F406532

General Info

Members Datasets Scaffolds Average Seq Length
322 245 644 132

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0174885|Ga0395900_0174885_817_1257
Length 146
Sequence MIVRTLDEITDTDRDVKTPNWRSKRIVLAGDGVGFSVHETVLDAGTVNDFWYANHIEAVFITEGEGELYDKDNDVTYQLGPGSIYVLNGNERHQLRPRTRMRTVCVFNPPVTGREVHDENGVYPLISPDAAPTTAAGEVESTKEAS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
33 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
34 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
55 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
56 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
157 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
160 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
193 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
194 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
195 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
196 2582580736 Prauserella sp. Am3 Isolate Unclassified
197 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
198 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
199 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
200 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
201 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
202 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
203 2643221692 Nocardia sp. Root136 Isolate Unclassified
204 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
205 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
206 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
207 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
208 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
209 2808606394 Promicromonospora sp. C35 Isolate Unclassified
210 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
211 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
212 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
213 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
214 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
215 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
216 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
217 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
218 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
219 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
220 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
221 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
222 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
223 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
224 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
225 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
226 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
227 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
228 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
229 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
230 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
231 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
232 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
233 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
234 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
235 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
236 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
237 2922554459 Rhodococcus sp. 66b Isolate Unclassified
238 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
239 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
240 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
241 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
242 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
243 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
244 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
245 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.57
Metatranscriptomes 13.66
Isolates 16.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0.31
Rhizoplane 2.8
Rhizosphere 68.32
Stem 0
Stem Tuber 0.31
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0174885 3300037418 Bacteria 2184
2 rootH2_10242294 3300003320 Bacteria 1340
3 Ga0055530_10029848 3300003791 Bacteria 1452
4 JGI25405J52794_10006023 3300003911 Bacteria 2207
5 Ga0070670_101141297 3300005331 Bacteria 711
6 Ga0068868_100172739 3300005338 Bacteria 1790
7 Ga0070668_100001325 3300005347 Bacteria 17726
8 Ga0070668_100037917 3300005347 Bacteria 3682
9 Ga0070668_100124963 3300005347 Bacteria 2060
10 Ga0070668_100561664 3300005347 Bacteria 994
11 Ga0070669_101651894 3300005353 Bacteria 558
12 Ga0070671_100001069 3300005355 Bacteria 20212
13 Ga0070667_100242695 3300005367 Bacteria 1609
14 Ga0070714_100165374 3300005435 Bacteria 2004
15 Ga0070700_100175956 3300005441 Bacteria 1485
16 Ga0070663_100000277 3300005455 Bacteria 25888
17 Ga0070678_102407904 3300005456 Bacteria 500
18 Ga0070681_11734855 3300005458 Bacteria 551
19 Ga0070686_100113068 3300005544 Bacteria 1853
20 Ga0070665_100006798 3300005548 Bacteria 11628
21 Ga0070665_100677759 3300005548 Bacteria 1044
22 Ga0068864_100473457 3300005618 Bacteria 1201
23 Ga0068851_10016612 3300005834 Bacteria 3525
24 Ga0068863_100011962 3300005841 Bacteria 8387
25 Ga0068863_100937834 3300005841 Bacteria 867
26 Ga0068860_100029208 3300005843 Bacteria 5303
27 Ga0068860_100213083 3300005843 Bacteria 1874
28 Ga0068860_100720887 3300005843 Bacteria 1008
29 Ga0081455_10000037 3300005937 Bacteria 136059
30 Ga0081539_10074506 3300005985 Bacteria 1807
31 Ga0075363_100242761 3300006048 Bacteria 1036
32 Ga0075364_10491642 3300006051 Bacteria 839
33 Ga0075432_10110686 3300006058 Bacteria 1023
34 Ga0075362_10537258 3300006177 Bacteria 600
35 Ga0075370_10143683 3300006353 Bacteria 1396
36 Ga0105250_10541839 3300009092 Bacteria 533
37 Ga0105247_10328972 3300009101 Bacteria 1069
38 Ga0105249_13018372 3300009553 Bacteria 540
39 Ga0105029_109539 3300009984 Bacteria 726
40 Ga0105033_113304 3300009986 Bacteria 731
41 Ga0105028_108049 3300009993 Bacteria 1103
42 Ga0157369_10912157 3300013105 Bacteria 901
43 Ga0157379_10016033 3300014968 Bacteria 6588
44 Ga0206350_10870357 3300020080 Bacteria 1700
45 Ga0224712_10487504 3300022467 Bacteria 595
46 Ga0209050_1000813 3300025298 Bacteria 43681
47 Ga0207710_10221128 3300025900 Bacteria 940
48 Ga0207693_10358773 3300025915 Bacteria 1140
49 Ga0207664_10076034 3300025929 Bacteria 2717
50 Ga0207664_10319097 3300025929 Bacteria 1371
51 Ga0207644_10001360 3300025931 Bacteria 15731
52 Ga0207668_10062385 3300025972 Bacteria 2624
53 Ga0207668_10111554 3300025972 Bacteria 2053
54 Ga0207677_10192420 3300026023 Bacteria 1615
55 Ga0207678_10000108 3300026067 Bacteria 67848
56 Ga0207708_10400477 3300026075 Bacteria 1135
57 Ga0207641_10019785 3300026088 Bacteria 5526
58 Ga0207641_10506623 3300026088 Bacteria 1173
59 Ga0268266_10025934 3300028379 Bacteria 4986
60 Ga0268266_10236335 3300028379 Bacteria 1685
61 Ga0268264_10056432 3300028381 Bacteria 3284
62 Ga0268264_10173383 3300028381 Bacteria 1953
63 Ga0268264_10232883 3300028381 Bacteria 1702
64 Ga0307515_10068648 3300028794 Bacteria 4865
65 Ga0307515_10873040 3300028794 Bacteria 528
66 Ga0307511_10299542 3300030521 Bacteria 727
67 Ga0307512_10011888 3300030522 Bacteria 8229
68 Ga0316176_1117183 3300030732 Bacteria 923
69 Ga0314311_1236085 3300030733 Bacteria 1922
70 Ga0316181_1060726 3300030744 Bacteria 686
71 Ga0265327_10000019 3300031251 Bacteria 427653
72 Ga0265327_10000367 3300031251 Bacteria 85619
73 Ga0265327_10012133 3300031251 Bacteria 5846
74 Ga0307513_10002686 3300031456 Bacteria 24488
75 Ga0307513_10049091 3300031456 Bacteria 4574
76 Ga0307513_10106717 3300031456 Bacteria 2806
77 Ga0307513_10147820 3300031456 Bacteria 2265
78 Ga0307513_10231907 3300031456 Bacteria 1658
79 Ga0307408_100046133 3300031548 Bacteria 3116
80 Ga0307408_100069318 3300031548 Bacteria 2600
81 Ga0307408_100895648 3300031548 Bacteria 812
82 Ga0307408_101739015 3300031548 Bacteria 595
83 Ga0316575_10028383 3300031665 Bacteria 2182
84 Ga0307405_10013619 3300031731 Bacteria 4343
85 Ga0307405_10045609 3300031731 Bacteria 2688
86 Ga0307405_10763879 3300031731 Bacteria 806
87 Ga0307405_11272715 3300031731 Bacteria 639
88 Ga0307413_10026127 3300031824 Bacteria 3214
89 Ga0307413_10029738 3300031824 Bacteria 3061
90 Ga0307413_10185307 3300031824 Bacteria 1489
91 Ga0307518_10005350 3300031838 Bacteria 9169
92 Ga0307518_10522412 3300031838 Bacteria 601
93 Ga0307410_10084392 3300031852 Bacteria 2239
94 Ga0307410_10251844 3300031852 Bacteria 1373
95 Ga0307410_10279518 3300031852 Bacteria 1309
96 Ga0307410_11409153 3300031852 Bacteria 612
97 Ga0307406_10033107 3300031901 Bacteria 3161
98 Ga0307407_10030292 3300031903 Bacteria 2918
99 Ga0307412_10216105 3300031911 Bacteria 1466
100 Ga0307409_100141313 3300031995 Bacteria 2075
101 Ga0307409_100221520 3300031995 Bacteria 1708
102 Ga0307409_102637231 3300031995 Bacteria 531
103 Ga0307416_100200577 3300032002 Bacteria 1892
104 Ga0307416_100473655 3300032002 Bacteria 1310
105 Ga0307414_10003353 3300032004 Bacteria 8554
106 Ga0307414_10031554 3300032004 Bacteria 3478
107 Ga0307414_10049660 3300032004 Bacteria 2902
108 Ga0307411_10299459 3300032005 Bacteria 1289
109 Ga0307411_10687002 3300032005 Bacteria 890
110 Ga0307411_11947722 3300032005 Bacteria 548
111 Ga0307415_100056906 3300032126 Bacteria 2684
112 Ga0307415_100116073 3300032126 Bacteria 1996
113 Ga0307507_10010720 3300033179 Bacteria 11752
114 Ga0307510_10160980 3300033180 Bacteria 1841
115 Ga0395899_0216252 3300037312 Bacteria 1329
116 Ga0436361_0419572 3300039447 Bacteria 4538
117 Ga0439438_022406 3300041405 Bacteria 1752
118 Ga0439439_0020360 3300041406 Bacteria 1649
119 Ga0451789_0191377 3300041443 Bacteria 683
120 Ga0451797_0961830 3300041453 Bacteria 542
121 Ga0451807_2034116 3300041486 Bacteria 524
122 Ga0451853_1149488 3300041512 Bacteria 1284
123 Ga0439431_0269240 3300041997 Bacteria 508
124 Ga0439449_0004255 3300042007 Bacteria 5534
125 Ga0439449_0011822 3300042007 Bacteria 3282
126 Ga0439457_001603 3300042014 Bacteria 6744
127 Ga0466969_0116904 3300044656 Bacteria 1244
128 Ga0466972_0009899 3300044658 Bacteria 4784
129 Ga0466972_0015397 3300044658 Bacteria 3822
130 Ga0466965_0000227 3300044683 Bacteria 17945
131 Ga0466966_0342867 3300044684 Bacteria 898
132 Ga0466961_0270167 3300044693 Bacteria 1042
133 Ga0466963_0110405 3300044694 Bacteria 1887
134 Ga0466964_0006225 3300044706 Bacteria 4449
135 Ga0466964_0117297 3300044706 Bacteria 1195
136 Ga0466964_0260777 3300044706 Bacteria 858
137 Ga0466971_0276778 3300044719 Bacteria 803
138 Ga0466968_0109149 3300044735 Bacteria 1243
139 Ga0466968_0365167 3300044735 Bacteria 703
140 Ga0466970_0025556 3300044765 Bacteria 3092
141 Ga0466957_0037723 3300044842 Bacteria 2910
142 Ga0466957_0096694 3300044842 Bacteria 1856
143 Ga0466960_0006272 3300044901 Bacteria 4761
144 Ga0466958_0036959 3300045836 Bacteria 2925
145 Ga0466958_0336135 3300045836 Bacteria 971
146 Ga0466958_1059962 3300045836 Bacteria 529
147 Ga0466967_0041700 3300045976 Bacteria 3960
148 Ga0466967_0041797 3300045976 Bacteria 3957
149 Ga0495627_029126 3300046453 Bacteria 1759
150 Ga0495596_0000696 3300046500 Bacteria 20861
151 Ga0495665_0034942 3300046531 Bacteria 2687
152 Ga0495656_0022023 3300046615 Bacteria 2490
153 Ga0495668_0000043 3300046616 Bacteria 227636
154 Ga0495588_0340619 3300046674 Bacteria 788
155 Ga0495670_0219408 3300046691 Bacteria 1010
156 Ga0495581_0265445 3300047315 Bacteria 1004
157 Ga0495676_0478988 3300047321 Bacteria 819
158 Ga0496100_0003124 3300048903 Bacteria 8573
159 Ga0496100_0432234 3300048903 Bacteria 1007
160 Ga0496102_0000574 3300048905 Bacteria 39023
161 Ga0496103_0000380 3300048906 Bacteria 39723
162 Ga0496111_0035275 3300048914 Bacteria 3574
163 Ga0496114_0731182 3300048917 Bacteria 866
164 Ga0496116_0000183 3300048919 Bacteria 124744
165 Ga0496116_0001035 3300048919 Bacteria 33974
166 Ga0496117_0000059 3300048920 Bacteria 260163
167 Ga0496118_0001225 3300048921 Bacteria 39433
168 Ga0496119_0000955 3300048922 Bacteria 37211
169 Ga0496120_0004216 3300048923 Bacteria 12267
170 Ga0496121_0003157 3300048924 Bacteria 23758
171 Ga0496121_0021696 3300048924 Bacteria 6277
172 Ga0496122_0001374 3300048925 Bacteria 39556
173 Ga0496122_0003519 3300048925 Bacteria 20549
174 Ga0496122_0167543 3300048925 Bacteria 1330
175 Ga0496123_0000858 3300048926 Bacteria 48557
176 Ga0496123_0001146 3300048926 Bacteria 39552
177 Ga0496124_0004559 3300048927 Bacteria 16104
178 Ga0496124_0006202 3300048927 Bacteria 13099
179 Ga0496124_0011877 3300048927 Bacteria 8670
180 Ga0496124_0211000 3300048927 Bacteria 1469
181 Ga0496125_0042757 3300048928 Bacteria 3854
182 Ga0496125_0122556 3300048928 Bacteria 1850
183 Ga0496126_0001443 3300048929 Bacteria 37279
184 Ga0496126_0003265 3300048929 Bacteria 20705
185 Ga0501306_025561 3300049127 Bacteria 850
186 Ga0501311_069903 3300049527 Bacteria 581
187 Ga0501317_075516 3300049533 Bacteria 575
188 Ga0501323_013443 3300049539 Bacteria 1012
189 Ga0501325_011067 3300049541 Bacteria 828
190 Ga0501325_019232 3300049541 Bacteria 706
191 Ga0501031_0759339 3300049568 Bacteria 622
192 Ga0501032_0021418 3300049569 Bacteria 4493
193 Ga0501032_0084302 3300049569 Bacteria 2112
194 Ga0501033_0154725 3300049570 Bacteria 1652
195 Ga0501034_0012231 3300049571 Bacteria 8869
196 Ga0501034_0293676 3300049571 Bacteria 1563
197 Ga0501036_0025799 3300049572 Bacteria 4959
198 Ga0501037_0085162 3300049573 Bacteria 2288
199 Ga0501038_0010538 3300049574 Bacteria 8455
200 Ga0501038_1192684 3300049574 Bacteria 553
201 Ga0501039_0322354 3300049575 Bacteria 1214
202 Ga0501040_0317716 3300049576 Bacteria 1114
203 Ga0501043_0002029 3300049579 Bacteria 17284
204 Ga0501043_0165526 3300049579 Bacteria 1727
205 Ga0501047_0007212 3300049581 Bacteria 10452
206 Ga0501068_0199765 3300049584 Bacteria 1268
207 Ga0501070_0020861 3300049586 Bacteria 5496
208 Ga0501070_0052884 3300049586 Bacteria 3370
209 Ga0501070_0731036 3300049586 Bacteria 781
210 Ga0501070_1068675 3300049586 Bacteria 624
211 Ga0501073_0578071 3300049589 Bacteria 776
212 Ga0501198_098710 3300049649 Bacteria 589
213 Ga0501080_0009086 3300049742 Bacteria 9043
214 Ga0501035_0213199 3300049822 Bacteria 1651
215 Ga0501044_0154069 3300049823 Bacteria 2278
216 Ga0501045_0077379 3300049824 Bacteria 2451
217 nmdc:mga03n38_299230_c1 3300050490 Bacteria 863
218 nmdc:mga03n38_54348_c1 3300050490 Bacteria 1799
219 nmdc:mga03n38_76706_c1 3300050490 Bacteria 1560
220 nmdc:mga07m45_89443_c1 3300050496 Bacteria 1763
221 nmdc:mga07m45_89749_c1 3300050496 Bacteria 1760
222 Ga0495619_0680903 3300053085 Bacteria 700
223 Ga0500644_0061652 3300053088 Bacteria 1323
224 Ga0500658_0070680 3300053134 Bacteria 1472
225 Ga0500559_0006914 3300053136 Bacteria 5076
226 Ga0500568_0036001 3300053139 Bacteria 2017
227 Ga0500577_0043064 3300053142 Bacteria 1656
228 Ga0500589_232492 3300053147 Bacteria 687
229 Ga0500600_0304742 3300053149 Bacteria 680
230 Ga0500634_0168130 3300053161 Bacteria 1003
231 Ga0587084_010419 3300059477 Bacteria 1218
232 Ga0587066_030590 3300059490 Bacteria 957
233 Ga0587073_0033040 3300059492 Bacteria 1082
234 Ga0587077_058352 3300059493 Bacteria 829
235 Ga0587080_004029 3300059503 Bacteria 1877
236 Ga0587082_092930 3300059504 Bacteria 646
237 Ga0587083_0015441 3300059505 Bacteria 1333
238 Ga0587085_036838 3300059506 Bacteria 833
239 Ga0587088_000569 3300059508 Bacteria 3161
240 Ga0587088_030479 3300059508 Bacteria 961
241 Ga0587088_071217 3300059508 Bacteria 725
242 Ga0587088_079283 3300059508 Bacteria 700
243 Ga0587088_125178 3300059508 Bacteria 599
244 Ga0587089_001140 3300059509 Bacteria 2368
245 Ga0587090_004863 3300059510 Bacteria 1655
246 Ga0587091_022949 3300059511 Bacteria 1107
247 Ga0587106_018963 3300059605 Bacteria 999
248 Ga0587129_011943 3300059608 Bacteria 689
249 Ga0587131_001936 3300059609 Bacteria 1076
250 Ga0587101_048975 3300059623 Bacteria 722
251 Ga0587113_000156 3300059625 Bacteria 2864
252 Ga0587115_025208 3300059626 Bacteria 853
253 Ga0587122_000731 3300059628 Bacteria 1889
254 Ga0587128_000505 3300059630 Bacteria 2934
255 Ga0587067_001327 3300059640 Bacteria 2640
256 Ga0587069_000837 3300059642 Bacteria 2580
257 Ga0587072_012348 3300059643 Bacteria 1410
258 Ga0587076_008973 3300059645 Bacteria 1410
259 Ga0587079_024123 3300059647 Bacteria 1119
260 Ga0587102_022896 3300059649 Bacteria 717
261 Ga0587107_004185 3300059652 Bacteria 1450
262 Ga0587114_000548 3300059655 Bacteria 2606
263 Ga0587119_014640 3300059658 Bacteria 943
264 Ga0587120_001965 3300059659 Bacteria 1348
265 Ga0587120_030251 3300059659 Bacteria 551
266 Ga0587071_026263 3300060344 Bacteria 1098
267 Ga0466962_0056281 3300061719 Bacteria 1879
268 Ga0466962_0158334 3300061719 Bacteria 1100
269 2512644790 2512564014 Bacteria 4639632
270 2537900546 2537561592 Bacteria 4348607
271 2558910430 2558860112 Bacteria 9931328
272 2566994038 2565956761 Bacteria 6601618
273 2583149214 2582580736 Bacteria 5325865
274 2586057776 2585427649 Bacteria 9053857
275 2643731766 2643221541 Bacteria 5498788
276 2643947017 2643221587 Bacteria 7586415
277 2644041907 2643221606 Bacteria 5588032
278 2644394450 2643221671 Bacteria 5496681
279 2644433511 2643221677 Bacteria 7584031
280 2644512039 2643221692 Bacteria 7282860
281 2738889598 2738541308 Bacteria 7020677
282 2739605117 2739367654 Bacteria 6049412
283 2760307966 2758568522 Bacteria 5953541
284 2774396249 2773857762 Bacteria 5971770
285 2795780318 2795385470 Bacteria 8317180
286 2809028322 2808606394 Bacteria 6248540
287 2809065081 2808606401 Bacteria 4586670
288 2809081048 2808606404 Bacteria 4652788
289 2809085413 2808606405 Bacteria 4586632
290 2809197880 2808606439 Bacteria 5952208
291 2809593393 2808606522 Bacteria 9488490
292 2812347628 2811994878 Bacteria 5992952
293 2816505930 2816332139 Bacteria 9138787
294 2819555422 2818991438 Bacteria 5793701
295 2839989324 2839986021 Bacteria 3685650
296 2848553380 2848551377 Bacteria 3720646
297 2852649668 2852646457 Bacteria 3408613
298 2863069432 2863067949 Bacteria 8541735
299 2866557443 2866552031 Bacteria 5824618
300 2866612642 2866612099 Bacteria 7543886
301 2870782956 2870782633 Bacteria 9624083
302 2880520784 2880518877 Bacteria 5012590
303 2887443809 2887443736 Bacteria 4426037
304 2891331048 2891326441 Bacteria 6439512
305 2891968971 2891968417 Bacteria 5821697
306 2897562610 2897561785 Bacteria 3256946
307 2899366043 2899359706 Bacteria 10940472
308 2899374801 2899370129 Bacteria 6781179
309 2904539806 2904535858 Bacteria 6308016
310 2906801686 2906799679 Bacteria 4031749
311 2915769459 2915768154 Bacteria 8424322
312 2917740650 2917736166 Bacteria 9690793
313 2919709295 2919709256 Bacteria 4318106
314 2922560375 2922554459 Bacteria 6683962
315 2945969780 2945968032 Bacteria 4111363
316 3003009067 3002998708 Bacteria 11715108
317 8003319769 8003314358 Bacteria 10575343
318 8053947461 8053945823 Bacteria 8962862
319 8054476942 8054472261 Bacteria 7464355
320 8056209670 8056207758 Bacteria 8639239
321 8056582351 8056579771 Bacteria 5840325
322 8056685611 8056681323 Bacteria 8472857
323 Ga0395900_0174885
324 rootH2_10242294
325 Ga0055530_10029848
326 JGI25405J52794_10006023
327 Ga0070670_101141297
328 Ga0068868_100172739
329 Ga0070668_100001325
330 Ga0070668_100037917
331 Ga0070668_100124963
332 Ga0070668_100561664
333 Ga0070669_101651894
334 Ga0070671_100001069
335 Ga0070667_100242695
336 Ga0070714_100165374
337 Ga0070700_100175956
338 Ga0070663_100000277
339 Ga0070678_102407904
340 Ga0070681_11734855
341 Ga0070686_100113068
342 Ga0070665_100006798
343 Ga0070665_100677759
344 Ga0068864_100473457
345 Ga0068851_10016612
346 Ga0068863_100011962
347 Ga0068863_100937834
348 Ga0068860_100029208
349 Ga0068860_100213083
350 Ga0068860_100720887
351 Ga0081455_10000037
352 Ga0081539_10074506
353 Ga0075363_100242761
354 Ga0075364_10491642
355 Ga0075432_10110686
356 Ga0075362_10537258
357 Ga0075370_10143683
358 Ga0105250_10541839
359 Ga0105247_10328972
360 Ga0105249_13018372
361 Ga0105029_109539
362 Ga0105033_113304
363 Ga0105028_108049
364 Ga0157369_10912157
365 Ga0157379_10016033
366 Ga0206350_10870357
367 Ga0224712_10487504
368 Ga0209050_1000813
369 Ga0207710_10221128
370 Ga0207693_10358773
371 Ga0207664_10076034
372 Ga0207664_10319097
373 Ga0207644_10001360
374 Ga0207668_10062385
375 Ga0207668_10111554
376 Ga0207677_10192420
377 Ga0207678_10000108
378 Ga0207708_10400477
379 Ga0207641_10019785
380 Ga0207641_10506623
381 Ga0268266_10025934
382 Ga0268266_10236335
383 Ga0268264_10056432
384 Ga0268264_10173383
385 Ga0268264_10232883
386 Ga0307515_10068648
387 Ga0307515_10873040
388 Ga0307511_10299542
389 Ga0307512_10011888
390 Ga0316176_1117183
391 Ga0314311_1236085
392 Ga0316181_1060726
393 Ga0265327_10000019
394 Ga0265327_10000367
395 Ga0265327_10012133
396 Ga0307513_10002686
397 Ga0307513_10049091
398 Ga0307513_10106717
399 Ga0307513_10147820
400 Ga0307513_10231907
401 Ga0307408_100046133
402 Ga0307408_100069318
403 Ga0307408_100895648
404 Ga0307408_101739015
405 Ga0316575_10028383
406 Ga0307405_10013619
407 Ga0307405_10045609
408 Ga0307405_10763879
409 Ga0307405_11272715
410 Ga0307413_10026127
411 Ga0307413_10029738
412 Ga0307413_10185307
413 Ga0307518_10005350
414 Ga0307518_10522412
415 Ga0307410_10084392
416 Ga0307410_10251844
417 Ga0307410_10279518
418 Ga0307410_11409153
419 Ga0307406_10033107
420 Ga0307407_10030292
421 Ga0307412_10216105
422 Ga0307409_100141313
423 Ga0307409_100221520
424 Ga0307409_102637231
425 Ga0307416_100200577
426 Ga0307416_100473655
427 Ga0307414_10003353
428 Ga0307414_10031554
429 Ga0307414_10049660
430 Ga0307411_10299459
431 Ga0307411_10687002
432 Ga0307411_11947722
433 Ga0307415_100056906
434 Ga0307415_100116073
435 Ga0307507_10010720
436 Ga0307510_10160980
437 Ga0395899_0216252
438 Ga0436361_0419572
439 Ga0439438_022406
440 Ga0439439_0020360
441 Ga0451789_0191377
442 Ga0451797_0961830
443 Ga0451807_2034116
444 Ga0451853_1149488
445 Ga0439431_0269240
446 Ga0439449_0004255
447 Ga0439449_0011822
448 Ga0439457_001603
449 Ga0466969_0116904
450 Ga0466972_0009899
451 Ga0466972_0015397
452 Ga0466965_0000227
453 Ga0466966_0342867
454 Ga0466961_0270167
455 Ga0466963_0110405
456 Ga0466964_0006225
457 Ga0466964_0117297
458 Ga0466964_0260777
459 Ga0466971_0276778
460 Ga0466968_0109149
461 Ga0466968_0365167
462 Ga0466970_0025556
463 Ga0466957_0037723
464 Ga0466957_0096694
465 Ga0466960_0006272
466 Ga0466958_0036959
467 Ga0466958_0336135
468 Ga0466958_1059962
469 Ga0466967_0041700
470 Ga0466967_0041797
471 Ga0495627_029126
472 Ga0495596_0000696
473 Ga0495665_0034942
474 Ga0495656_0022023
475 Ga0495668_0000043
476 Ga0495588_0340619
477 Ga0495670_0219408
478 Ga0495581_0265445
479 Ga0495676_0478988
480 Ga0496100_0003124
481 Ga0496100_0432234
482 Ga0496102_0000574
483 Ga0496103_0000380
484 Ga0496111_0035275
485 Ga0496114_0731182
486 Ga0496116_0000183
487 Ga0496116_0001035
488 Ga0496117_0000059
489 Ga0496118_0001225
490 Ga0496119_0000955
491 Ga0496120_0004216
492 Ga0496121_0003157
493 Ga0496121_0021696
494 Ga0496122_0001374
495 Ga0496122_0003519
496 Ga0496122_0167543
497 Ga0496123_0000858
498 Ga0496123_0001146
499 Ga0496124_0004559
500 Ga0496124_0006202
501 Ga0496124_0011877
502 Ga0496124_0211000
503 Ga0496125_0042757
504 Ga0496125_0122556
505 Ga0496126_0001443
506 Ga0496126_0003265
507 Ga0501306_025561
508 Ga0501311_069903
509 Ga0501317_075516
510 Ga0501323_013443
511 Ga0501325_011067
512 Ga0501325_019232
513 Ga0501031_0759339
514 Ga0501032_0021418
515 Ga0501032_0084302
516 Ga0501033_0154725
517 Ga0501034_0012231
518 Ga0501034_0293676
519 Ga0501036_0025799
520 Ga0501037_0085162
521 Ga0501038_0010538
522 Ga0501038_1192684
523 Ga0501039_0322354
524 Ga0501040_0317716
525 Ga0501043_0002029
526 Ga0501043_0165526
527 Ga0501047_0007212
528 Ga0501068_0199765
529 Ga0501070_0020861
530 Ga0501070_0052884
531 Ga0501070_0731036
532 Ga0501070_1068675
533 Ga0501073_0578071
534 Ga0501198_098710
535 Ga0501080_0009086
536 Ga0501035_0213199
537 Ga0501044_0154069
538 Ga0501045_0077379
539 nmdc:mga03n38_299230_c1
540 nmdc:mga03n38_54348_c1
541 nmdc:mga03n38_76706_c1
542 nmdc:mga07m45_89443_c1
543 nmdc:mga07m45_89749_c1
544 Ga0495619_0680903
545 Ga0500644_0061652
546 Ga0500658_0070680
547 Ga0500559_0006914
548 Ga0500568_0036001
549 Ga0500577_0043064
550 Ga0500589_232492
551 Ga0500600_0304742
552 Ga0500634_0168130
553 Ga0587084_010419
554 Ga0587066_030590
555 Ga0587073_0033040
556 Ga0587077_058352
557 Ga0587080_004029
558 Ga0587082_092930
559 Ga0587083_0015441
560 Ga0587085_036838
561 Ga0587088_000569
562 Ga0587088_030479
563 Ga0587088_071217
564 Ga0587088_079283
565 Ga0587088_125178
566 Ga0587089_001140
567 Ga0587090_004863
568 Ga0587091_022949
569 Ga0587106_018963
570 Ga0587129_011943
571 Ga0587131_001936
572 Ga0587101_048975
573 Ga0587113_000156
574 Ga0587115_025208
575 Ga0587122_000731
576 Ga0587128_000505
577 Ga0587067_001327
578 Ga0587069_000837
579 Ga0587072_012348
580 Ga0587076_008973
581 Ga0587079_024123
582 Ga0587102_022896
583 Ga0587107_004185
584 Ga0587114_000548
585 Ga0587119_014640
586 Ga0587120_001965
587 Ga0587120_030251
588 Ga0587071_026263
589 Ga0466962_0056281
590 Ga0466962_0158334
591 2512644790
592 2537900546
593 2558910430
594 2566994038
595 2583149214
596 2586057776
597 2643731766
598 2643947017
599 2644041907
600 2644394450
601 2644433511
602 2644512039
603 2738889598
604 2739605117
605 2760307966
606 2774396249
607 2795780318
608 2809028322
609 2809065081
610 2809081048
611 2809085413
612 2809197880
613 2809593393
614 2812347628
615 2816505930
616 2819555422
617 2839989324
618 2848553380
619 2852649668
620 2863069432
621 2866557443
622 2866612642
623 2870782956
624 2880520784
625 2887443809
626 2891331048
627 2891968971
628 2897562610
629 2899366043
630 2899374801
631 2904539806
632 2906801686
633 2915769459
634 2917740650
635 2919709295
636 2922560375
637 2945969780
638 3003009067
639 8003319769
640 8053947461
641 8054476942
642 8056209670
643 8056582351
644 8056685611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06339

Ectoine_synth

Ectoine synthase

1

127

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bxx-assembly2.cif.gz_C crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis 0.9666 1 111
5bxx-assembly2.cif.gz_C crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis 0.9581 1 111
2pyt-assembly1.cif.gz_B crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution 0.9058 21 109
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8737 23 109
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8649 34 106
ID Description Score Start End Superfamily
5bxxC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9666 1 111 2.60.120.10
5bxxC00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9581 1 111 2.60.120.10
2pytB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8978 22 109 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8812 13 108 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8749 33 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A829HXN5-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.997 33 109 GO:0019491
GO:0033990
AF-A0A1U1PDY6-F1-model_v4 deleted 0.9941 1 109
AF-A0A142BYK3-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.9896 1 94 GO:0019491
GO:0033990
AF-A0A356U6S8-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.987 1 101 GO:0019491
GO:0033990
AF-A0A7X9JYF4-F1-model_v4 L-ectoine synthase (EC 4.2.1.108) (N-acetyldiaminobutyrate dehydratase) 0.9752 1 108 GO:0019491
GO:0033990

Map