616348 2818991449 Bacteria 5518009
320 2894417352 2894414249 Bacteria 4405451
321 2987607547 2987605356 Bacteria 4187822
322 8055434767 8055431914 Bacteria 4551896
323 Ga0436362_0890448
324 SwRhRL2b_contig_605036
325 JGI24740J21852_10002695
326 JGI24739J22299_10001308
327 JGI24737J22298_10000688
328 JGI24738J21930_10002093
329 Ga0070658_10042782
330 Ga0070658_10053211
331 Ga0070658_10555335
332 Ga0070690_101100040
333 Ga0070666_10041702
334 Ga0070666_10141091
335 Ga0070682_100012546
336 Ga0070682_100767644
337 Ga0070660_100051761
338 Ga0070660_100182786
339 Ga0070661_100007329
340 Ga0070661_100274595
341 Ga0070692_10242839
342 Ga0070669_100009487
343 Ga0070671_100017121
344 Ga0070673_100565132
345 Ga0070659_100013294
346 Ga0070667_100000682
347 Ga0070667_100005293
348 Ga0070694_100135251
349 Ga0070663_100009201
350 Ga0070663_100034690
351 Ga0070678_100038831
352 Ga0070678_100248008
353 Ga0070681_10031188
354 Ga0068867_100364432
355 Ga0070679_100117854
356 Ga0070679_100120779
357 Ga0070684_100492381
358 Ga0068853_100009675
359 Ga0068853_100104899
360 Ga0068853_100171865
361 Ga0070686_100083471
362 Ga0070695_100084358
363 Ga0070665_100005638
364 Ga0070665_100024582
365 Ga0070665_100024929
366 Ga0070665_100039011
367 Ga0070665_100269141
368 Ga0068855_100006938
369 Ga0068855_100013681
370 Ga0068855_100019874
371 Ga0068855_100594333
372 Ga0070664_100010648
373 Ga0068857_100011063
374 Ga0068857_100092156
375 Ga0068857_100453740
376 Ga0068854_100004531
377 Ga0068856_100109058
378 Ga0068852_100005725
379 Ga0068852_100492158
380 Ga0068852_101008801
381 Ga0068859_100032054
382 Ga0068859_102382257
383 Ga0068864_100006145
384 Ga0068851_10002914
385 Ga0068870_10741137
386 Ga0068863_100000005
387 Ga0068863_100167913
388 Ga0068863_100193759
389 Ga0068858_100002024
390 Ga0068858_100066755
391 Ga0068858_101694985
392 Ga0068860_100000028
393 Ga0068860_100605367
394 Ga0068862_100050156
395 Ga0075369_10406018
396 Ga0075366_10131048
397 Ga0097621_100100160
398 Ga0097621_100205868
399 Ga0097621_100268681
400 Ga0068871_100016277
401 Ga0068871_100113073
402 Ga0068871_100151688
403 Ga0068865_100003644
404 Ga0097620_100032053
405 Ga0097620_102382154
406 Ga0105251_10000028
407 Ga0105244_10024668
408 Ga0105240_10046116
409 Ga0105240_10163223
410 Ga0105240_10177418
411 Ga0105240_10503046
412 Ga0111539_10354558
413 Ga0105247_10078004
414 Ga0105247_10485400
415 Ga0105241_10033266
416 Ga0105242_10064988
417 Ga0105248_10098184
418 Ga0105248_10102066
419 Ga0105248_11201125
420 Ga0105237_10003341
421 Ga0105237_10025735
422 Ga0105238_10010038
423 Ga0105238_10548240
424 Ga0105249_10043108
425 Ga0105249_10922238
426 Ga0105239_10017555
427 Ga0105239_10036293
428 Ga0157373_10005229
429 Ga0157373_10800382
430 Ga0157371_10036053
431 Ga0157370_10011230
432 Ga0157370_10070008
433 Ga0157370_10655111
434 Ga0157369_10013398
435 Ga0157374_10062634
436 Ga0163162_10008296
437 Ga0163162_10013809
438 Ga0163162_10043266
439 Ga0163162_10044822
440 Ga0163162_11124565
441 Ga0157372_10012744
442 Ga0157375_10013542
443 Ga0157375_10612563
444 Ga0163163_11962826
445 Ga0157376_10000564
446 Ga0157376_10039291
447 Ga0157376_10222682
448 Ga0157376_10498967
449 Ga0157376_10853746
450 Ga0182007_10052698
451 Ga0163161_10070174
452 Ga0209563_107736
453 Ga0209759_1002873
454 Ga0209759_1005398
455 Ga0207696_1033710
456 Ga0207655_1010367
457 Ga0207713_1001226
458 Ga0207713_1016366
459 Ga0207680_10016963
460 Ga0207647_10005728
461 Ga0207705_10043004
462 Ga0207654_10010414
463 Ga0207707_10029714
464 Ga0207695_10073746
465 Ga0207695_10240357
466 Ga0207695_10586320
467 Ga0207695_10614242
468 Ga0207695_10769196
469 Ga0207671_10258168
470 Ga0207671_10343592
471 Ga0207657_10020666
472 Ga0207657_10036064
473 Ga0207652_10090529
474 Ga0207681_10000626
475 Ga0207694_10003358
476 Ga0207644_10011330
477 Ga0207644_10460991
478 Ga0207686_10132241
479 Ga0207686_10621762
480 Ga0207704_10015289
481 Ga0207691_10067082
482 Ga0207711_10056000
483 Ga0207711_10373082
484 Ga0207711_10375420
485 Ga0207711_10925713
486 Ga0207689_10216688
487 Ga0207679_10021232
488 Ga0207667_10015443
489 Ga0207667_10057818
490 Ga0207667_10133875
491 Ga0207667_11646445
492 Ga0207651_10377605
493 Ga0207712_10154380
494 Ga0207712_10632729
495 Ga0207668_10127633
496 Ga0207668_10457268
497 Ga0207640_10010053
498 Ga0207658_10008179
499 Ga0207658_10008663
500 Ga0207703_10011484
501 Ga0207703_10035917
502 Ga0207703_10149138
503 Ga0207639_10000083
504 Ga0207639_10082075
505 Ga0207678_10000186
506 Ga0207678_10050782
507 Ga0207702_10000882
508 Ga0207641_10000326
509 Ga0207641_10047639
510 Ga0207641_10159707
511 Ga0207648_10009535
512 Ga0207676_10199581
513 Ga0207674_10014836
514 Ga0207674_10080014
515 Ga0207674_10132349
516 Ga0207683_10007556
517 Ga0207683_10261632
518 Ga0207698_10013752
519 Ga0207698_10617045
520 Ga0268266_10008562
521 Ga0268266_10020788
522 Ga0268266_10158029
523 Ga0268264_10000066
524 Ga0268264_10152104
525 Ga0307515_10403815
526 Ga0307511_10053050
527 Ga0307513_10316367
528 Ga0307509_10194067
529 Ga0307408_100233971
530 Ga0307405_10287850
531 Ga0307413_10178427
532 Ga0307413_10223828
533 Ga0307518_10144877
534 Ga0307406_10008912
535 Ga0307409_100586847
536 Ga0307416_100151280
537 Ga0307416_100971807
538 Ga0307416_101446947
539 Ga0307411_10015816
540 Ga0373934_0030079
541 Ga0373937_0069834
542 Ga0373937_1737768
543 Ga0373925_0810614
544 Ga0395899_0127042
545 Ga0395898_0008823
546 Ga0395905_0000130
547 Ga0395901_0000986
548 Ga0400488_14008
549 Ga0436365_1881686
550 Ga0451797_0735208
551 Ga0439464_0001109
552 Ga0439460_0007753
553 Ga0451577_0001826
554 Ga0451577_0271752
555 Ga0451577_0800051
556 Ga0451577_1015273
557 Ga0453684_0209220
558 Ga0453684_0306981
559 Ga0453684_0910243
560 Ga0451576_0000364
561 Ga0451576_0037412
562 Ga0451576_0043166
563 Ga0451576_0150983
564 Ga0451576_0203418
565 Ga0495638_0223979
566 Ga0495650_0010101
567 Ga0495594_0151488
568 Ga0495583_0000071
569 Ga0495606_0003888
570 Ga0495606_0102904
571 Ga0495616_0006479
572 Ga0495663_0014705
573 Ga0495625_0026646
574 Ga0495625_0202039
575 Ga0495649_0000286
576 Ga0495589_0051481
577 Ga0495686_0119561
578 Ga0496100_0399496
579 Ga0496101_0004728
580 Ga0496101_0219975
581 Ga0496102_0001484
582 Ga0496102_0349412
583 Ga0496102_0940925
584 Ga0496102_1308954
585 Ga0496103_0000111
586 Ga0496104_0005088
587 Ga0496105_0006588
588 Ga0496105_0006966
589 Ga0496106_0001624
590 Ga0496107_0000624
591 Ga0496110_0092934
592 Ga0496111_0183393
593 Ga0496112_0006155
594 Ga0496113_0000042
595 Ga0496116_0045466
596 Ga0496117_0000414
597 Ga0496117_0066127
598 Ga0496118_0006842
599 Ga0496118_0045095
600 Ga0496119_0000838
601 Ga0496119_0079179
602 Ga0496120_0054687
603 Ga0496121_0002175
604 Ga0496121_0124302
605 Ga0496121_0369980
606 Ga0496121_0403755
607 Ga0496122_0000269
608 Ga0496122_0001370
609 Ga0496122_0003699
610 Ga0496123_0000712
611 Ga0496123_0001175
612 Ga0496123_0002913
613 Ga0496123_0121095
614 Ga0496124_0001811
615 Ga0496125_0002079
616 Ga0496125_0034730
617 Ga0496125_0054751
618 Ga0496126_0000219
619 Ga0501031_0005382
620 Ga0501031_0008498
621 Ga0501032_0022059
622 Ga0501033_0002163
623 Ga0501034_0348487
624 Ga0501036_0015994
625 Ga0501038_0029039
626 Ga0501039_0795007
627 Ga0501043_0043557
628 Ga0501047_0015065
629 Ga0501035_0000549
630 Ga0501044_0000476
631 nmdc:mga00v17_78198_c1
632 nmdc:mga0k408_162657_c1
633 nmdc:mga08y16_40533_c1
634 nmdc:mga0sz30_378907_c1
635 Ga0500642_0071477
636 Ga0500619_000064
637 2643941385
638 2644080370
639 2644219687
640 2644696983
641 2819616348
642 2894417352
643 2987607547
644 8055434767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

41

121

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.9321 6 173
3lvy-assembly2.cif.gz_D crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.9182 9 173
3lvy-assembly3.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.9134 9 173
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.9129 6 173
3bey-assembly1.cif.gz_A crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.8979 36 105
ID Description Score Start End Superfamily
3lvyC01 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8962 14 173 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8873 41 167 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8729 34 178 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8715 43 173 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8539 59 173 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4R8FH04-F1-model_v4 deleted 0.995 52 183
AF-A0A117S8C1-F1-model_v4 Alkylhydroperoxidase 0.9923 1 183 GO:0051920
AF-A0A8A7B344-F1-model_v4 deleted 0.9916 1 182
AF-A0A1K2HLY8-F1-model_v4 Uncharacterized peroxidase-related enzyme 0.991 1 180 GO:0051920
AF-A0A534AFS8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9907 1 138 GO:0051920

Map