F406535

General Info

Members Datasets Scaffolds Average Seq Length
322 174 642 115

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0026116|Ga0436364_0026116_3210_3584
Length 124
Sequence MTPKRDDGRIELVYGALDMLILRTLRWQPTHGHGIAKSIERMSEDALRVEHGSLYPALQRLLQEGWITAEWGVSENNQRAKYYRLTPAGRRKLAVETSRWERFVRAITGVLSPANPASESEEGQ

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
158 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
164 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
165 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
166 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 26.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0026116 3300037853 Unclassified 3771
2 Ga0065707_10247909 3300005295 Bacteria 1134
3 Ga0070658_10003798 3300005327 Bacteria 12373
4 Ga0070683_100199764 3300005329 Bacteria 1899
5 Ga0070690_101067279 3300005330 Bacteria 639
6 Ga0070680_101636117 3300005336 Bacteria 558
7 Ga0070691_10000806 3300005341 Bacteria 12524
8 Ga0070661_100071346 3300005344 Bacteria 2556
9 Ga0070661_100547870 3300005344 Unclassified 930
10 Ga0070668_100006989 3300005347 Bacteria 8363
11 Ga0070669_100321090 3300005353 Bacteria 1250
12 Ga0070669_101786659 3300005353 Unclassified 536
13 Ga0070675_100014169 3300005354 Bacteria 6286
14 Ga0070675_100097226 3300005354 Bacteria 2475
15 Ga0070675_100225389 3300005354 Bacteria 1634
16 Ga0070675_100369601 3300005354 Bacteria 1275
17 Ga0070675_101097187 3300005354 Bacteria 732
18 Ga0070675_101776572 3300005354 Bacteria 569
19 Ga0070674_100350036 3300005356 Bacteria 1193
20 Ga0070673_100081793 3300005364 Bacteria 2620
21 Ga0070673_101420903 3300005364 Bacteria 653
22 Ga0070673_101430552 3300005364 Bacteria 651
23 Ga0070688_100406891 3300005365 Bacteria 1008
24 Ga0070714_100457425 3300005435 Unclassified 1213
25 Ga0070713_101184351 3300005436 Unclassified 739
26 Ga0070694_100324428 3300005444 Bacteria 1186
27 Ga0070694_100950954 3300005444 Unclassified 711
28 Ga0070694_101032516 3300005444 Bacteria 683
29 Ga0070678_101143699 3300005456 Bacteria 720
30 Ga0070662_101492057 3300005457 Bacteria 583
31 Ga0070681_10227767 3300005458 Bacteria 1778
32 Ga0068867_100504525 3300005459 Bacteria 1040
33 Ga0070706_100927766 3300005467 Bacteria 804
34 Ga0070698_100000026 3300005471 Bacteria 98301
35 Ga0070699_101924466 3300005518 Bacteria 541
36 Ga0070679_100043922 3300005530 Unclassified 4450
37 Ga0070679_100184991 3300005530 Bacteria 2055
38 Ga0070679_100414962 3300005530 Bacteria 1292
39 Ga0070684_100964785 3300005535 Unclassified 800
40 Ga0068853_100946285 3300005539 Unclassified 828
41 Ga0070672_100063149 3300005543 Bacteria 2924
42 Ga0070672_100137503 3300005543 Bacteria 2013
43 Ga0070672_100159941 3300005543 Bacteria 1868
44 Ga0070686_101122131 3300005544 Bacteria 650
45 Ga0070695_100141382 3300005545 Bacteria 1669
46 Ga0070695_100512742 3300005545 Unclassified 929
47 Ga0070696_100155991 3300005546 Bacteria 1679
48 Ga0070693_100381767 3300005547 Bacteria 972
49 Ga0070665_100355620 3300005548 Bacteria 1470
50 Ga0070704_100088224 3300005549 Unclassified 2304
51 Ga0068855_100294441 3300005563 Bacteria 1799
52 Ga0070664_100043617 3300005564 Bacteria 3785
53 Ga0070664_100065592 3300005564 Bacteria 3098
54 Ga0068856_100532261 3300005614 Bacteria 1196
55 Ga0068852_100037293 3300005616 Bacteria 4074
56 Ga0068859_100031984 3300005617 Bacteria 5285
57 Ga0068859_100530635 3300005617 Bacteria 1272
58 Ga0068864_100789453 3300005618 Unclassified 932
59 Ga0068861_100123349 3300005719 Bacteria 2093
60 Ga0068863_101954305 3300005841 Bacteria 597
61 Ga0068860_101790286 3300005843 Bacteria 636
62 Ga0070717_10427754 3300006028 Bacteria 1191
63 Ga0070716_100892192 3300006173 Unclassified 695
64 Ga0070712_101556671 3300006175 Unclassified 578
65 Ga0068871_100017889 3300006358 Bacteria 5373
66 Ga0068871_100665705 3300006358 Bacteria 951
67 Ga0075428_101283482 3300006844 Unclassified 770
68 Ga0075430_101389753 3300006846 Unclassified 577
69 Ga0075433_10309679 3300006852 Bacteria 1398
70 Ga0075434_100086222 3300006871 Bacteria 3140
71 Ga0075434_100748100 3300006871 Unclassified 994
72 Ga0075436_100126789 3300006914 Bacteria 1789
73 Ga0075436_100345344 3300006914 Unclassified 1072
74 Ga0097620_100031984 3300006931 Bacteria 5285
75 Ga0097620_100530633 3300006931 Bacteria 1272
76 Ga0075435_100144357 3300007076 Unclassified 1998
77 Ga0075435_100288587 3300007076 Bacteria 1401
78 Ga0075435_101002251 3300007076 Unclassified 729
79 Ga0105240_10371064 3300009093 Bacteria 1618
80 Ga0114129_12608915 3300009147 Unclassified 603
81 Ga0105242_10373232 3300009176 Bacteria 1324
82 Ga0105248_10073166 3300009177 Bacteria 3852
83 Ga0105248_11248675 3300009177 Bacteria 840
84 Ga0105248_13469088 3300009177 Bacteria 501
85 Ga0105237_11965462 3300009545 Unclassified 593
86 Ga0105249_11381374 3300009553 Bacteria 776
87 Ga0105246_12041134 3300011119 Unclassified 554
88 Ga0157370_10208121 3300013104 Bacteria 1813
89 Ga0157369_10309510 3300013105 Unclassified 1643
90 Ga0157369_10835657 3300013105 Unclassified 946
91 Ga0157369_11336043 3300013105 Unclassified 730
92 Ga0157372_10044352 3300013307 Bacteria 4927
93 Ga0157372_12258740 3300013307 Bacteria 625
94 Ga0157375_10536413 3300013308 Bacteria 1333
95 Ga0157375_10671755 3300013308 Bacteria 1191
96 Ga0157375_11456871 3300013308 Bacteria 807
97 Ga0163163_10250011 3300014325 Bacteria 1823
98 Ga0163163_10595399 3300014325 Bacteria 1169
99 Ga0163163_11297875 3300014325 Bacteria 790
100 Ga0157380_10591975 3300014326 Bacteria 1096
101 Ga0157380_10758477 3300014326 Bacteria 982
102 Ga0157379_10080114 3300014968 Bacteria 2925
103 Ga0157379_11561785 3300014968 Bacteria 643
104 Ga0182007_10186813 3300015262 Bacteria 719
105 Ga0206353_10915952 3300020082 Bacteria 834
106 Ga0213876_10286967 3300021384 Bacteria 875
107 Ga0213875_10005830 3300021388 Bacteria 6553
108 Ga0213875_10155383 3300021388 Unclassified 1073
109 Ga0213875_10186011 3300021388 Bacteria 976
110 Ga0207682_10024329 3300025893 Bacteria 2397
111 Ga0207699_10730956 3300025906 Bacteria 725
112 Ga0207645_10090356 3300025907 Bacteria 1969
113 Ga0207705_10008108 3300025909 Bacteria 7696
114 Ga0207705_10295018 3300025909 Bacteria 1243
115 Ga0207693_10411257 3300025915 Unclassified 1057
116 Ga0207693_11070024 3300025915 Unclassified 614
117 Ga0207660_10569781 3300025917 Unclassified 921
118 Ga0207649_10160134 3300025920 Bacteria 1559
119 Ga0207649_10317801 3300025920 Bacteria 1143
120 Ga0207652_10140806 3300025921 Bacteria 2157
121 Ga0207681_10187310 3300025923 Bacteria 1581
122 Ga0207681_11529612 3300025923 Unclassified 559
123 Ga0207650_11053124 3300025925 Bacteria 692
124 Ga0207659_10117916 3300025926 Bacteria 2029
125 Ga0207659_10385032 3300025926 Bacteria 1170
126 Ga0207659_10550126 3300025926 Bacteria 981
127 Ga0207659_11388106 3300025926 Unclassified 602
128 Ga0207664_10385442 3300025929 Bacteria 1245
129 Ga0207706_10220038 3300025933 Bacteria 1663
130 Ga0207706_11243476 3300025933 Bacteria 617
131 Ga0207686_10686983 3300025934 Bacteria 812
132 Ga0207669_10156666 3300025937 Bacteria 1603
133 Ga0207691_10034408 3300025940 Bacteria 4711
134 Ga0207691_10074582 3300025940 Bacteria 3060
135 Ga0207691_10694587 3300025940 Unclassified 858
136 Ga0207679_10007100 3300025945 Bacteria 7098
137 Ga0207679_11425812 3300025945 Bacteria 635
138 Ga0207667_10934801 3300025949 Bacteria 857
139 Ga0207651_10089644 3300025960 Bacteria 2246
140 Ga0207651_11185379 3300025960 Bacteria 685
141 Ga0207651_11431943 3300025960 Bacteria 622
142 Ga0207639_10621786 3300026041 Bacteria 997
143 Ga0207678_10378253 3300026067 Bacteria 1224
144 Ga0207641_10888000 3300026088 Bacteria 885
145 Ga0207641_12606175 3300026088 Bacteria 503
146 Ga0207648_10148504 3300026089 Bacteria 2068
147 Ga0207676_10354926 3300026095 Bacteria 1357
148 Ga0207674_10759077 3300026116 Unclassified 936
149 Ga0207675_100105648 3300026118 Bacteria 2654
150 Ga0207698_10232616 3300026142 Bacteria 1674
151 Ga0207698_11004831 3300026142 Bacteria 845
152 Ga0268264_11781847 3300028381 Bacteria 626
153 Ga0265330_10347005 3300031235 Unclassified 627
154 Ga0265332_10251222 3300031238 Bacteria 731
155 Ga0265325_10095459 3300031241 Unclassified 1461
156 Ga0265340_10120704 3300031247 Bacteria 1206
157 Ga0265339_10267249 3300031249 Bacteria 823
158 Ga0265331_10310286 3300031250 Unclassified 707
159 Ga0307408_100002950 3300031548 Bacteria 11787
160 Ga0307408_100040543 3300031548 Bacteria 3297
161 Ga0307408_102498185 3300031548 Bacteria 502
162 Ga0265342_10592330 3300031712 Unclassified 560
163 Ga0307405_10008337 3300031731 Bacteria 5244
164 Ga0307405_10022838 3300031731 Bacteria 3544
165 Ga0307405_10200071 3300031731 Bacteria 1450
166 Ga0307405_10547762 3300031731 Bacteria 936
167 Ga0307405_10710749 3300031731 Bacteria 833
168 Ga0307405_10914530 3300031731 Bacteria 743
169 Ga0307413_10000306 3300031824 Bacteria 15174
170 Ga0307413_10001481 3300031824 Bacteria 8943
171 Ga0307413_10015919 3300031824 Bacteria 3867
172 Ga0307413_10108462 3300031824 Bacteria 1853
173 Ga0307413_10116412 3300031824 Bacteria 1801
174 Ga0307413_10145414 3300031824 Unclassified 1645
175 Ga0307413_10606756 3300031824 Bacteria 896
176 Ga0307413_10636785 3300031824 Bacteria 877
177 Ga0307413_11183394 3300031824 Bacteria 664
178 Ga0307413_11948253 3300031824 Bacteria 529
179 Ga0307410_10001535 3300031852 Bacteria 10519
180 Ga0307410_10003384 3300031852 Bacteria 7995
181 Ga0307410_10004819 3300031852 Bacteria 7045
182 Ga0307410_10062829 3300031852 Bacteria 2546
183 Ga0307410_10891226 3300031852 Bacteria 762
184 Ga0307406_10000686 3300031901 Bacteria 19193
185 Ga0307406_10003498 3300031901 Bacteria 8551
186 Ga0307406_10005456 3300031901 Bacteria 6961
187 Ga0307406_10011783 3300031901 Unclassified 4965
188 Ga0307406_10335420 3300031901 Bacteria 1176
189 Ga0307406_10503675 3300031901 Bacteria 982
190 Ga0307406_10651668 3300031901 Bacteria 874
191 Ga0307406_10678787 3300031901 Bacteria 858
192 Ga0307406_11206138 3300031901 Bacteria 657
193 Ga0307406_11345088 3300031901 Bacteria 625
194 Ga0307406_11733410 3300031901 Bacteria 554
195 Ga0307407_10000543 3300031903 Bacteria 11791
196 Ga0307407_10008828 3300031903 Bacteria 4654
197 Ga0307407_10016681 3300031903 Bacteria 3662
198 Ga0307407_10396871 3300031903 Bacteria 988
199 Ga0307407_10474487 3300031903 Bacteria 912
200 Ga0307412_10006775 3300031911 Bacteria 6495
201 Ga0307412_10008786 3300031911 Bacteria 5785
202 Ga0307412_10036884 3300031911 Bacteria 3136
203 Ga0307412_10046652 3300031911 Bacteria 2840
204 Ga0307412_10416349 3300031911 Bacteria 1098
205 Ga0307409_100000326 3300031995 Bacteria 19596
206 Ga0307409_100013735 3300031995 Bacteria 5229
207 Ga0307409_100028381 3300031995 Bacteria 3986
208 Ga0307409_100047746 3300031995 Bacteria 3252
209 Ga0307409_100138629 3300031995 Bacteria 2092
210 Ga0307409_100336464 3300031995 Bacteria 1418
211 Ga0307409_100361205 3300031995 Bacteria 1374
212 Ga0307409_101505413 3300031995 Bacteria 700
213 Ga0307409_102456255 3300031995 Bacteria 550
214 Ga0307416_100000519 3300032002 Bacteria 19661
215 Ga0307416_100000645 3300032002 Bacteria 17987
216 Ga0307416_100080486 3300032002 Unclassified 2750
217 Ga0307416_100197685 3300032002 Bacteria 1904
218 Ga0307416_100344170 3300032002 Bacteria 1505
219 Ga0307416_100423383 3300032002 Unclassified 1376
220 Ga0307416_100557232 3300032002 Bacteria 1220
221 Ga0307416_102487582 3300032002 Unclassified 616
222 Ga0307416_102734099 3300032002 Bacteria 590
223 Ga0307414_10002657 3300032004 Bacteria 9407
224 Ga0307414_10109275 3300032004 Bacteria 2100
225 Ga0307414_10153743 3300032004 Bacteria 1818
226 Ga0307414_10248211 3300032004 Bacteria 1478
227 Ga0307414_10297425 3300032004 Unclassified 1364
228 Ga0307414_10365943 3300032004 Bacteria 1242
229 Ga0307414_10387606 3300032004 Bacteria 1210
230 Ga0307414_10919975 3300032004 Bacteria 802
231 Ga0307414_12062451 3300032004 Bacteria 532
232 Ga0307411_10003738 3300032005 Bacteria 7138
233 Ga0307411_10004807 3300032005 Bacteria 6545
234 Ga0307411_10006728 3300032005 Bacteria 5779
235 Ga0307411_10030900 3300032005 Bacteria 3289
236 Ga0307411_11098484 3300032005 Unclassified 717
237 Ga0307415_100001074 3300032126 Bacteria 12718
238 Ga0307415_100009977 3300032126 Bacteria 5356
239 Ga0307415_100011436 3300032126 Bacteria 5079
240 Ga0307415_100038458 3300032126 Bacteria 3153
241 Ga0307415_100183439 3300032126 Bacteria 1644
242 Ga0307415_100209493 3300032126 Bacteria 1554
243 Ga0307415_101748355 3300032126 Bacteria 601
244 Ga0307415_101904998 3300032126 Bacteria 577
245 Ga0373926_0024241 3300035083 Bacteria 2112
246 Ga0373931_0405729 3300035691 Bacteria 864
247 Ga0373927_0166631 3300035695 Unclassified 1444
248 Ga0373947_0263680 3300035725 Unclassified 1142
249 Ga0373937_1857007 3300036401 Unclassified 549
250 Ga0373925_0068473 3300037068 Bacteria 2679
251 Ga0395899_0026130 3300037312 Bacteria 4407
252 Ga0395900_0210154 3300037418 Bacteria 1965
253 Ga0395900_0245299 3300037418 Bacteria 1795
254 Ga0395898_1434461 3300037466 Unclassified 617
255 Ga0395905_0009787 3300037471 Bacteria 9345
256 Ga0395905_1067842 3300037471 Bacteria 711
257 Ga0436364_0807877 3300037853 Bacteria 1925
258 Ga0436364_1010535 3300037853 Unclassified 909
259 Ga0436364_1029411 3300037853 Bacteria 3582
260 Ga0436364_1118825 3300037853 Bacteria 26943
261 Ga0436364_1166218 3300037853 Bacteria 1263
262 Ga0436364_1402036 3300037853 Bacteria 1126
263 Ga0395901_0005898 3300038443 Bacteria 12397
264 Ga0436365_0576432 3300039437 Unclassified 641
265 Ga0436365_1351531 3300039437 Bacteria 1074
266 Ga0436365_1929879 3300039437 Bacteria 691
267 Ga0436361_0628955 3300039447 Unclassified 1926
268 Ga0436363_0927441 3300039450 Unclassified 536
269 Ga0439439_0034471 3300041406 Unclassified 1298
270 Ga0439453_0041402 3300041408 Unclassified 904
271 Ga0451800_0279448 3300041459 Unclassified 684
272 Ga0466963_0191237 3300044694 Bacteria 1430
273 Ga0466963_0272532 3300044694 Unclassified 1189
274 Ga0466957_0293373 3300044842 Unclassified 1091
275 Ga0466959_0410423 3300045049 Unclassified 920
276 Ga0451576_0037171 3300045051 Bacteria 5158
277 Ga0466967_1189524 3300045976 Unclassified 760
278 Ga0495603_0047469 3300046455 Bacteria 2557
279 Ga0495580_0000172 3300046472 Bacteria 48147
280 Ga0495580_0473374 3300046472 Unclassified 838
281 Ga0495582_0559156 3300046473 Unclassified 662
282 Ga0495639_0427799 3300046475 Unclassified 671
283 Ga0495594_0035479 3300046499 Bacteria 2717
284 Ga0495630_0323482 3300046517 Unclassified 1179
285 Ga0495586_0486830 3300046535 Unclassified 712
286 Ga0495657_0004373 3300046675 Bacteria 11275
287 Ga0495657_0186590 3300046675 Unclassified 1269
288 Ga0495675_0050458 3300047444 Unclassified 2645
289 Ga0496104_0242001 3300048907 Bacteria 1717
290 Ga0496109_1757395 3300048912 Unclassified 553
291 Ga0501034_0426242 3300049571 Bacteria 1247
292 Ga0501071_0569056 3300049587 Unclassified 871
293 Ga0501071_1493635 3300049587 Unclassified 522
294 Ga0501202_138087 3300049652 Bacteria 628
295 Ga0501217_172051 3300049661 Bacteria 660
296 Ga0501217_249179 3300049661 Unclassified 572
297 Ga0501217_322129 3300049661 Bacteria 515
298 Ga0501235_063715 3300049669 Bacteria 866
299 Ga0501249_135120 3300049679 Bacteria 611
300 Ga0501249_150494 3300049679 Unclassified 585
301 Ga0501079_0175414 3300049741 Unclassified 1672
302 Ga0501080_0013943 3300049742 Bacteria 7397
303 Ga0501080_0552898 3300049742 Bacteria 1025
304 Ga0501081_0517665 3300049743 Unclassified 890
305 Ga0501083_0506731 3300049744 Bacteria 786
306 Ga0501241_101654 3300049758 Unclassified 620
307 Ga0501263_046428 3300049760 Unclassified 651
308 Ga0501276_029071 3300049773 Unclassified 569
309 Ga0501278_033612 3300049774 Bacteria 531
310 nmdc:mga05p37_840633_c1 3300050507 Bacteria 998
311 nmdc:mga0n895_611167_c1 3300050512 Bacteria 1092
312 nmdc:mga0rr50_57163_c1 3300050513 Unclassified 2917
313 nmdc:mga0rr50_885470_c1 3300050513 Unclassified 761
314 nmdc:mga0rr50_945608_c1 3300050513 Unclassified 735
315 nmdc:mga08x19_358657_c1 3300050514 Unclassified 1019
316 nmdc:mga08x19_44241_c1 3300050514 Bacteria 2842
317 nmdc:mga08x19_784632_c1 3300050514 Unclassified 677
318 nmdc:mga0a205_287242_c1 3300050515 Bacteria 1520
319 Ga0590077_173046 3300059426 Bacteria 520
320 Ga0501082_1185666 3300060353 Unclassified 667
321 Ga0466962_0133933 3300061719 Unclassified 1199
322 Ga0436364_0026116
323 Ga0065707_10247909
324 Ga0070658_10003798
325 Ga0070683_100199764
326 Ga0070690_101067279
327 Ga0070680_101636117
328 Ga0070691_10000806
329 Ga0070661_100071346
330 Ga0070661_100547870
331 Ga0070668_100006989
332 Ga0070669_100321090
333 Ga0070669_101786659
334 Ga0070675_100014169
335 Ga0070675_100097226
336 Ga0070675_100225389
337 Ga0070675_100369601
338 Ga0070675_101097187
339 Ga0070675_101776572
340 Ga0070674_100350036
341 Ga0070673_100081793
342 Ga0070673_101420903
343 Ga0070673_101430552
344 Ga0070688_100406891
345 Ga0070714_100457425
346 Ga0070713_101184351
347 Ga0070694_100324428
348 Ga0070694_100950954
349 Ga0070694_101032516
350 Ga0070678_101143699
351 Ga0070662_101492057
352 Ga0070681_10227767
353 Ga0068867_100504525
354 Ga0070706_100927766
355 Ga0070698_100000026
356 Ga0070699_101924466
357 Ga0070679_100043922
358 Ga0070679_100184991
359 Ga0070679_100414962
360 Ga0070684_100964785
361 Ga0068853_100946285
362 Ga0070672_100063149
363 Ga0070672_100137503
364 Ga0070672_100159941
365 Ga0070686_101122131
366 Ga0070695_100141382
367 Ga0070695_100512742
368 Ga0070696_100155991
369 Ga0070693_100381767
370 Ga0070665_100355620
371 Ga0070704_100088224
372 Ga0068855_100294441
373 Ga0070664_100043617
374 Ga0070664_100065592
375 Ga0068856_100532261
376 Ga0068852_100037293
377 Ga0068859_100031984
378 Ga0068859_100530635
379 Ga0068864_100789453
380 Ga0068861_100123349
381 Ga0068863_101954305
382 Ga0068860_101790286
383 Ga0070717_10427754
384 Ga0070716_100892192
385 Ga0070712_101556671
386 Ga0068871_100017889
387 Ga0068871_100665705
388 Ga0075428_101283482
389 Ga0075430_101389753
390 Ga0075433_10309679
391 Ga0075434_100086222
392 Ga0075434_100748100
393 Ga0075436_100126789
394 Ga0075436_100345344
395 Ga0097620_100031984
396 Ga0097620_100530633
397 Ga0075435_100144357
398 Ga0075435_100288587
399 Ga0075435_101002251
400 Ga0105240_10371064
401 Ga0114129_12608915
402 Ga0105242_10373232
403 Ga0105248_10073166
404 Ga0105248_11248675
405 Ga0105248_13469088
406 Ga0105237_11965462
407 Ga0105249_11381374
408 Ga0105246_12041134
409 Ga0157370_10208121
410 Ga0157369_10309510
411 Ga0157369_10835657
412 Ga0157369_11336043
413 Ga0157372_10044352
414 Ga0157372_12258740
415 Ga0157375_10536413
416 Ga0157375_10671755
417 Ga0157375_11456871
418 Ga0163163_10250011
419 Ga0163163_10595399
420 Ga0163163_11297875
421 Ga0157380_10591975
422 Ga0157380_10758477
423 Ga0157379_10080114
424 Ga0157379_11561785
425 Ga0182007_10186813
426 Ga0206353_10915952
427 Ga0213876_10286967
428 Ga0213875_10005830
429 Ga0213875_10155383
430 Ga0213875_10186011
431 Ga0207682_10024329
432 Ga0207699_10730956
433 Ga0207645_10090356
434 Ga0207705_10008108
435 Ga0207705_10295018
436 Ga0207693_10411257
437 Ga0207693_11070024
438 Ga0207660_10569781
439 Ga0207649_10160134
440 Ga0207649_10317801
441 Ga0207652_10140806
442 Ga0207681_10187310
443 Ga0207681_11529612
444 Ga0207650_11053124
445 Ga0207659_10117916
446 Ga0207659_10385032
447 Ga0207659_10550126
448 Ga0207659_11388106
449 Ga0207664_10385442
450 Ga0207706_10220038
451 Ga0207706_11243476
452 Ga0207686_10686983
453 Ga0207669_10156666
454 Ga0207691_10034408
455 Ga0207691_10074582
456 Ga0207691_10694587
457 Ga0207679_10007100
458 Ga0207679_11425812
459 Ga0207667_10934801
460 Ga0207651_10089644
461 Ga0207651_11185379
462 Ga0207651_11431943
463 Ga0207639_10621786
464 Ga0207678_10378253
465 Ga0207641_10888000
466 Ga0207641_12606175
467 Ga0207648_10148504
468 Ga0207676_10354926
469 Ga0207674_10759077
470 Ga0207675_100105648
471 Ga0207698_10232616
472 Ga0207698_11004831
473 Ga0268264_11781847
474 Ga0265330_10347005
475 Ga0265332_10251222
476 Ga0265325_10095459
477 Ga0265340_10120704
478 Ga0265339_10267249
479 Ga0265331_10310286
480 Ga0307408_100002950
481 Ga0307408_100040543
482 Ga0307408_102498185
483 Ga0265342_10592330
484 Ga0307405_10008337
485 Ga0307405_10022838
486 Ga0307405_10200071
487 Ga0307405_10547762
488 Ga0307405_10710749
489 Ga0307405_10914530
490 Ga0307413_10000306
491 Ga0307413_10001481
492 Ga0307413_10015919
493 Ga0307413_10108462
494 Ga0307413_10116412
495 Ga0307413_10145414
496 Ga0307413_10606756
497 Ga0307413_10636785
498 Ga0307413_11183394
499 Ga0307413_11948253
500 Ga0307410_10001535
501 Ga0307410_10003384
502 Ga0307410_10004819
503 Ga0307410_10062829
504 Ga0307410_10891226
505 Ga0307406_10000686
506 Ga0307406_10003498
507 Ga0307406_10005456
508 Ga0307406_10011783
509 Ga0307406_10335420
510 Ga0307406_10503675
511 Ga0307406_10651668
512 Ga0307406_10678787
513 Ga0307406_11206138
514 Ga0307406_11345088
515 Ga0307406_11733410
516 Ga0307407_10000543
517 Ga0307407_10008828
518 Ga0307407_10016681
519 Ga0307407_10396871
520 Ga0307407_10474487
521 Ga0307412_10006775
522 Ga0307412_10008786
523 Ga0307412_10036884
524 Ga0307412_10046652
525 Ga0307412_10416349
526 Ga0307409_100000326
527 Ga0307409_100013735
528 Ga0307409_100028381
529 Ga0307409_100047746
530 Ga0307409_100138629
531 Ga0307409_100336464
532 Ga0307409_100361205
533 Ga0307409_101505413
534 Ga0307409_102456255
535 Ga0307416_100000519
536 Ga0307416_100000645
537 Ga0307416_100080486
538 Ga0307416_100197685
539 Ga0307416_100344170
540 Ga0307416_100423383
541 Ga0307416_100557232
542 Ga0307416_102487582
543 Ga0307416_102734099
544 Ga0307414_10002657
545 Ga0307414_10109275
546 Ga0307414_10153743
547 Ga0307414_10248211
548 Ga0307414_10297425
549 Ga0307414_10365943
550 Ga0307414_10387606
551 Ga0307414_10919975
552 Ga0307414_12062451
553 Ga0307411_10003738
554 Ga0307411_10004807
555 Ga0307411_10006728
556 Ga0307411_10030900
557 Ga0307411_11098484
558 Ga0307415_100001074
559 Ga0307415_100009977
560 Ga0307415_100011436
561 Ga0307415_100038458
562 Ga0307415_100183439
563 Ga0307415_100209493
564 Ga0307415_101748355
565 Ga0307415_101904998
566 Ga0373926_0024241
567 Ga0373931_0405729
568 Ga0373927_0166631
569 Ga0373947_0263680
570 Ga0373937_1857007
571 Ga0373925_0068473
572 Ga0395899_0026130
573 Ga0395900_0210154
574 Ga0395900_0245299
575 Ga0395898_1434461
576 Ga0395905_0009787
577 Ga0395905_1067842
578 Ga0436364_0807877
579 Ga0436364_1010535
580 Ga0436364_1029411
581 Ga0436364_1118825
582 Ga0436364_1166218
583 Ga0436364_1402036
584 Ga0395901_0005898
585 Ga0436365_0576432
586 Ga0436365_1351531
587 Ga0436365_1929879
588 Ga0436361_0628955
589 Ga0436363_0927441
590 Ga0439439_0034471
591 Ga0439453_0041402
592 Ga0451800_0279448
593 Ga0466963_0191237
594 Ga0466963_0272532
595 Ga0466957_0293373
596 Ga0466959_0410423
597 Ga0451576_0037171
598 Ga0466967_1189524
599 Ga0495603_0047469
600 Ga0495580_0000172
601 Ga0495580_0473374
602 Ga0495582_0559156
603 Ga0495639_0427799
604 Ga0495594_0035479
605 Ga0495630_0323482
606 Ga0495586_0486830
607 Ga0495657_0004373
608 Ga0495657_0186590
609 Ga0495675_0050458
610 Ga0496104_0242001
611 Ga0496109_1757395
612 Ga0501034_0426242
613 Ga0501071_0569056
614 Ga0501071_1493635
615 Ga0501202_138087
616 Ga0501217_172051
617 Ga0501217_249179
618 Ga0501217_322129
619 Ga0501235_063715
620 Ga0501249_135120
621 Ga0501249_150494
622 Ga0501079_0175414
623 Ga0501080_0013943
624 Ga0501080_0552898
625 Ga0501081_0517665
626 Ga0501083_0506731
627 Ga0501241_101654
628 Ga0501263_046428
629 Ga0501276_029071
630 Ga0501278_033612
631 nmdc:mga05p37_840633_c1
632 nmdc:mga0n895_611167_c1
633 nmdc:mga0rr50_57163_c1
634 nmdc:mga0rr50_885470_c1
635 nmdc:mga0rr50_945608_c1
636 nmdc:mga08x19_358657_c1
637 nmdc:mga08x19_44241_c1
638 nmdc:mga08x19_784632_c1
639 nmdc:mga0a205_287242_c1
640 Ga0590077_173046
641 Ga0501082_1185666
642 Ga0466962_0133933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9194 6 101
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9139 5 103
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.907 6 103
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9065 8 104
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9045 6 103
ID Description Score Start End Superfamily
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.905 8 104 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9036 6 103 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8866 8 89 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8778 8 78 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8651 1 99 1.10.10.10
ID Description Score Start End GO Terms
AF-W0RGM1-F1-model_v4 Transcriptional regulator, PadR-family 0.984 6 101
AF-A0A6J4LS10-F1-model_v4 Transcriptional regulator, PadR family 0.9805 6 103
AF-A0A6A7L9E2-F1-model_v4 PadR family transcriptional regulator 0.9749 3 103
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.9748 6 104
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9731 6 102

Map