F406455

General Info

Members Datasets Scaffolds Average Seq Length
322 173 644 348

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10109873|Ga0157380_101098733
Length 379
Sequence LPTSINQQSAIENQQWHRDKFSHRPMTVQTVLVCEAQVPFVHGGAEVHVRQLVRELRARGYTTELVSVPFKWYPKEEILPHAAAWRLLDLSESNGRAVDLVIGTKFPSYFARHPKKVAWLIHQYRAAYELCGTEYSDFAHTELDVGLRDTLMRLDTTMLGECRAVFTNARNTAARLARFNGLAAEPLYHPPKLASRLVPGPYTNYVLSVGRIESVKRVDLIIAAMADVPPEVRLMIAGDGTQRLNAERAAEEAGVADRVTFLGTVEDDDLIALYAGALAVVYPPYDEDFGYVTLEAFLARKPVITCTDSGGPNEFVIDGVNGFVSAPESGELAAAINRLAADRARTAAMGDAGHDTASAITWDGVIEKLTTLPEPRKLP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 4.97
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10109873 3300014326 Bacteria 2314
2 Ga0065712_10082668 3300005290 Bacteria 2896
3 Ga0065712_10087850 3300005290 Bacteria 2551
4 Ga0065712_10108457 3300005290 Bacteria 1874
5 Ga0065712_10136877 3300005290 Bacteria 1485
6 Ga0065715_10010082 3300005293 Bacteria 3685
7 Ga0065715_10097041 3300005293 Bacteria 3773
8 Ga0065715_10114847 3300005293 Bacteria 2436
9 Ga0065707_10000751 3300005295 Bacteria 16640
10 Ga0065707_10117721 3300005295 Bacteria 2205
11 Ga0065707_10180556 3300005295 Bacteria 1421
12 Ga0070676_10093872 3300005328 Bacteria 1843
13 Ga0070683_100011290 3300005329 Bacteria 7712
14 Ga0070683_100036513 3300005329 Bacteria 4497
15 Ga0070670_100001909 3300005331 Bacteria 17062
16 Ga0070670_100022132 3300005331 Bacteria 5471
17 Ga0070680_100238452 3300005336 Unclassified 1537
18 Ga0070680_100273531 3300005336 Unclassified 1430
19 Ga0070661_100163906 3300005344 Unclassified 1685
20 Ga0070668_100546315 3300005347 Bacteria 1008
21 Ga0070669_100006661 3300005353 Bacteria 8316
22 Ga0070675_100131233 3300005354 Bacteria 2135
23 Ga0070671_100358244 3300005355 Bacteria 1245
24 Ga0070674_100003342 3300005356 Bacteria 8981
25 Ga0070667_100128125 3300005367 Bacteria 2213
26 Ga0070667_100203738 3300005367 Bacteria 1756
27 Ga0070713_100032582 3300005436 Bacteria 4164
28 Ga0070701_10129101 3300005438 Unclassified 1434
29 Ga0070700_100218445 3300005441 Bacteria 1349
30 Ga0070708_100084710 3300005445 Unclassified 2875
31 Ga0070678_100441076 3300005456 Bacteria 1139
32 Ga0070681_10164742 3300005458 Bacteria 2140
33 Ga0070698_100533167 3300005471 Unclassified 1113
34 Ga0070699_100004383 3300005518 Bacteria 12471
35 Ga0070699_100008307 3300005518 Bacteria 9003
36 Ga0070699_100071834 3300005518 Bacteria 3010
37 Ga0070679_100176146 3300005530 Bacteria 2111
38 Ga0070684_100000477 3300005535 Bacteria 27392
39 Ga0070684_100043012 3300005535 Bacteria 3901
40 Ga0070672_100237671 3300005543 Bacteria 1532
41 Ga0070696_100211695 3300005546 Bacteria 1451
42 Ga0070665_100090039 3300005548 Bacteria 3074
43 Ga0070704_100083614 3300005549 Bacteria 2357
44 Ga0070664_100009326 3300005564 Bacteria 7961
45 Ga0070664_100029357 3300005564 Bacteria 4585
46 Ga0070664_100030942 3300005564 Bacteria 4468
47 Ga0070664_100195685 3300005564 Bacteria 1802
48 Ga0068857_100010376 3300005577 Bacteria 8095
49 Ga0068859_100000002 3300005617 Bacteria 541370
50 Ga0068859_100007477 3300005617 Bacteria 11091
51 Ga0068864_100017239 3300005618 Bacteria 6022
52 Ga0068861_100128007 3300005719 Bacteria 2058
53 Ga0068858_100021737 3300005842 Bacteria 5994
54 Ga0068862_100192520 3300005844 Bacteria 1836
55 Ga0075365_10009839 3300006038 Bacteria 5531
56 Ga0075368_10007277 3300006042 Bacteria 3903
57 Ga0075364_10012556 3300006051 Bacteria 5187
58 Ga0075364_10085558 3300006051 Bacteria 2088
59 Ga0075362_10005950 3300006177 Bacteria 4509
60 Ga0075367_10023911 3300006178 Bacteria 3443
61 Ga0075367_10057822 3300006178 Bacteria 2306
62 Ga0075366_10008258 3300006195 Bacteria 5780
63 Ga0075366_10036357 3300006195 Bacteria 2903
64 Ga0075366_10048795 3300006195 Bacteria 2511
65 Ga0068871_100104158 3300006358 Bacteria 2380
66 Ga0075428_100010597 3300006844 Bacteria 10245
67 Ga0075428_100153328 3300006844 Unclassified 2503
68 Ga0075428_100262611 3300006844 Bacteria 1859
69 Ga0075430_100004199 3300006846 Bacteria 12151
70 Ga0075430_100005653 3300006846 Bacteria 10560
71 Ga0075430_100040543 3300006846 Bacteria 3942
72 Ga0075431_100003567 3300006847 Bacteria 15070
73 Ga0075431_100007134 3300006847 Bacteria 11102
74 Ga0075431_100032226 3300006847 Bacteria 5400
75 Ga0075431_100048362 3300006847 Bacteria 4387
76 Ga0075431_100051746 3300006847 Bacteria 4235
77 Ga0075431_100101116 3300006847 Bacteria 2975
78 Ga0075431_100233287 3300006847 Bacteria 1874
79 Ga0075433_10006822 3300006852 Bacteria 9050
80 Ga0075433_10020657 3300006852 Bacteria 5511
81 Ga0075433_10117994 3300006852 Bacteria 2355
82 Ga0075433_10139591 3300006852 Bacteria 2154
83 Ga0075433_10350024 3300006852 Unclassified 1306
84 Ga0075434_100000731 3300006871 Bacteria 25794
85 Ga0075434_100115766 3300006871 Bacteria 2694
86 Ga0075434_100286596 3300006871 Bacteria 1667
87 Ga0075429_100028618 3300006880 Bacteria 4838
88 Ga0068865_100082055 3300006881 Bacteria 2317
89 Ga0068865_100286273 3300006881 Unclassified 1314
90 Ga0075436_100058963 3300006914 Bacteria 2651
91 Ga0097620_100000002 3300006931 Bacteria 541370
92 Ga0097620_100007478 3300006931 Bacteria 11091
93 Ga0075435_100045703 3300007076 Bacteria 3511
94 Ga0075435_100101132 3300007076 Bacteria 2388
95 Ga0105240_10093777 3300009093 Bacteria 3663
96 Ga0111539_10000010 3300009094 Bacteria 366246
97 Ga0111539_10007299 3300009094 Bacteria 14152
98 Ga0111539_10015911 3300009094 Bacteria 9342
99 Ga0111539_10035499 3300009094 Bacteria 6036
100 Ga0111539_10134530 3300009094 Bacteria 2895
101 Ga0111539_10139906 3300009094 Bacteria 2834
102 Ga0105247_10009155 3300009101 Bacteria 6027
103 Ga0105247_10033099 3300009101 Bacteria 3143
104 Ga0114129_10000047 3300009147 Bacteria 104957
105 Ga0114129_10000408 3300009147 Bacteria 50625
106 Ga0114129_10004725 3300009147 Bacteria 19236
107 Ga0114129_10006465 3300009147 Bacteria 16620
108 Ga0114129_10011453 3300009147 Bacteria 12629
109 Ga0114129_10093688 3300009147 Bacteria 4161
110 Ga0105241_10109072 3300009174 Unclassified 2213
111 Ga0105248_10000664 3300009177 Bacteria 39095
112 Ga0105248_10076990 3300009177 Bacteria 3749
113 Ga0105248_10085756 3300009177 Bacteria 3543
114 Ga0105248_10317944 3300009177 Bacteria 1753
115 Ga0105249_10000566 3300009553 Bacteria 33999
116 Ga0105249_10032293 3300009553 Bacteria 4736
117 Ga0105249_10081212 3300009553 Bacteria 3013
118 Ga0163163_10000071 3300014325 Bacteria 112778
119 Ga0163163_10068131 3300014325 Bacteria 3540
120 Ga0163163_10180045 3300014325 Unclassified 2161
121 Ga0157380_10024821 3300014326 Bacteria 4541
122 Ga0157380_10187778 3300014326 Bacteria 1822
123 Ga0157379_10125289 3300014968 Bacteria 2312
124 Ga0207697_10039060 3300025315 Unclassified 1947
125 Ga0207710_10015384 3300025900 Bacteria 3232
126 Ga0207688_10018575 3300025901 Unclassified 3782
127 Ga0207680_10209059 3300025903 Bacteria 1333
128 Ga0207695_10163412 3300025913 Bacteria 2156
129 Ga0207663_10072303 3300025916 Bacteria 2229
130 Ga0207660_10127651 3300025917 Bacteria 1933
131 Ga0207650_10003088 3300025925 Bacteria 11467
132 Ga0207700_10038708 3300025928 Bacteria 3463
133 Ga0207706_10073135 3300025933 Bacteria 3014
134 Ga0207706_10161742 3300025933 Unclassified 1968
135 Ga0207670_10026906 3300025936 Bacteria 3631
136 Ga0207670_10141404 3300025936 Bacteria 1775
137 Ga0207704_10102783 3300025938 Bacteria 1910
138 Ga0207665_10032679 3300025939 Bacteria 3446
139 Ga0207691_10088307 3300025940 Bacteria 2780
140 Ga0207711_10033049 3300025941 Bacteria 4376
141 Ga0207661_10028352 3300025944 Bacteria 4287
142 Ga0207679_10011795 3300025945 Bacteria 5677
143 Ga0207679_10074596 3300025945 Bacteria 2571
144 Ga0207712_10175704 3300025961 Unclassified 1678
145 Ga0207703_10024671 3300026035 Bacteria 4731
146 Ga0207678_10257328 3300026067 Bacteria 1496
147 Ga0207648_10064383 3300026089 Bacteria 3196
148 Ga0207676_10014449 3300026095 Bacteria 5681
149 Ga0207674_10016297 3300026116 Bacteria 8140
150 Ga0207675_100016870 3300026118 Bacteria 6822
151 Ga0207675_100359356 3300026118 Bacteria 1428
152 Ga0209813_10007789 3300027866 Bacteria 2680
153 Ga0207428_10000034 3300027907 Bacteria 231306
154 Ga0207428_10046740 3300027907 Unclassified 3479
155 Ga0307408_100220150 3300031548 Bacteria 1548
156 Ga0307413_10031731 3300031824 Bacteria 2985
157 Ga0307407_10013590 3300031903 Bacteria 3957
158 Ga0307407_10023113 3300031903 Bacteria 3239
159 Ga0307416_100027270 3300032002 Bacteria 4226
160 Ga0307416_100064457 3300032002 Bacteria 3006
161 Ga0307411_10023534 3300032005 Unclassified 3651
162 Ga0307415_100027674 3300032126 Bacteria 3595
163 Ga0307415_100052672 3300032126 Bacteria 2769
164 Ga0373925_0001772 3300037068 Bacteria 18014
165 Ga0373925_0168561 3300037068 Bacteria 1728
166 Ga0436364_0043205 3300037853 Bacteria 2028
167 Ga0439461_0013514 3300041410 Bacteria 1542
168 Ga0450896_003485 3300042133 Bacteria 2093
169 Ga0439435_0019307 3300042436 Unclassified 1745
170 Ga0439435_0033050 3300042436 Bacteria 1414
171 Ga0439435_0039300 3300042436 Bacteria 1318
172 Ga0439464_0015971 3300042439 Bacteria 2029
173 Ga0451577_0003629 3300042876 Bacteria 16952
174 Ga0451577_0299464 3300042876 Unclassified 1457
175 Ga0453684_0000414 3300044712 Bacteria 174278
176 Ga0453684_0042005 3300044712 Bacteria 6171
177 Ga0453684_0094127 3300044712 Bacteria 3687
178 Ga0451576_0054611 3300045051 Bacteria 4182
179 Ga0495603_0131206 3300046455 Bacteria 1459
180 Ga0495608_0074066 3300046511 Bacteria 2220
181 Ga0495635_0024299 3300046663 Bacteria 4225
182 Ga0495658_0004399 3300046683 Bacteria 6939
183 Ga0495669_0100897 3300046684 Unclassified 1340
184 Ga0495674_0055434 3300047319 Bacteria 3477
185 Ga0496102_0006525 3300048905 Bacteria 9954
186 Ga0496104_0013818 3300048907 Bacteria 7283
187 Ga0496104_0174692 3300048907 Bacteria 2059
188 Ga0496105_0053421 3300048908 Bacteria 3336
189 Ga0496106_0290330 3300048909 Bacteria 1311
190 Ga0496106_0390532 3300048909 Bacteria 1118
191 Ga0496108_0006264 3300048911 Bacteria 9640
192 Ga0496109_0001850 3300048912 Bacteria 17524
193 Ga0496110_0000816 3300048913 Bacteria 21833
194 Ga0496111_0001209 3300048914 Bacteria 14420
195 Ga0496112_0003409 3300048915 Bacteria 13132
196 Ga0496112_0023882 3300048915 Bacteria 5849
197 Ga0496112_0237955 3300048915 Unclassified 1774
198 Ga0496112_0454420 3300048915 Unclassified 1218
199 Ga0496113_0007690 3300048916 Bacteria 6955
200 Ga0496113_0264923 3300048916 Bacteria 1373
201 Ga0501032_0046976 3300049569 Bacteria 2916
202 Ga0501034_0000989 3300049571 Bacteria 40796
203 Ga0501034_0075741 3300049571 Bacteria 3371
204 Ga0501036_0017503 3300049572 Bacteria 5993
205 Ga0501036_0106595 3300049572 Bacteria 2370
206 Ga0501036_0126945 3300049572 Unclassified 2154
207 Ga0501036_0216091 3300049572 Bacteria 1610
208 Ga0501037_0033451 3300049573 Bacteria 3796
209 Ga0501038_0004904 3300049574 Bacteria 12430
210 Ga0501038_0022381 3300049574 Bacteria 5665
211 Ga0501039_0036589 3300049575 Bacteria 3788
212 Ga0501039_0040531 3300049575 Bacteria 3595
213 Ga0501039_0074676 3300049575 Bacteria 2635
214 Ga0501039_0099939 3300049575 Bacteria 2264
215 Ga0501040_0026550 3300049576 Bacteria 3896
216 Ga0501041_0054887 3300049577 Bacteria 2431
217 Ga0501042_0005337 3300049578 Bacteria 8260
218 Ga0501042_0011995 3300049578 Bacteria 5859
219 Ga0501043_0287363 3300049579 Bacteria 1259
220 Ga0501046_0004223 3300049580 Bacteria 13073
221 Ga0501046_0016794 3300049580 Bacteria 6119
222 Ga0501046_0058336 3300049580 Bacteria 3026
223 Ga0501046_0061032 3300049580 Unclassified 2950
224 Ga0501047_0001605 3300049581 Bacteria 22037
225 Ga0501047_0062222 3300049581 Bacteria 3600
226 Ga0501048_0044968 3300049582 Bacteria 3155
227 Ga0501048_0111318 3300049582 Bacteria 1933
228 Ga0501048_0323851 3300049582 Bacteria 1098
229 Ga0501067_0038400 3300049583 Bacteria 2658
230 Ga0501068_0008802 3300049584 Bacteria 5630
231 Ga0501068_0065911 3300049584 Bacteria 2205
232 Ga0501069_0040049 3300049585 Bacteria 2589
233 Ga0501069_0072429 3300049585 Bacteria 1932
234 Ga0501071_0097893 3300049587 Bacteria 2160
235 Ga0501071_0161884 3300049587 Bacteria 1673
236 Ga0501072_0010302 3300049588 Bacteria 7124
237 Ga0501072_0070963 3300049588 Unclassified 2752
238 Ga0501072_0121111 3300049588 Bacteria 2084
239 Ga0501073_0028578 3300049589 Bacteria 3984
240 Ga0501073_0076282 3300049589 Bacteria 2332
241 Ga0501074_0114464 3300049590 Bacteria 1930
242 Ga0501075_0053199 3300049591 Bacteria 3045
243 Ga0501075_0175632 3300049591 Bacteria 1635
244 Ga0501076_0005286 3300049592 Bacteria 9258
245 Ga0501076_0028319 3300049592 Bacteria 4349
246 Ga0501076_0056194 3300049592 Bacteria 3123
247 Ga0501076_0102866 3300049592 Unclassified 2303
248 Ga0501077_0049271 3300049593 Bacteria 2677
249 Ga0501079_0026155 3300049741 Bacteria 4475
250 Ga0501079_0068651 3300049741 Bacteria 2736
251 Ga0501079_0088549 3300049741 Bacteria 2397
252 Ga0501080_0005942 3300049742 Bacteria 10938
253 Ga0501080_0087935 3300049742 Bacteria 2886
254 Ga0501080_0108186 3300049742 Bacteria 2577
255 Ga0501080_0221229 3300049742 Bacteria 1732
256 Ga0501081_0052250 3300049743 Unclassified 2819
257 Ga0501081_0271597 3300049743 Bacteria 1240
258 Ga0501083_0114920 3300049744 Bacteria 1767
259 Ga0501035_0043356 3300049822 Bacteria 4054
260 Ga0501035_0058625 3300049822 Bacteria 3430
261 Ga0501044_0109353 3300049823 Bacteria 2773
262 Ga0501045_0031718 3300049824 Bacteria 3827
263 Ga0501045_0095603 3300049824 Bacteria 2198
264 nmdc:mga00v17_14970_c1 3300050491 Bacteria 4344
265 nmdc:mga00v17_46901_c1 3300050491 Bacteria 2616
266 nmdc:mga0yw44_1474_c1 3300050492 Bacteria 9375
267 nmdc:mga0k408_13535_c1 3300050493 Bacteria 4477
268 nmdc:mga0k408_222874_c1 3300050493 Bacteria 1126
269 nmdc:mga06z11_3024_c1 3300050494 Bacteria 6472
270 nmdc:mga06z11_36597_c1 3300050494 Bacteria 2424
271 nmdc:mga05p37_130943_c1 3300050507 Unclassified 3078
272 nmdc:mga05p37_16784_c1 3300050507 Bacteria 8827
273 nmdc:mga05p37_180_c1 3300050507 Bacteria 61836
274 nmdc:mga05p37_19709_c1 3300050507 Bacteria 8160
275 nmdc:mga05p37_24022_c1 3300050507 Bacteria 7404
276 nmdc:mga05p37_46062_c1 3300050507 Bacteria 5363
277 nmdc:mga05p37_625_c1 3300050507 Bacteria 19207
278 nmdc:mga05p37_75083_c1 3300050507 Bacteria 4161
279 nmdc:mga09592_120073_c1 3300050508 Unclassified 2257
280 nmdc:mga09592_173421_c1 3300050508 Unclassified 1865
281 nmdc:mga09592_48357_c1 3300050508 Bacteria 3585
282 nmdc:mga0qj67_15375_c1 3300050509 Bacteria 5795
283 nmdc:mga0qj67_69728_c1 3300050509 Bacteria 2804
284 nmdc:mga06r32_10344_c1 3300050510 Bacteria 8414
285 nmdc:mga06r32_120140_c1 3300050510 Bacteria 2591
286 nmdc:mga06r32_47060_c1 3300050510 Bacteria 4119
287 nmdc:mga06r32_88533_c1 3300050510 Bacteria 3022
288 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
289 nmdc:mga08y16_139201_c1 3300050511 Bacteria 2523
290 nmdc:mga08y16_2484_c1 3300050511 Bacteria 18944
291 nmdc:mga08y16_25449_c1 3300050511 Bacteria 6241
292 nmdc:mga08y16_52384_c1 3300050511 Bacteria 4270
293 nmdc:mga0n895_152077_c1 3300050512 Bacteria 2345
294 nmdc:mga0n895_409031_c1 3300050512 Bacteria 1372
295 nmdc:mga0n895_73896_c1 3300050512 Bacteria 3385
296 nmdc:mga0rr50_41349_c1 3300050513 Bacteria 3358
297 nmdc:mga0rr50_93444_c1 3300050513 Bacteria 2347
298 nmdc:mga08x19_70808_c1 3300050514 Bacteria 2273
299 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
300 nmdc:mga0a205_10903_c1 3300050515 Bacteria 8361
301 nmdc:mga0a205_249726_c1 3300050515 Bacteria 1654
302 nmdc:mga0a205_31209_c1 3300050515 Bacteria 5104
303 nmdc:mga0a205_59516_c2 3300050515 Unclassified 2048
304 nmdc:mga0a205_84111_c1 3300050515 Bacteria 3073
305 Ga0500651_0064351 3300053093 Bacteria 2287
306 Ga0500555_000244 3300053103 Bacteria 24230
307 Ga0500568_0008892 3300053139 Bacteria 4804
308 Ga0500616_0003547 3300053153 Bacteria 11823
309 Ga0501084_0007619 3300054114 Bacteria 8926
310 Ga0501084_0048263 3300054114 Bacteria 3564
311 Ga0501084_0131921 3300054114 Unclassified 2103
312 Ga0590071_000759 3300059421 Bacteria 9033
313 Ga0590074_000969 3300059423 Bacteria 4505
314 Ga0590074_001011 3300059423 Bacteria 4420
315 Ga0590075_002158 3300059424 Bacteria 4732
316 Ga0590077_000392 3300059426 Bacteria 12330
317 Ga0590077_000652 3300059426 Bacteria 9244
318 Ga0501082_0006545 3300060353 Bacteria 10095
319 Ga0501082_0053099 3300060353 Bacteria 3493
320 Ga0501082_0067638 3300060353 Bacteria 3077
321 Ga0530510_0003827 3300061734 Bacteria 10379
322 Ga0530510_0096975 3300061734 Bacteria 2155
323 Ga0157380_10109873
324 Ga0065712_10082668
325 Ga0065712_10087850
326 Ga0065712_10108457
327 Ga0065712_10136877
328 Ga0065715_10010082
329 Ga0065715_10097041
330 Ga0065715_10114847
331 Ga0065707_10000751
332 Ga0065707_10117721
333 Ga0065707_10180556
334 Ga0070676_10093872
335 Ga0070683_100011290
336 Ga0070683_100036513
337 Ga0070670_100001909
338 Ga0070670_100022132
339 Ga0070680_100238452
340 Ga0070680_100273531
341 Ga0070661_100163906
342 Ga0070668_100546315
343 Ga0070669_100006661
344 Ga0070675_100131233
345 Ga0070671_100358244
346 Ga0070674_100003342
347 Ga0070667_100128125
348 Ga0070667_100203738
349 Ga0070713_100032582
350 Ga0070701_10129101
351 Ga0070700_100218445
352 Ga0070708_100084710
353 Ga0070678_100441076
354 Ga0070681_10164742
355 Ga0070698_100533167
356 Ga0070699_100004383
357 Ga0070699_100008307
358 Ga0070699_100071834
359 Ga0070679_100176146
360 Ga0070684_100000477
361 Ga0070684_100043012
362 Ga0070672_100237671
363 Ga0070696_100211695
364 Ga0070665_100090039
365 Ga0070704_100083614
366 Ga0070664_100009326
367 Ga0070664_100029357
368 Ga0070664_100030942
369 Ga0070664_100195685
370 Ga0068857_100010376
371 Ga0068859_100000002
372 Ga0068859_100007477
373 Ga0068864_100017239
374 Ga0068861_100128007
375 Ga0068858_100021737
376 Ga0068862_100192520
377 Ga0075365_10009839
378 Ga0075368_10007277
379 Ga0075364_10012556
380 Ga0075364_10085558
381 Ga0075362_10005950
382 Ga0075367_10023911
383 Ga0075367_10057822
384 Ga0075366_10008258
385 Ga0075366_10036357
386 Ga0075366_10048795
387 Ga0068871_100104158
388 Ga0075428_100010597
389 Ga0075428_100153328
390 Ga0075428_100262611
391 Ga0075430_100004199
392 Ga0075430_100005653
393 Ga0075430_100040543
394 Ga0075431_100003567
395 Ga0075431_100007134
396 Ga0075431_100032226
397 Ga0075431_100048362
398 Ga0075431_100051746
399 Ga0075431_100101116
400 Ga0075431_100233287
401 Ga0075433_10006822
402 Ga0075433_10020657
403 Ga0075433_10117994
404 Ga0075433_10139591
405 Ga0075433_10350024
406 Ga0075434_100000731
407 Ga0075434_100115766
408 Ga0075434_100286596
409 Ga0075429_100028618
410 Ga0068865_100082055
411 Ga0068865_100286273
412 Ga0075436_100058963
413 Ga0097620_100000002
414 Ga0097620_100007478
415 Ga0075435_100045703
416 Ga0075435_100101132
417 Ga0105240_10093777
418 Ga0111539_10000010
419 Ga0111539_10007299
420 Ga0111539_10015911
421 Ga0111539_10035499
422 Ga0111539_10134530
423 Ga0111539_10139906
424 Ga0105247_10009155
425 Ga0105247_10033099
426 Ga0114129_10000047
427 Ga0114129_10000408
428 Ga0114129_10004725
429 Ga0114129_10006465
430 Ga0114129_10011453
431 Ga0114129_10093688
432 Ga0105241_10109072
433 Ga0105248_10000664
434 Ga0105248_10076990
435 Ga0105248_10085756
436 Ga0105248_10317944
437 Ga0105249_10000566
438 Ga0105249_10032293
439 Ga0105249_10081212
440 Ga0163163_10000071
441 Ga0163163_10068131
442 Ga0163163_10180045
443 Ga0157380_10024821
444 Ga0157380_10187778
445 Ga0157379_10125289
446 Ga0207697_10039060
447 Ga0207710_10015384
448 Ga0207688_10018575
449 Ga0207680_10209059
450 Ga0207695_10163412
451 Ga0207663_10072303
452 Ga0207660_10127651
453 Ga0207650_10003088
454 Ga0207700_10038708
455 Ga0207706_10073135
456 Ga0207706_10161742
457 Ga0207670_10026906
458 Ga0207670_10141404
459 Ga0207704_10102783
460 Ga0207665_10032679
461 Ga0207691_10088307
462 Ga0207711_10033049
463 Ga0207661_10028352
464 Ga0207679_10011795
465 Ga0207679_10074596
466 Ga0207712_10175704
467 Ga0207703_10024671
468 Ga0207678_10257328
469 Ga0207648_10064383
470 Ga0207676_10014449
471 Ga0207674_10016297
472 Ga0207675_100016870
473 Ga0207675_100359356
474 Ga0209813_10007789
475 Ga0207428_10000034
476 Ga0207428_10046740
477 Ga0307408_100220150
478 Ga0307413_10031731
479 Ga0307407_10013590
480 Ga0307407_10023113
481 Ga0307416_100027270
482 Ga0307416_100064457
483 Ga0307411_10023534
484 Ga0307415_100027674
485 Ga0307415_100052672
486 Ga0373925_0001772
487 Ga0373925_0168561
488 Ga0436364_0043205
489 Ga0439461_0013514
490 Ga0450896_003485
491 Ga0439435_0019307
492 Ga0439435_0033050
493 Ga0439435_0039300
494 Ga0439464_0015971
495 Ga0451577_0003629
496 Ga0451577_0299464
497 Ga0453684_0000414
498 Ga0453684_0042005
499 Ga0453684_0094127
500 Ga0451576_0054611
501 Ga0495603_0131206
502 Ga0495608_0074066
503 Ga0495635_0024299
504 Ga0495658_0004399
505 Ga0495669_0100897
506 Ga0495674_0055434
507 Ga0496102_0006525
508 Ga0496104_0013818
509 Ga0496104_0174692
510 Ga0496105_0053421
511 Ga0496106_0290330
512 Ga0496106_0390532
513 Ga0496108_0006264
514 Ga0496109_0001850
515 Ga0496110_0000816
516 Ga0496111_0001209
517 Ga0496112_0003409
518 Ga0496112_0023882
519 Ga0496112_0237955
520 Ga0496112_0454420
521 Ga0496113_0007690
522 Ga0496113_0264923
523 Ga0501032_0046976
524 Ga0501034_0000989
525 Ga0501034_0075741
526 Ga0501036_0017503
527 Ga0501036_0106595
528 Ga0501036_0126945
529 Ga0501036_0216091
530 Ga0501037_0033451
531 Ga0501038_0004904
532 Ga0501038_0022381
533 Ga0501039_0036589
534 Ga0501039_0040531
535 Ga0501039_0074676
536 Ga0501039_0099939
537 Ga0501040_0026550
538 Ga0501041_0054887
539 Ga0501042_0005337
540 Ga0501042_0011995
541 Ga0501043_0287363
542 Ga0501046_0004223
543 Ga0501046_0016794
544 Ga0501046_0058336
545 Ga0501046_0061032
546 Ga0501047_0001605
547 Ga0501047_0062222
548 Ga0501048_0044968
549 Ga0501048_0111318
550 Ga0501048_0323851
551 Ga0501067_0038400
552 Ga0501068_0008802
553 Ga0501068_0065911
554 Ga0501069_0040049
555 Ga0501069_0072429
556 Ga0501071_0097893
557 Ga0501071_0161884
558 Ga0501072_0010302
559 Ga0501072_0070963
560 Ga0501072_0121111
561 Ga0501073_0028578
562 Ga0501073_0076282
563 Ga0501074_0114464
564 Ga0501075_0053199
565 Ga0501075_0175632
566 Ga0501076_0005286
567 Ga0501076_0028319
568 Ga0501076_0056194
569 Ga0501076_0102866
570 Ga0501077_0049271
571 Ga0501079_0026155
572 Ga0501079_0068651
573 Ga0501079_0088549
574 Ga0501080_0005942
575 Ga0501080_0087935
576 Ga0501080_0108186
577 Ga0501080_0221229
578 Ga0501081_0052250
579 Ga0501081_0271597
580 Ga0501083_0114920
581 Ga0501035_0043356
582 Ga0501035_0058625
583 Ga0501044_0109353
584 Ga0501045_0031718
585 Ga0501045_0095603
586 nmdc:mga00v17_14970_c1
587 nmdc:mga00v17_46901_c1
588 nmdc:mga0yw44_1474_c1
589 nmdc:mga0k408_13535_c1
590 nmdc:mga0k408_222874_c1
591 nmdc:mga06z11_3024_c1
592 nmdc:mga06z11_36597_c1
593 nmdc:mga05p37_130943_c1
594 nmdc:mga05p37_16784_c1
595 nmdc:mga05p37_180_c1
596 nmdc:mga05p37_19709_c1
597 nmdc:mga05p37_24022_c1
598 nmdc:mga05p37_46062_c1
599 nmdc:mga05p37_625_c1
600 nmdc:mga05p37_75083_c1
601 nmdc:mga09592_120073_c1
602 nmdc:mga09592_173421_c1
603 nmdc:mga09592_48357_c1
604 nmdc:mga0qj67_15375_c1
605 nmdc:mga0qj67_69728_c1
606 nmdc:mga06r32_10344_c1
607 nmdc:mga06r32_120140_c1
608 nmdc:mga06r32_47060_c1
609 nmdc:mga06r32_88533_c1
610 nmdc:mga08y16_10_c1
611 nmdc:mga08y16_139201_c1
612 nmdc:mga08y16_2484_c1
613 nmdc:mga08y16_25449_c1
614 nmdc:mga08y16_52384_c1
615 nmdc:mga0n895_152077_c1
616 nmdc:mga0n895_409031_c1
617 nmdc:mga0n895_73896_c1
618 nmdc:mga0rr50_41349_c1
619 nmdc:mga0rr50_93444_c1
620 nmdc:mga08x19_70808_c1
621 nmdc:mga08x19_9112_c1
622 nmdc:mga0a205_10903_c1
623 nmdc:mga0a205_249726_c1
624 nmdc:mga0a205_31209_c1
625 nmdc:mga0a205_59516_c2
626 nmdc:mga0a205_84111_c1
627 Ga0500651_0064351
628 Ga0500555_000244
629 Ga0500568_0008892
630 Ga0500616_0003547
631 Ga0501084_0007619
632 Ga0501084_0048263
633 Ga0501084_0131921
634 Ga0590071_000759
635 Ga0590074_000969
636 Ga0590074_001011
637 Ga0590075_002158
638 Ga0590077_000392
639 Ga0590077_000652
640 Ga0501082_0006545
641 Ga0501082_0053099
642 Ga0501082_0067638
643 Ga0530510_0003827
644 Ga0530510_0096975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

196

356

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

203

342

0.91

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

163

369

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8606 178 332
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8594 167 332
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8481 177 334
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8406 167 332
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8395 178 332
ID Description Score Start End Superfamily
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9494 176 331 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.948 176 328 3.40.50.2000
af_F4IBV4_205_380_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9356 174 332 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9278 180 332 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9257 177 332 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9851 169 319 GO:0016757
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9739 119 344 GO:0016758
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9654 119 344 GO:0016758
AF-A0A538LKC2-F1-model_v4 Glycosyltransferase 0.9577 188 343 GO:0016757
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9478 169 319 GO:0016757

Map