F406500

General Info

Members Datasets Scaffolds Average Seq Length
322 196 644 285

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10089827|Ga0207428_100898273
Length 324
Sequence MKTLAVVGQRCIFMRRALSNKIRGCKHCHLVRVVHNPEVQIWQKLKITLEMIKFEHTIFALPFAFIGALLAGHGLPSAWQIGWIVAAMVGARSAAMTFNRIVDLQYDRLNPRTEGRALPAGTLSMPFALAFTLLMAGLFVFSAAQLNPICFYLSFPTLAILLFYSYTKRFTSLSHLFLGIAIGLAPLAAWLAVRGEFGWPPVLLSAAVMFWVAGFDVIYALQDMEFDRSNRLFSLPSRLGPGPALTLSSGFHALTILLLIATAFWTQLGPIAYAGIAVVAAILFWEHRIVKPNDLSRVNVAFFSLNGYVSILLLISFATDILTR

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.31
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 0
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 12.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10089827 3300027907 Bacteria 2387
2 Ga0070683_100001856 3300005329 Bacteria 16491
3 Ga0070683_100056728 3300005329 Bacteria 3637
4 Ga0070670_100032942 3300005331 Unclassified 4465
5 Ga0068869_100175418 3300005334 Bacteria 1677
6 Ga0070666_10023361 3300005335 Bacteria 4025
7 Ga0070666_10090029 3300005335 Bacteria 2107
8 Ga0070680_100004843 3300005336 Bacteria 10137
9 Ga0070669_100373195 3300005353 Unclassified 1162
10 Ga0070675_100000133 3300005354 Bacteria 44841
11 Ga0070675_100006012 3300005354 Bacteria 9302
12 Ga0070675_100014483 3300005354 Bacteria 6220
13 Ga0070675_100254789 3300005354 Bacteria 1537
14 Ga0070673_100035195 3300005364 Unclassified 3795
15 Ga0070673_100050512 3300005364 Bacteria 3252
16 Ga0070688_100076660 3300005365 Unclassified 2152
17 Ga0070688_100298653 3300005365 Bacteria 1163
18 Ga0070667_100004270 3300005367 Bacteria 12063
19 Ga0070703_10111708 3300005406 Unclassified 979
20 Ga0070714_100081107 3300005435 Bacteria 2824
21 Ga0070713_100031368 3300005436 Bacteria 4233
22 Ga0070708_100280837 3300005445 Bacteria 1567
23 Ga0070681_10001551 3300005458 Bacteria 20353
24 Ga0070681_10120591 3300005458 Bacteria 2557
25 Ga0070681_10350693 3300005458 Bacteria 1386
26 Ga0070707_100032409 3300005468 Bacteria 4979
27 Ga0070698_100109795 3300005471 Bacteria 2724
28 Ga0070698_100199777 3300005471 Unclassified 1935
29 Ga0070698_100571670 3300005471 Bacteria 1070
30 Ga0070699_100115734 3300005518 Bacteria 2356
31 Ga0070699_100350037 3300005518 Unclassified 1331
32 Ga0070699_100378864 3300005518 Bacteria 1277
33 Ga0070679_100001406 3300005530 Bacteria 21251
34 Ga0070679_100052293 3300005530 Bacteria 4070
35 Ga0070684_100012043 3300005535 Bacteria 6914
36 Ga0070697_100112822 3300005536 Bacteria 2267
37 Ga0068853_100033561 3300005539 Bacteria 4356
38 Ga0070672_100078720 3300005543 Unclassified 2638
39 Ga0070672_100244828 3300005543 Bacteria 1509
40 Ga0070686_100019378 3300005544 Bacteria 4008
41 Ga0070686_100356874 3300005544 Bacteria 1100
42 Ga0070696_100004516 3300005546 Bacteria 9287
43 Ga0070665_100041636 3300005548 Bacteria 4618
44 Ga0070665_100101316 3300005548 Unclassified 2884
45 Ga0070665_100113695 3300005548 Bacteria 2710
46 Ga0070704_100004011 3300005549 Bacteria 8499
47 Ga0068855_100017086 3300005563 Bacteria 8728
48 Ga0068855_100099048 3300005563 Bacteria 3358
49 Ga0068855_100183309 3300005563 Bacteria 2366
50 Ga0070664_100008467 3300005564 Bacteria 8317
51 Ga0070664_100068315 3300005564 Bacteria 3038
52 Ga0068857_100000274 3300005577 Bacteria 35189
53 Ga0068856_100001029 3300005614 Bacteria 29689
54 Ga0068852_100010033 3300005616 Bacteria 7048
55 Ga0068859_100001124 3300005617 Bacteria 27357
56 Ga0068859_100004415 3300005617 Bacteria 14350
57 Ga0068864_100208615 3300005618 Unclassified 1798
58 Ga0068863_100001603 3300005841 Bacteria 22354
59 Ga0068863_100184560 3300005841 Bacteria 2003
60 Ga0068858_100017209 3300005842 Bacteria 6784
61 Ga0068858_100083360 3300005842 Bacteria 2973
62 Ga0068858_100091606 3300005842 Bacteria 2829
63 Ga0068860_100004397 3300005843 Bacteria 14396
64 Ga0068860_100286082 3300005843 Bacteria 1612
65 Ga0070717_10022390 3300006028 Bacteria 4993
66 Ga0070717_10060841 3300006028 Bacteria 3128
67 Ga0075363_100121959 3300006048 Bacteria 1456
68 Ga0070715_10213706 3300006163 Bacteria 987
69 Ga0097621_100044298 3300006237 Bacteria 3590
70 Ga0075370_10186246 3300006353 Bacteria 1222
71 Ga0068871_100006302 3300006358 Bacteria 8381
72 Ga0068871_100042695 3300006358 Bacteria 3641
73 Ga0075428_100050646 3300006844 Bacteria 4554
74 Ga0075428_100655966 3300006844 Bacteria 1119
75 Ga0075430_100064547 3300006846 Unclassified 3076
76 Ga0075430_100124612 3300006846 Bacteria 2148
77 Ga0075431_100012010 3300006847 Bacteria 8738
78 Ga0075431_100027524 3300006847 Bacteria 5835
79 Ga0075431_100060459 3300006847 Bacteria 3909
80 Ga0075433_10012348 3300006852 Bacteria 6895
81 Ga0075434_100051905 3300006871 Bacteria 4074
82 Ga0068865_100102014 3300006881 Bacteria 2102
83 Ga0075436_100023804 3300006914 Bacteria 4208
84 Ga0075436_100212271 3300006914 Bacteria 1372
85 Ga0075436_100261992 3300006914 Bacteria 1233
86 Ga0097620_100001124 3300006931 Bacteria 27357
87 Ga0097620_100004415 3300006931 Bacteria 14350
88 Ga0105240_10008079 3300009093 Bacteria 15121
89 Ga0105240_10014483 3300009093 Bacteria 10766
90 Ga0105240_10027707 3300009093 Bacteria 7414
91 Ga0105240_10035521 3300009093 Bacteria 6421
92 Ga0105240_10203614 3300009093 Bacteria 2318
93 Ga0105240_10394895 3300009093 Bacteria 1559
94 Ga0105240_10407941 3300009093 Bacteria 1529
95 Ga0111539_10003890 3300009094 Bacteria 19648
96 Ga0111539_10014800 3300009094 Bacteria 9730
97 Ga0111539_10081458 3300009094 Bacteria 3807
98 Ga0105245_10015783 3300009098 Bacteria 6586
99 Ga0105245_10051346 3300009098 Bacteria 3697
100 Ga0105245_10051568 3300009098 Bacteria 3688
101 Ga0114129_10037301 3300009147 Bacteria 6863
102 Ga0114129_10056845 3300009147 Bacteria 5477
103 Ga0114129_10230898 3300009147 Bacteria 2492
104 Ga0114129_10365733 3300009147 Bacteria 1908
105 Ga0114129_10392420 3300009147 Bacteria 1830
106 Ga0105243_10040920 3300009148 Bacteria 3623
107 Ga0105241_10029254 3300009174 Bacteria 4109
108 Ga0105241_10168672 3300009174 Unclassified 1806
109 Ga0105241_10201418 3300009174 Bacteria 1663
110 Ga0105242_10007899 3300009176 Bacteria 8188
111 Ga0105242_10073657 3300009176 Bacteria 2840
112 Ga0105248_10000748 3300009177 Bacteria 36506
113 Ga0105237_10005322 3300009545 Bacteria 14554
114 Ga0105237_10006646 3300009545 Bacteria 12782
115 Ga0105238_10110627 3300009551 Bacteria 2727
116 Ga0105238_10457629 3300009551 Bacteria 1273
117 Ga0105239_10614112 3300010375 Unclassified 1241
118 Ga0157370_10021976 3300013104 Bacteria 6353
119 Ga0157374_10047250 3300013296 Bacteria 3991
120 Ga0157378_10083352 3300013297 Unclassified 2893
121 Ga0157378_10466321 3300013297 Bacteria 1256
122 Ga0163162_10019055 3300013306 Bacteria 6730
123 Ga0157372_10008144 3300013307 Bacteria 11145
124 Ga0157375_10001761 3300013308 Bacteria 18567
125 Ga0157375_10406229 3300013308 Bacteria 1528
126 Ga0157375_10499395 3300013308 Bacteria 1381
127 Ga0163163_10001514 3300014325 Bacteria 19640
128 Ga0163163_10018100 3300014325 Bacteria 6584
129 Ga0163163_10030972 3300014325 Bacteria 5158
130 Ga0163163_10506294 3300014325 Bacteria 1269
131 Ga0157380_10026837 3300014326 Unclassified 4376
132 Ga0157377_10188039 3300014745 Unclassified 1303
133 Ga0157379_10000057 3300014968 Bacteria 70302
134 Ga0157376_10017852 3300014969 Bacteria 5424
135 Ga0157376_10042996 3300014969 Bacteria 3706
136 Ga0157376_10062586 3300014969 Bacteria 3131
137 Ga0157376_10143291 3300014969 Bacteria 2146
138 Ga0163161_10272366 3300017792 Unclassified 1325
139 Ga0213873_10008231 3300021358 Bacteria 2122
140 Ga0213876_10006231 3300021384 Bacteria 6506
141 Ga0213875_10000006 3300021388 Bacteria 579005
142 Ga0213875_10015586 3300021388 Unclassified 3697
143 Ga0207656_10111939 3300025321 Bacteria 1262
144 Ga0207653_10021165 3300025885 Bacteria 2062
145 Ga0207680_10030876 3300025903 Unclassified 3028
146 Ga0207654_10075280 3300025911 Bacteria 2017
147 Ga0207707_10000705 3300025912 Bacteria 33231
148 Ga0207707_10014373 3300025912 Bacteria 6895
149 Ga0207695_10000843 3300025913 Bacteria 56294
150 Ga0207695_10017337 3300025913 Bacteria 8383
151 Ga0207695_10045022 3300025913 Unclassified 4688
152 Ga0207695_10148472 3300025913 Bacteria 2285
153 Ga0207671_10010637 3300025914 Bacteria 7569
154 Ga0207671_10024725 3300025914 Bacteria 4511
155 Ga0207660_10022182 3300025917 Bacteria 4277
156 Ga0207662_10124715 3300025918 Bacteria 1618
157 Ga0207657_10075693 3300025919 Bacteria 2840
158 Ga0207652_10015720 3300025921 Bacteria 6165
159 Ga0207652_10038844 3300025921 Bacteria 4037
160 Ga0207646_10004237 3300025922 Bacteria 15673
161 Ga0207694_10000435 3300025924 Bacteria 38792
162 Ga0207694_10079174 3300025924 Bacteria 2577
163 Ga0207650_10072051 3300025925 Unclassified 2600
164 Ga0207659_10000598 3300025926 Bacteria 21516
165 Ga0207659_10001418 3300025926 Bacteria 14282
166 Ga0207659_10006832 3300025926 Bacteria 7015
167 Ga0207659_10107218 3300025926 Bacteria 2117
168 Ga0207687_10001669 3300025927 Bacteria 15309
169 Ga0207687_10027264 3300025927 Bacteria 3832
170 Ga0207687_10029466 3300025927 Bacteria 3692
171 Ga0207700_10026480 3300025928 Bacteria 4044
172 Ga0207664_10082753 3300025929 Bacteria 2615
173 Ga0207706_10115089 3300025933 Unclassified 2365
174 Ga0207686_10042865 3300025934 Bacteria 2769
175 Ga0207665_10208649 3300025939 Bacteria 1426
176 Ga0207691_10204563 3300025940 Unclassified 1717
177 Ga0207691_10329958 3300025940 Bacteria 1307
178 Ga0207711_10000565 3300025941 Bacteria 37724
179 Ga0207711_10082523 3300025941 Bacteria 2810
180 Ga0207711_10457631 3300025941 Bacteria 1188
181 Ga0207689_10070603 3300025942 Bacteria 2869
182 Ga0207679_10127675 3300025945 Unclassified 2035
183 Ga0207667_10002003 3300025949 Bacteria 25560
184 Ga0207667_10179953 3300025949 Bacteria 2171
185 Ga0207667_10185925 3300025949 Bacteria 2133
186 Ga0207651_10151967 3300025960 Unclassified 1803
187 Ga0207651_10180476 3300025960 Bacteria 1674
188 Ga0207658_10005083 3300025986 Bacteria 9047
189 Ga0207703_10052009 3300026035 Unclassified 3324
190 Ga0207703_10584662 3300026035 Bacteria 1055
191 Ga0207639_10038950 3300026041 Bacteria 3539
192 Ga0207639_10298510 3300026041 Bacteria 1423
193 Ga0207702_10001718 3300026078 Bacteria 21566
194 Ga0207702_10286612 3300026078 Bacteria 1559
195 Ga0207641_10002771 3300026088 Bacteria 15964
196 Ga0207641_10077413 3300026088 Bacteria 2878
197 Ga0207641_10165611 3300026088 Bacteria 2013
198 Ga0207676_10577813 3300026095 Unclassified 1077
199 Ga0207674_10000110 3300026116 Bacteria 94822
200 Ga0209974_10081423 3300027876 Unclassified 1115
201 Ga0268266_10044062 3300028379 Bacteria 3813
202 Ga0268264_10259670 3300028381 Bacteria 1618
203 Ga0265323_10005842 3300028653 Bacteria 5204
204 Ga0265760_10001642 3300031090 Bacteria 6568
205 Ga0265330_10068057 3300031235 Unclassified 1543
206 Ga0265325_10075041 3300031241 Bacteria 1690
207 Ga0265327_10041466 3300031251 Bacteria 2481
208 Ga0265316_10001748 3300031344 Bacteria 23044
209 Ga0265316_10296026 3300031344 Bacteria 1180
210 Ga0265314_10009420 3300031711 Bacteria 8236
211 Ga0316576_10007771 3300031727 Bacteria 6774
212 Ga0307416_100005080 3300032002 Bacteria 8029
213 Ga0307414_10285398 3300032004 Unclassified 1389
214 Ga0373934_0000656 3300035086 Bacteria 12305
215 Ga0373923_0040188 3300035111 Bacteria 1924
216 Ga0373953_0040135 3300035117 Bacteria 1858
217 Ga0373954_0007602 3300035118 Bacteria 4745
218 Ga0373956_0063260 3300035119 Bacteria 1678
219 Ga0373943_0128010 3300035170 Unclassified 1356
220 Ga0373955_0001060 3300035172 Bacteria 11712
221 Ga0316574_0070784 3300035398 Bacteria 2202
222 Ga0373935_0054435 3300035692 Unclassified 2548
223 Ga0373927_0005126 3300035695 Bacteria 9068
224 Ga0373927_0153510 3300035695 Bacteria 1508
225 Ga0373947_0005044 3300035725 Bacteria 7732
226 Ga0373937_0010524 3300036401 Bacteria 8076
227 Ga0373937_0022939 3300036401 Bacteria 5613
228 Ga0373925_0002380 3300037068 Bacteria 15089
229 Ga0373925_0298640 3300037068 Bacteria 1300
230 Ga0316581_0059575 3300037588 Bacteria 1171
231 Ga0436364_0043838 3300037853 Bacteria 6190
232 Ga0436364_0104664 3300037853 Bacteria 1821
233 Ga0436364_0478514 3300037853 Bacteria 578677
234 Ga0436364_0622498 3300037853 Bacteria 3925
235 Ga0436364_0673912 3300037853 Bacteria 4690
236 Ga0436364_0833382 3300037853 Bacteria 1873
237 Ga0436364_0980627 3300037853 Unclassified 970
238 Ga0436364_1302831 3300037853 Unclassified 4512
239 Ga0436364_1329024 3300037853 Bacteria 2923
240 Ga0436365_0113537 3300039437 Bacteria 1841
241 Ga0436365_0475839 3300039437 Bacteria 1936
242 Ga0436360_0736298 3300039438 Bacteria 7379
243 Ga0436361_1204679 3300039447 Bacteria 5872
244 Ga0436362_0210421 3300039453 Unclassified 3278
245 Ga0436362_0291115 3300039453 Bacteria 9023
246 Ga0436362_0352079 3300039453 Bacteria 4652
247 Ga0451577_0008693 3300042876 Bacteria 9851
248 Ga0451577_0204807 3300042876 Bacteria 1781
249 Ga0451577_0385385 3300042876 Bacteria 1272
250 Ga0453684_0004270 3300044712 Bacteria 30512
251 Ga0453684_0019037 3300044712 Bacteria 10486
252 Ga0453684_0069148 3300044712 Bacteria 4480
253 Ga0453684_0482541 3300044712 Unclassified 1375
254 Ga0495580_0000396 3300046472 Bacteria 35673
255 Ga0495580_0178779 3300046472 Bacteria 1465
256 Ga0495582_0109551 3300046473 Bacteria 1551
257 Ga0495608_0119214 3300046511 Bacteria 1693
258 Ga0495652_0035313 3300046529 Bacteria 4352
259 Ga0495665_0050449 3300046531 Bacteria 2206
260 Ga0495645_0053690 3300046543 Bacteria 2929
261 Ga0495645_0090157 3300046543 Bacteria 2192
262 Ga0495645_0123407 3300046543 Bacteria 1822
263 Ga0495667_0174838 3300046559 Bacteria 1379
264 Ga0495623_0195003 3300046679 Bacteria 1168
265 Ga0495613_0047276 3300046689 Bacteria 3179
266 Ga0495684_0013738 3300047471 Bacteria 6233
267 Ga0501031_0040111 3300049568 Unclassified 3057
268 Ga0501032_0001821 3300049569 Bacteria 16847
269 Ga0501033_0004018 3300049570 Bacteria 11885
270 Ga0501034_0010156 3300049571 Bacteria 9823
271 Ga0501034_0014229 3300049571 Bacteria 8201
272 Ga0501036_0000814 3300049572 Bacteria 23171
273 Ga0501037_0002216 3300049573 Bacteria 14038
274 Ga0501037_0304119 3300049573 Bacteria 1107
275 Ga0501038_0010651 3300049574 Bacteria 8406
276 Ga0501039_0010076 3300049575 Bacteria 7203
277 Ga0501040_0178009 3300049576 Bacteria 1507
278 Ga0501043_0003634 3300049579 Bacteria 12669
279 Ga0501046_0000783 3300049580 Bacteria 30741
280 Ga0501047_0017464 3300049581 Bacteria 6872
281 Ga0501048_0001371 3300049582 Bacteria 18434
282 Ga0501067_0001195 3300049583 Bacteria 14103
283 Ga0501068_0005632 3300049584 Bacteria 6860
284 Ga0501069_0000558 3300049585 Bacteria 17157
285 Ga0501070_0013650 3300049586 Bacteria 6843
286 Ga0501072_0001726 3300049588 Bacteria 16284
287 Ga0501073_0000325 3300049589 Bacteria 31963
288 Ga0501074_0011823 3300049590 Bacteria 6345
289 Ga0501075_0061601 3300049591 Bacteria 2828
290 Ga0501075_0084774 3300049591 Bacteria 2400
291 Ga0501076_0051197 3300049592 Bacteria 3268
292 Ga0501076_0348456 3300049592 Bacteria 1216
293 Ga0501077_0014523 3300049593 Bacteria 4949
294 Ga0501079_0005683 3300049741 Bacteria 9313
295 Ga0501080_0000021 3300049742 Bacteria 91749
296 Ga0501081_0024507 3300049743 Bacteria 4051
297 Ga0501083_0004214 3300049744 Bacteria 10125
298 Ga0501035_0006187 3300049822 Bacteria 11258
299 Ga0501044_0041805 3300049823 Bacteria 4771
300 Ga0501044_0175228 3300049823 Bacteria 2114
301 nmdc:mga07m45_62497_c2 3300050496 Bacteria 1221
302 nmdc:mga05p37_115477_c1 3300050507 Bacteria 3300
303 nmdc:mga05p37_380059_c1 3300050507 Bacteria 1655
304 nmdc:mga05p37_46517_c1 3300050507 Bacteria 5335
305 nmdc:mga05p37_693150_c1 3300050507 Bacteria 1133
306 nmdc:mga0qj67_122024_c1 3300050509 Unclassified 2108
307 nmdc:mga0qj67_299078_c1 3300050509 Bacteria 1304
308 nmdc:mga06r32_22573_c1 3300050510 Bacteria 5819
309 nmdc:mga06r32_85527_c1 3300050510 Unclassified 3075
310 nmdc:mga06r32_93876_c1 3300050510 Bacteria 2935
311 nmdc:mga08y16_154274_c1 3300050511 Bacteria 2387
312 nmdc:mga08y16_59587_c1 3300050511 Bacteria 3987
313 nmdc:mga0n895_209918_c1 3300050512 Bacteria 1977
314 nmdc:mga0n895_46104_c1 3300050512 Bacteria 4257
315 nmdc:mga08x19_353115_c1 3300050514 Bacteria 1027
316 nmdc:mga08x19_3893_c1 3300050514 Bacteria 8882
317 nmdc:mga0a205_32962_c1 3300050515 Unclassified 4968
318 Ga0501084_0001230 3300054114 Bacteria 20169
319 Ga0501082_0001571 3300060353 Bacteria 20131
320 Ga0501082_0009592 3300060353 Bacteria 8332
321 Ga0501082_0429294 3300060353 Bacteria 1154
322 2920112908 2920107658 Bacteria 10042636
323 Ga0207428_10089827
324 Ga0070683_100001856
325 Ga0070683_100056728
326 Ga0070670_100032942
327 Ga0068869_100175418
328 Ga0070666_10023361
329 Ga0070666_10090029
330 Ga0070680_100004843
331 Ga0070669_100373195
332 Ga0070675_100000133
333 Ga0070675_100006012
334 Ga0070675_100014483
335 Ga0070675_100254789
336 Ga0070673_100035195
337 Ga0070673_100050512
338 Ga0070688_100076660
339 Ga0070688_100298653
340 Ga0070667_100004270
341 Ga0070703_10111708
342 Ga0070714_100081107
343 Ga0070713_100031368
344 Ga0070708_100280837
345 Ga0070681_10001551
346 Ga0070681_10120591
347 Ga0070681_10350693
348 Ga0070707_100032409
349 Ga0070698_100109795
350 Ga0070698_100199777
351 Ga0070698_100571670
352 Ga0070699_100115734
353 Ga0070699_100350037
354 Ga0070699_100378864
355 Ga0070679_100001406
356 Ga0070679_100052293
357 Ga0070684_100012043
358 Ga0070697_100112822
359 Ga0068853_100033561
360 Ga0070672_100078720
361 Ga0070672_100244828
362 Ga0070686_100019378
363 Ga0070686_100356874
364 Ga0070696_100004516
365 Ga0070665_100041636
366 Ga0070665_100101316
367 Ga0070665_100113695
368 Ga0070704_100004011
369 Ga0068855_100017086
370 Ga0068855_100099048
371 Ga0068855_100183309
372 Ga0070664_100008467
373 Ga0070664_100068315
374 Ga0068857_100000274
375 Ga0068856_100001029
376 Ga0068852_100010033
377 Ga0068859_100001124
378 Ga0068859_100004415
379 Ga0068864_100208615
380 Ga0068863_100001603
381 Ga0068863_100184560
382 Ga0068858_100017209
383 Ga0068858_100083360
384 Ga0068858_100091606
385 Ga0068860_100004397
386 Ga0068860_100286082
387 Ga0070717_10022390
388 Ga0070717_10060841
389 Ga0075363_100121959
390 Ga0070715_10213706
391 Ga0097621_100044298
392 Ga0075370_10186246
393 Ga0068871_100006302
394 Ga0068871_100042695
395 Ga0075428_100050646
396 Ga0075428_100655966
397 Ga0075430_100064547
398 Ga0075430_100124612
399 Ga0075431_100012010
400 Ga0075431_100027524
401 Ga0075431_100060459
402 Ga0075433_10012348
403 Ga0075434_100051905
404 Ga0068865_100102014
405 Ga0075436_100023804
406 Ga0075436_100212271
407 Ga0075436_100261992
408 Ga0097620_100001124
409 Ga0097620_100004415
410 Ga0105240_10008079
411 Ga0105240_10014483
412 Ga0105240_10027707
413 Ga0105240_10035521
414 Ga0105240_10203614
415 Ga0105240_10394895
416 Ga0105240_10407941
417 Ga0111539_10003890
418 Ga0111539_10014800
419 Ga0111539_10081458
420 Ga0105245_10015783
421 Ga0105245_10051346
422 Ga0105245_10051568
423 Ga0114129_10037301
424 Ga0114129_10056845
425 Ga0114129_10230898
426 Ga0114129_10365733
427 Ga0114129_10392420
428 Ga0105243_10040920
429 Ga0105241_10029254
430 Ga0105241_10168672
431 Ga0105241_10201418
432 Ga0105242_10007899
433 Ga0105242_10073657
434 Ga0105248_10000748
435 Ga0105237_10005322
436 Ga0105237_10006646
437 Ga0105238_10110627
438 Ga0105238_10457629
439 Ga0105239_10614112
440 Ga0157370_10021976
441 Ga0157374_10047250
442 Ga0157378_10083352
443 Ga0157378_10466321
444 Ga0163162_10019055
445 Ga0157372_10008144
446 Ga0157375_10001761
447 Ga0157375_10406229
448 Ga0157375_10499395
449 Ga0163163_10001514
450 Ga0163163_10018100
451 Ga0163163_10030972
452 Ga0163163_10506294
453 Ga0157380_10026837
454 Ga0157377_10188039
455 Ga0157379_10000057
456 Ga0157376_10017852
457 Ga0157376_10042996
458 Ga0157376_10062586
459 Ga0157376_10143291
460 Ga0163161_10272366
461 Ga0213873_10008231
462 Ga0213876_10006231
463 Ga0213875_10000006
464 Ga0213875_10015586
465 Ga0207656_10111939
466 Ga0207653_10021165
467 Ga0207680_10030876
468 Ga0207654_10075280
469 Ga0207707_10000705
470 Ga0207707_10014373
471 Ga0207695_10000843
472 Ga0207695_10017337
473 Ga0207695_10045022
474 Ga0207695_10148472
475 Ga0207671_10010637
476 Ga0207671_10024725
477 Ga0207660_10022182
478 Ga0207662_10124715
479 Ga0207657_10075693
480 Ga0207652_10015720
481 Ga0207652_10038844
482 Ga0207646_10004237
483 Ga0207694_10000435
484 Ga0207694_10079174
485 Ga0207650_10072051
486 Ga0207659_10000598
487 Ga0207659_10001418
488 Ga0207659_10006832
489 Ga0207659_10107218
490 Ga0207687_10001669
491 Ga0207687_10027264
492 Ga0207687_10029466
493 Ga0207700_10026480
494 Ga0207664_10082753
495 Ga0207706_10115089
496 Ga0207686_10042865
497 Ga0207665_10208649
498 Ga0207691_10204563
499 Ga0207691_10329958
500 Ga0207711_10000565
501 Ga0207711_10082523
502 Ga0207711_10457631
503 Ga0207689_10070603
504 Ga0207679_10127675
505 Ga0207667_10002003
506 Ga0207667_10179953
507 Ga0207667_10185925
508 Ga0207651_10151967
509 Ga0207651_10180476
510 Ga0207658_10005083
511 Ga0207703_10052009
512 Ga0207703_10584662
513 Ga0207639_10038950
514 Ga0207639_10298510
515 Ga0207702_10001718
516 Ga0207702_10286612
517 Ga0207641_10002771
518 Ga0207641_10077413
519 Ga0207641_10165611
520 Ga0207676_10577813
521 Ga0207674_10000110
522 Ga0209974_10081423
523 Ga0268266_10044062
524 Ga0268264_10259670
525 Ga0265323_10005842
526 Ga0265760_10001642
527 Ga0265330_10068057
528 Ga0265325_10075041
529 Ga0265327_10041466
530 Ga0265316_10001748
531 Ga0265316_10296026
532 Ga0265314_10009420
533 Ga0316576_10007771
534 Ga0307416_100005080
535 Ga0307414_10285398
536 Ga0373934_0000656
537 Ga0373923_0040188
538 Ga0373953_0040135
539 Ga0373954_0007602
540 Ga0373956_0063260
541 Ga0373943_0128010
542 Ga0373955_0001060
543 Ga0316574_0070784
544 Ga0373935_0054435
545 Ga0373927_0005126
546 Ga0373927_0153510
547 Ga0373947_0005044
548 Ga0373937_0010524
549 Ga0373937_0022939
550 Ga0373925_0002380
551 Ga0373925_0298640
552 Ga0316581_0059575
553 Ga0436364_0043838
554 Ga0436364_0104664
555 Ga0436364_0478514
556 Ga0436364_0622498
557 Ga0436364_0673912
558 Ga0436364_0833382
559 Ga0436364_0980627
560 Ga0436364_1302831
561 Ga0436364_1329024
562 Ga0436365_0113537
563 Ga0436365_0475839
564 Ga0436360_0736298
565 Ga0436361_1204679
566 Ga0436362_0210421
567 Ga0436362_0291115
568 Ga0436362_0352079
569 Ga0451577_0008693
570 Ga0451577_0204807
571 Ga0451577_0385385
572 Ga0453684_0004270
573 Ga0453684_0019037
574 Ga0453684_0069148
575 Ga0453684_0482541
576 Ga0495580_0000396
577 Ga0495580_0178779
578 Ga0495582_0109551
579 Ga0495608_0119214
580 Ga0495652_0035313
581 Ga0495665_0050449
582 Ga0495645_0053690
583 Ga0495645_0090157
584 Ga0495645_0123407
585 Ga0495667_0174838
586 Ga0495623_0195003
587 Ga0495613_0047276
588 Ga0495684_0013738
589 Ga0501031_0040111
590 Ga0501032_0001821
591 Ga0501033_0004018
592 Ga0501034_0010156
593 Ga0501034_0014229
594 Ga0501036_0000814
595 Ga0501037_0002216
596 Ga0501037_0304119
597 Ga0501038_0010651
598 Ga0501039_0010076
599 Ga0501040_0178009
600 Ga0501043_0003634
601 Ga0501046_0000783
602 Ga0501047_0017464
603 Ga0501048_0001371
604 Ga0501067_0001195
605 Ga0501068_0005632
606 Ga0501069_0000558
607 Ga0501070_0013650
608 Ga0501072_0001726
609 Ga0501073_0000325
610 Ga0501074_0011823
611 Ga0501075_0061601
612 Ga0501075_0084774
613 Ga0501076_0051197
614 Ga0501076_0348456
615 Ga0501077_0014523
616 Ga0501079_0005683
617 Ga0501080_0000021
618 Ga0501081_0024507
619 Ga0501083_0004214
620 Ga0501035_0006187
621 Ga0501044_0041805
622 Ga0501044_0175228
623 nmdc:mga07m45_62497_c2
624 nmdc:mga05p37_115477_c1
625 nmdc:mga05p37_380059_c1
626 nmdc:mga05p37_46517_c1
627 nmdc:mga05p37_693150_c1
628 nmdc:mga0qj67_122024_c1
629 nmdc:mga0qj67_299078_c1
630 nmdc:mga06r32_22573_c1
631 nmdc:mga06r32_85527_c1
632 nmdc:mga06r32_93876_c1
633 nmdc:mga08y16_154274_c1
634 nmdc:mga08y16_59587_c1
635 nmdc:mga0n895_209918_c1
636 nmdc:mga0n895_46104_c1
637 nmdc:mga08x19_353115_c1
638 nmdc:mga08x19_3893_c1
639 nmdc:mga0a205_32962_c1
640 Ga0501084_0001230
641 Ga0501082_0001571
642 Ga0501082_0009592
643 Ga0501082_0429294
644 2920112908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

60

308

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8933 1 275
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8841 1 275
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7277 7 276
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7163 6 279
4tq6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7048 7 276
ID Description Score Start End Superfamily
af_Q54U71_333_454_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9335 161 278 1.20.120.1780
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9269 158 275 1.20.120.1780
af_Q66JT7_234_356_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9248 161 275 1.20.120.1780
af_Q8I7J4_224_349_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9218 157 278 1.20.120.1780
af_C6KSS3_222_381_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9153 9 145 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A2V9ZRD5-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9977 65 279 GO:0005886
GO:0006744
GO:0016765
AF-A0A7C6E2C4-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9962 114 275 GO:0005886
GO:0006744
GO:0016765
AF-A0A7W1YCD7-F1-model_v4 UbiA family prenyltransferase 0.995 49 278 GO:0005886
GO:0006744
GO:0016765
AF-A0A2V9ZRD5-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9931 65 279 GO:0005886
GO:0006744
GO:0016765
AF-A0A7X3VGT4-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9917 3 279 GO:0005886
GO:0006744
GO:0016765

Map