F406337

General Info

Members Datasets Scaffolds Average Seq Length
322 217 644 204

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10158366|Ga0070685_101583661
Length 203
Sequence MTLEIYLAYVLACVVITIVPGPTVTVIVANSLTHGTRAGLLNVAGTQIGLGLMMATLVVGLSTIIATMGWWFDWLRLAGAAYLIWLGWKLIRSSGDVAAVKAPVPRGGFVLQGLLVILSNPKGLLWFGAFIPQFIDPKGDYVGQIILLGITAMATALISDGAYAILVGRAGSALSRHRVRLVNRVGGVFLIGGGIWLALTRAR

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
212 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.25
Nodule 0
Rhizoplane 2.17
Rhizosphere 76.71
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10158366 3300005466 Bacteria 1441
2 JGI25406J46586_10012432 3300003203 Bacteria 3693
3 JGI25153J46596_10001926 3300003215 Bacteria 12324
4 JGI25153J46596_10005523 3300003215 Bacteria 6615
5 Ga0065715_10195425 3300005293 Bacteria 1390
6 Ga0070683_100158594 3300005329 Bacteria 2146
7 Ga0070690_100011512 3300005330 Bacteria 5175
8 Ga0070670_100624141 3300005331 Bacteria 966
9 Ga0070677_10008423 3300005333 Bacteria 3469
10 Ga0070677_10313563 3300005333 Bacteria 801
11 Ga0068869_100609866 3300005334 Bacteria 923
12 Ga0070680_100024456 3300005336 Bacteria 4825
13 Ga0070689_100024483 3300005340 Bacteria 4529
14 Ga0070689_100643342 3300005340 Bacteria 922
15 Ga0070687_100019224 3300005343 Bacteria 3174
16 Ga0070687_100267067 3300005343 Bacteria 1071
17 Ga0070661_100095069 3300005344 Bacteria 2210
18 Ga0070669_100109367 3300005353 Bacteria 2096
19 Ga0070669_100279352 3300005353 Bacteria 1338
20 Ga0070669_100350701 3300005353 Bacteria 1198
21 Ga0070675_100005360 3300005354 Bacteria 9806
22 Ga0070675_100229137 3300005354 Bacteria 1620
23 Ga0070671_100267843 3300005355 Bacteria 1452
24 Ga0070674_100035194 3300005356 Bacteria 3352
25 Ga0070674_100264983 3300005356 Bacteria 1355
26 Ga0070673_100148392 3300005364 Bacteria 1984
27 Ga0070673_100395003 3300005364 Bacteria 1235
28 Ga0070673_100443432 3300005364 Bacteria 1167
29 Ga0070688_100026128 3300005365 Bacteria 3466
30 Ga0070688_100065869 3300005365 Bacteria 2304
31 Ga0070667_100382425 3300005367 Bacteria 1279
32 Ga0070667_100575329 3300005367 Bacteria 1037
33 Ga0070703_10230383 3300005406 Bacteria 742
34 Ga0070700_100637662 3300005441 Bacteria 840
35 Ga0070708_100621697 3300005445 Bacteria 1018
36 Ga0070678_100035374 3300005456 Bacteria 3486
37 Ga0070678_100303766 3300005456 Bacteria 1357
38 Ga0070678_100445092 3300005456 Bacteria 1134
39 Ga0070678_101006753 3300005456 Bacteria 766
40 Ga0070681_10399946 3300005458 Bacteria 1285
41 Ga0068867_100046428 3300005459 Bacteria 3191
42 Ga0070685_10028477 3300005466 Bacteria 3095
43 Ga0070706_100285263 3300005467 Bacteria 1541
44 Ga0070707_100567587 3300005468 Bacteria 1097
45 Ga0070698_100858141 3300005471 Bacteria 853
46 Ga0070684_100690592 3300005535 Bacteria 951
47 Ga0070697_100112024 3300005536 Bacteria 2275
48 Ga0068853_100132349 3300005539 Bacteria 2234
49 Ga0068853_100989907 3300005539 Bacteria 809
50 Ga0070672_100004949 3300005543 Bacteria 8773
51 Ga0070672_100413261 3300005543 Bacteria 1158
52 Ga0070695_100251106 3300005545 Bacteria 1287
53 Ga0070696_100020012 3300005546 Bacteria 4537
54 Ga0070696_100471840 3300005546 Bacteria 994
55 Ga0070696_100789828 3300005546 Unclassified 781
56 Ga0070693_100291315 3300005547 Bacteria 1097
57 Ga0070665_100128587 3300005548 Bacteria 2536
58 Ga0070704_100111377 3300005549 Bacteria 2083
59 Ga0070664_100384776 3300005564 Bacteria 1281
60 Ga0068857_100159446 3300005577 Bacteria 2047
61 Ga0068857_100560644 3300005577 Bacteria 1077
62 Ga0068854_100205125 3300005578 Bacteria 1552
63 Ga0070702_100099500 3300005615 Bacteria 1781
64 Ga0068859_100745025 3300005617 Bacteria 1069
65 Ga0068859_101964840 3300005617 Bacteria 646
66 Ga0068864_100075102 3300005618 Bacteria 2950
67 Ga0068864_100246057 3300005618 Bacteria 1658
68 Ga0068866_10199436 3300005718 Bacteria 1195
69 Ga0068861_100494746 3300005719 Bacteria 1104
70 Ga0068861_100641595 3300005719 Bacteria 980
71 Ga0068861_100755536 3300005719 Bacteria 909
72 Ga0068858_101215529 3300005842 Bacteria 741
73 Ga0068860_100929753 3300005843 Bacteria 886
74 Ga0068862_100431285 3300005844 Bacteria 1239
75 Ga0081539_10000468 3300005985 Bacteria 85386
76 Ga0081539_10004549 3300005985 Bacteria 15199
77 Ga0075365_10344949 3300006038 Bacteria 1049
78 Ga0075368_10034479 3300006042 Bacteria 1972
79 Ga0075368_10058678 3300006042 Bacteria 1538
80 Ga0075363_100020128 3300006048 Bacteria 3344
81 Ga0075364_10178268 3300006051 Bacteria 1437
82 Ga0075364_10242792 3300006051 Bacteria 1223
83 Ga0075364_10263645 3300006051 Bacteria 1171
84 Ga0075362_10080444 3300006177 Bacteria 1501
85 Ga0075362_10255486 3300006177 Bacteria 862
86 Ga0075367_10247190 3300006178 Bacteria 1118
87 Ga0075367_10316172 3300006178 Bacteria 984
88 Ga0075366_10000889 3300006195 Bacteria 14448
89 Ga0075366_10204721 3300006195 Bacteria 1200
90 Ga0075366_10277769 3300006195 Bacteria 1023
91 Ga0097621_100843253 3300006237 Bacteria 851
92 Ga0075370_10073168 3300006353 Bacteria 1962
93 Ga0075370_10337929 3300006353 Bacteria 898
94 Ga0075428_100055625 3300006844 Bacteria 4335
95 Ga0075430_100000209 3300006846 Bacteria 40052
96 Ga0075430_100245146 3300006846 Bacteria 1485
97 Ga0075430_100257130 3300006846 Bacteria 1446
98 Ga0075430_100433385 3300006846 Bacteria 1085
99 Ga0075430_100884615 3300006846 Bacteria 736
100 Ga0075431_100085446 3300006847 Bacteria 3257
101 Ga0075434_100041314 3300006871 Bacteria 4569
102 Ga0075434_101197657 3300006871 Bacteria 772
103 Ga0068865_100298861 3300006881 Bacteria 1288
104 Ga0097620_100744937 3300006931 Bacteria 1069
105 Ga0097620_101965295 3300006931 Bacteria 646
106 Ga0075435_100379097 3300007076 Bacteria 1215
107 Ga0111539_10554009 3300009094 Bacteria 1339
108 Ga0105245_10440344 3300009098 Bacteria 1310
109 Ga0105245_10597014 3300009098 Bacteria 1130
110 Ga0114129_10097452 3300009147 Bacteria 4071
111 Ga0114129_11666561 3300009147 Bacteria 779
112 Ga0105248_10248109 3300009177 Bacteria 2004
113 Ga0105248_10336029 3300009177 Bacteria 1701
114 Ga0105237_10219562 3300009545 Bacteria 1901
115 Ga0105238_10291690 3300009551 Bacteria 1613
116 Ga0105238_10350604 3300009551 Bacteria 1465
117 Ga0105238_10574413 3300009551 Bacteria 1133
118 Ga0105238_11403304 3300009551 Bacteria 726
119 Ga0105246_11028891 3300011119 Bacteria 747
120 Ga0157374_10485928 3300013296 Bacteria 1238
121 Ga0157374_10971095 3300013296 Bacteria 868
122 Ga0157378_10116916 3300013297 Bacteria 2453
123 Ga0157378_10588914 3300013297 Bacteria 1122
124 Ga0157375_10824756 3300013308 Bacteria 1075
125 Ga0163163_11117740 3300014325 Bacteria 851
126 Ga0157380_10706612 3300014326 Bacteria 1014
127 Ga0157380_11545818 3300014326 Bacteria 718
128 Ga0157377_10085962 3300014745 Bacteria 1847
129 Ga0157377_10212179 3300014745 Bacteria 1235
130 Ga0157377_10611571 3300014745 Bacteria 779
131 Ga0163161_10255077 3300017792 Bacteria 1368
132 Ga0163161_10658943 3300017792 Bacteria 868
133 Ga0213876_10037282 3300021384 Bacteria 2565
134 Ga0209758_1000302 3300025297 Bacteria 96619
135 Ga0209257_1000448 3300025304 Bacteria 77551
136 Ga0207697_10035993 3300025315 Bacteria 2027
137 Ga0207682_10005675 3300025893 Bacteria 5066
138 Ga0207642_10272170 3300025899 Bacteria 970
139 Ga0207645_10055321 3300025907 Bacteria 2533
140 Ga0207643_10073257 3300025908 Bacteria 1974
141 Ga0207684_10411969 3300025910 Bacteria 1162
142 Ga0207671_10032028 3300025914 Bacteria 3914
143 Ga0207662_10017556 3300025918 Bacteria 4050
144 Ga0207662_10145312 3300025918 Bacteria 1505
145 Ga0207662_10345951 3300025918 Bacteria 997
146 Ga0207646_11008164 3300025922 Bacteria 736
147 Ga0207681_10287279 3300025923 Bacteria 1297
148 Ga0207681_10552865 3300025923 Bacteria 947
149 Ga0207694_10279676 3300025924 Bacteria 1371
150 Ga0207694_10339065 3300025924 Bacteria 1243
151 Ga0207650_10165558 3300025925 Bacteria 1754
152 Ga0207650_10840949 3300025925 Bacteria 778
153 Ga0207659_10028826 3300025926 Bacteria 3776
154 Ga0207659_10102289 3300025926 Bacteria 2162
155 Ga0207700_10224666 3300025928 Bacteria 1593
156 Ga0207644_10192571 3300025931 Bacteria 1604
157 Ga0207709_10113214 3300025935 Bacteria 1818
158 Ga0207670_10239350 3300025936 Bacteria 1397
159 Ga0207670_10537224 3300025936 Bacteria 954
160 Ga0207669_10022322 3300025937 Bacteria 3360
161 Ga0207669_10536849 3300025937 Bacteria 941
162 Ga0207669_10551738 3300025937 Bacteria 930
163 Ga0207704_10185049 3300025938 Bacteria 1509
164 Ga0207691_10002241 3300025940 Bacteria 18944
165 Ga0207691_10124948 3300025940 Bacteria 2277
166 Ga0207691_10223255 3300025940 Bacteria 1633
167 Ga0207689_10128965 3300025942 Bacteria 2081
168 Ga0207661_10069480 3300025944 Bacteria 2872
169 Ga0207651_10116597 3300025960 Bacteria 2016
170 Ga0207712_10219352 3300025961 Bacteria 1519
171 Ga0207712_10861802 3300025961 Bacteria 799
172 Ga0207668_10448436 3300025972 Bacteria 1101
173 Ga0207668_10805798 3300025972 Bacteria 832
174 Ga0207658_10188407 3300025986 Bacteria 1713
175 Ga0207658_10989877 3300025986 Bacteria 767
176 Ga0207703_10777806 3300026035 Bacteria 913
177 Ga0207641_10174474 3300026088 Bacteria 1965
178 Ga0207648_10362973 3300026089 Bacteria 1307
179 Ga0207676_10119539 3300026095 Bacteria 2219
180 Ga0207676_10407867 3300026095 Bacteria 1271
181 Ga0207674_10102322 3300026116 Bacteria 2845
182 Ga0207674_10256865 3300026116 Bacteria 1694
183 Ga0207675_100471568 3300026118 Bacteria 1246
184 Ga0207683_10139977 3300026121 Bacteria 2180
185 Ga0207683_10153076 3300026121 Bacteria 2082
186 Ga0207683_10221110 3300026121 Bacteria 1725
187 Ga0207683_10250931 3300026121 Bacteria 1615
188 Ga0209981_1026484 3300027378 Bacteria 842
189 Ga0209995_1002368 3300027471 Bacteria 2977
190 Ga0209968_1006786 3300027526 Bacteria 1728
191 Ga0209968_1007080 3300027526 Bacteria 1694
192 Ga0209999_1012209 3300027543 Bacteria 1556
193 Ga0209971_1035467 3300027682 Bacteria 1199
194 Ga0209813_10037875 3300027866 Bacteria 1455
195 Ga0209974_10035570 3300027876 Bacteria 1654
196 Ga0268266_10200060 3300028379 Bacteria 1828
197 Ga0268266_10449953 3300028379 Bacteria 1224
198 Ga0268265_10026024 3300028380 Bacteria 4159
199 Ga0268265_10551092 3300028380 Bacteria 1095
200 Ga0265320_10036960 3300031240 Bacteria 2464
201 Ga0265340_10029531 3300031247 Bacteria 2753
202 Ga0307513_10116983 3300031456 Bacteria 2644
203 Ga0307513_10354509 3300031456 Bacteria 1214
204 Ga0307409_100579731 3300031995 Bacteria 1106
205 Ga0373952_0016331 3300035092 Bacteria 1508
206 Ga0373939_0008009 3300035114 Bacteria 2581
207 Ga0373954_0346305 3300035118 Bacteria 734
208 Ga0373961_0091831 3300035241 Bacteria 971
209 Ga0373931_0007661 3300035691 Bacteria 5093
210 Ga0373931_0299663 3300035691 Bacteria 992
211 Ga0373931_0465427 3300035691 Unclassified 811
212 Ga0373931_0547865 3300035691 Unclassified 751
213 Ga0373937_0137846 3300036401 Bacteria 2282
214 Ga0436364_0921171 3300037853 Bacteria 5236
215 Ga0436363_0161687 3300039450 Bacteria 12768
216 Ga0439461_0015099 3300041410 Bacteria 1477
217 Ga0439441_017225 3300042001 Unclassified 1295
218 Ga0439446_0002466 3300042156 Bacteria 4446
219 Ga0439434_0011701 3300042435 Bacteria 2595
220 Ga0439435_0000085 3300042436 Bacteria 11385
221 Ga0439460_0006395 3300042461 Bacteria 2920
222 Ga0439460_0089709 3300042461 Bacteria 976
223 Ga0466964_0081718 3300044706 Bacteria 1388
224 Ga0466957_0041527 3300044842 Bacteria 2782
225 Ga0451576_0007540 3300045051 Bacteria 12965
226 Ga0466967_0351115 3300045976 Bacteria 1427
227 Ga0495638_0016067 3300046460 Bacteria 5017
228 Ga0495580_0118200 3300046472 Bacteria 1841
229 Ga0495605_0126722 3300046474 Bacteria 1154
230 Ga0495642_0066442 3300046528 Bacteria 1503
231 Ga0495667_0550591 3300046559 Bacteria 721
232 Ga0495669_0108941 3300046684 Bacteria 1292
233 Ga0495672_0210948 3300047320 Bacteria 965
234 Ga0495615_0025820 3300048090 Bacteria 1367
235 Ga0496102_0490198 3300048905 Bacteria 1151
236 Ga0496104_0264755 3300048907 Bacteria 1632
237 Ga0496109_0565118 3300048912 Bacteria 1073
238 Ga0496110_0186161 3300048913 Bacteria 1885
239 Ga0496110_0214265 3300048913 Bacteria 1751
240 Ga0496111_0146367 3300048914 Bacteria 1752
241 Ga0496112_0682616 3300048915 Bacteria 955
242 Ga0501031_0084808 3300049568 Bacteria 2065
243 Ga0501039_0689806 3300049575 Bacteria 799
244 Ga0501040_0058081 3300049576 Bacteria 2657
245 Ga0501041_0301080 3300049577 Bacteria 1010
246 Ga0501046_0065249 3300049580 Bacteria 2841
247 Ga0501047_0017621 3300049581 Bacteria 6844
248 Ga0501048_0429739 3300049582 Bacteria 945
249 Ga0501069_0402613 3300049585 Bacteria 810
250 Ga0501071_0068723 3300049587 Bacteria 2578
251 Ga0501071_0101851 3300049587 Bacteria 2117
252 Ga0501072_0138423 3300049588 Bacteria 1941
253 Ga0501073_0026071 3300049589 Bacteria 4188
254 Ga0501074_0289257 3300049590 Bacteria 1165
255 Ga0501074_0431333 3300049590 Bacteria 935
256 Ga0501075_0021893 3300049591 Bacteria 4665
257 Ga0501075_0682468 3300049591 Bacteria 783
258 Ga0501076_0131260 3300049592 Bacteria 2031
259 Ga0501080_0113032 3300049742 Bacteria 2517
260 Ga0501080_0265551 3300049742 Bacteria 1563
261 Ga0501083_0070476 3300049744 Bacteria 2325
262 Ga0501044_0016662 3300049823 Bacteria 7891
263 Ga0501045_0250366 3300049824 Bacteria 1319
264 nmdc:mga03683_120962_c1 3300050489 Bacteria 1164
265 nmdc:mga03n38_122879_c1 3300050490 Bacteria 1278
266 nmdc:mga03n38_40364_c1 3300050490 Bacteria 2028
267 nmdc:mga03n38_500622_c1 3300050490 Bacteria 682
268 nmdc:mga00v17_155651_c1 3300050491 Bacteria 1470
269 nmdc:mga00v17_493886_c1 3300050491 Bacteria 794
270 nmdc:mga0yw44_43929_c1 3300050492 Bacteria 2671
271 nmdc:mga0yw44_85771_c1 3300050492 Bacteria 1982
272 nmdc:mga0k408_12110_c2 3300050493 Bacteria 2157
273 nmdc:mga0k408_3507_c1 3300050493 Bacteria 8292
274 nmdc:mga06z11_123674_c1 3300050494 Bacteria 1446
275 nmdc:mga06z11_53889_c1 3300050494 Bacteria 2071
276 nmdc:mga04h51_129158_c1 3300050495 Bacteria 949
277 nmdc:mga04h51_223495_c1 3300050495 Bacteria 747
278 nmdc:mga07m45_445899_c1 3300050496 Bacteria 751
279 nmdc:mga05p37_234875_c1 3300050507 Bacteria 2207
280 nmdc:mga05p37_678203_c1 3300050507 Bacteria 1149
281 nmdc:mga09592_131471_c1 3300050508 Bacteria 2154
282 nmdc:mga0qj67_231_c1 3300050509 Bacteria 38092
283 nmdc:mga0qj67_357027_c1 3300050509 Bacteria 1181
284 nmdc:mga0qj67_41322_c1 3300050509 Bacteria 3626
285 nmdc:mga0qj67_455955_c1 3300050509 Bacteria 1030
286 nmdc:mga0qj67_939095_c1 3300050509 Bacteria 680
287 nmdc:mga06r32_268303_c1 3300050510 Bacteria 1694
288 nmdc:mga0n895_16087_c1 3300050512 Bacteria 6855
289 nmdc:mga0rr50_43786_c1 3300050513 Bacteria 3278
290 nmdc:mga0sz30_222202_c1 3300050516 Bacteria 840
291 Ga0500610_0052039 3300053079 Unclassified 2133
292 Ga0500578_0315998 3300053086 Bacteria 922
293 Ga0500644_0167281 3300053088 Bacteria 892
294 Ga0500583_0213715 3300053092 Bacteria 957
295 Ga0500651_0286213 3300053093 Bacteria 949
296 Ga0500641_0073201 3300053096 Bacteria 1445
297 Ga0500556_0196038 3300053104 Bacteria 798
298 Ga0500594_0011744 3300053118 Bacteria 2049
299 Ga0500642_0000854 3300053130 Bacteria 8878
300 Ga0500642_0016856 3300053130 Bacteria 2786
301 Ga0500642_0125286 3300053130 Bacteria 1203
302 Ga0500658_0080643 3300053134 Bacteria 1391
303 Ga0500658_0229485 3300053134 Bacteria 852
304 Ga0500568_0005022 3300053139 Bacteria 6933
305 Ga0500577_0068682 3300053142 Bacteria 1384
306 Ga0500577_0173519 3300053142 Bacteria 923
307 Ga0500588_0009962 3300053146 Bacteria 2278
308 Ga0500588_0046007 3300053146 Bacteria 1339
309 Ga0500588_0183122 3300053146 Bacteria 771
310 Ga0500589_112767 3300053147 Bacteria 1164
311 Ga0500604_0000622 3300053151 Bacteria 9728
312 Ga0500616_0059122 3300053153 Bacteria 1992
313 Ga0500609_032242 3300053731 Bacteria 720
314 Ga0500599_001326 3300053736 Bacteria 2827
315 Ga0500587_015416 3300053739 Bacteria 973
316 Ga0501084_0119115 3300054114 Bacteria 2219
317 Ga0501084_0434539 3300054114 Bacteria 1110
318 Ga0501082_0039289 3300060353 Bacteria 4083
319 Ga0501082_0090331 3300060353 Bacteria 2644
320 Ga0501082_0636949 3300060353 Bacteria 933
321 Ga0530510_0182051 3300061734 Bacteria 1558
322 2821449080 2821443989 Bacteria 7658172
323 Ga0070685_10158366
324 JGI25406J46586_10012432
325 JGI25153J46596_10001926
326 JGI25153J46596_10005523
327 Ga0065715_10195425
328 Ga0070683_100158594
329 Ga0070690_100011512
330 Ga0070670_100624141
331 Ga0070677_10008423
332 Ga0070677_10313563
333 Ga0068869_100609866
334 Ga0070680_100024456
335 Ga0070689_100024483
336 Ga0070689_100643342
337 Ga0070687_100019224
338 Ga0070687_100267067
339 Ga0070661_100095069
340 Ga0070669_100109367
341 Ga0070669_100279352
342 Ga0070669_100350701
343 Ga0070675_100005360
344 Ga0070675_100229137
345 Ga0070671_100267843
346 Ga0070674_100035194
347 Ga0070674_100264983
348 Ga0070673_100148392
349 Ga0070673_100395003
350 Ga0070673_100443432
351 Ga0070688_100026128
352 Ga0070688_100065869
353 Ga0070667_100382425
354 Ga0070667_100575329
355 Ga0070703_10230383
356 Ga0070700_100637662
357 Ga0070708_100621697
358 Ga0070678_100035374
359 Ga0070678_100303766
360 Ga0070678_100445092
361 Ga0070678_101006753
362 Ga0070681_10399946
363 Ga0068867_100046428
364 Ga0070685_10028477
365 Ga0070706_100285263
366 Ga0070707_100567587
367 Ga0070698_100858141
368 Ga0070684_100690592
369 Ga0070697_100112024
370 Ga0068853_100132349
371 Ga0068853_100989907
372 Ga0070672_100004949
373 Ga0070672_100413261
374 Ga0070695_100251106
375 Ga0070696_100020012
376 Ga0070696_100471840
377 Ga0070696_100789828
378 Ga0070693_100291315
379 Ga0070665_100128587
380 Ga0070704_100111377
381 Ga0070664_100384776
382 Ga0068857_100159446
383 Ga0068857_100560644
384 Ga0068854_100205125
385 Ga0070702_100099500
386 Ga0068859_100745025
387 Ga0068859_101964840
388 Ga0068864_100075102
389 Ga0068864_100246057
390 Ga0068866_10199436
391 Ga0068861_100494746
392 Ga0068861_100641595
393 Ga0068861_100755536
394 Ga0068858_101215529
395 Ga0068860_100929753
396 Ga0068862_100431285
397 Ga0081539_10000468
398 Ga0081539_10004549
399 Ga0075365_10344949
400 Ga0075368_10034479
401 Ga0075368_10058678
402 Ga0075363_100020128
403 Ga0075364_10178268
404 Ga0075364_10242792
405 Ga0075364_10263645
406 Ga0075362_10080444
407 Ga0075362_10255486
408 Ga0075367_10247190
409 Ga0075367_10316172
410 Ga0075366_10000889
411 Ga0075366_10204721
412 Ga0075366_10277769
413 Ga0097621_100843253
414 Ga0075370_10073168
415 Ga0075370_10337929
416 Ga0075428_100055625
417 Ga0075430_100000209
418 Ga0075430_100245146
419 Ga0075430_100257130
420 Ga0075430_100433385
421 Ga0075430_100884615
422 Ga0075431_100085446
423 Ga0075434_100041314
424 Ga0075434_101197657
425 Ga0068865_100298861
426 Ga0097620_100744937
427 Ga0097620_101965295
428 Ga0075435_100379097
429 Ga0111539_10554009
430 Ga0105245_10440344
431 Ga0105245_10597014
432 Ga0114129_10097452
433 Ga0114129_11666561
434 Ga0105248_10248109
435 Ga0105248_10336029
436 Ga0105237_10219562
437 Ga0105238_10291690
438 Ga0105238_10350604
439 Ga0105238_10574413
440 Ga0105238_11403304
441 Ga0105246_11028891
442 Ga0157374_10485928
443 Ga0157374_10971095
444 Ga0157378_10116916
445 Ga0157378_10588914
446 Ga0157375_10824756
447 Ga0163163_11117740
448 Ga0157380_10706612
449 Ga0157380_11545818
450 Ga0157377_10085962
451 Ga0157377_10212179
452 Ga0157377_10611571
453 Ga0163161_10255077
454 Ga0163161_10658943
455 Ga0213876_10037282
456 Ga0209758_1000302
457 Ga0209257_1000448
458 Ga0207697_10035993
459 Ga0207682_10005675
460 Ga0207642_10272170
461 Ga0207645_10055321
462 Ga0207643_10073257
463 Ga0207684_10411969
464 Ga0207671_10032028
465 Ga0207662_10017556
466 Ga0207662_10145312
467 Ga0207662_10345951
468 Ga0207646_11008164
469 Ga0207681_10287279
470 Ga0207681_10552865
471 Ga0207694_10279676
472 Ga0207694_10339065
473 Ga0207650_10165558
474 Ga0207650_10840949
475 Ga0207659_10028826
476 Ga0207659_10102289
477 Ga0207700_10224666
478 Ga0207644_10192571
479 Ga0207709_10113214
480 Ga0207670_10239350
481 Ga0207670_10537224
482 Ga0207669_10022322
483 Ga0207669_10536849
484 Ga0207669_10551738
485 Ga0207704_10185049
486 Ga0207691_10002241
487 Ga0207691_10124948
488 Ga0207691_10223255
489 Ga0207689_10128965
490 Ga0207661_10069480
491 Ga0207651_10116597
492 Ga0207712_10219352
493 Ga0207712_10861802
494 Ga0207668_10448436
495 Ga0207668_10805798
496 Ga0207658_10188407
497 Ga0207658_10989877
498 Ga0207703_10777806
499 Ga0207641_10174474
500 Ga0207648_10362973
501 Ga0207676_10119539
502 Ga0207676_10407867
503 Ga0207674_10102322
504 Ga0207674_10256865
505 Ga0207675_100471568
506 Ga0207683_10139977
507 Ga0207683_10153076
508 Ga0207683_10221110
509 Ga0207683_10250931
510 Ga0209981_1026484
511 Ga0209995_1002368
512 Ga0209968_1006786
513 Ga0209968_1007080
514 Ga0209999_1012209
515 Ga0209971_1035467
516 Ga0209813_10037875
517 Ga0209974_10035570
518 Ga0268266_10200060
519 Ga0268266_10449953
520 Ga0268265_10026024
521 Ga0268265_10551092
522 Ga0265320_10036960
523 Ga0265340_10029531
524 Ga0307513_10116983
525 Ga0307513_10354509
526 Ga0307409_100579731
527 Ga0373952_0016331
528 Ga0373939_0008009
529 Ga0373954_0346305
530 Ga0373961_0091831
531 Ga0373931_0007661
532 Ga0373931_0299663
533 Ga0373931_0465427
534 Ga0373931_0547865
535 Ga0373937_0137846
536 Ga0436364_0921171
537 Ga0436363_0161687
538 Ga0439461_0015099
539 Ga0439441_017225
540 Ga0439446_0002466
541 Ga0439434_0011701
542 Ga0439435_0000085
543 Ga0439460_0006395
544 Ga0439460_0089709
545 Ga0466964_0081718
546 Ga0466957_0041527
547 Ga0451576_0007540
548 Ga0466967_0351115
549 Ga0495638_0016067
550 Ga0495580_0118200
551 Ga0495605_0126722
552 Ga0495642_0066442
553 Ga0495667_0550591
554 Ga0495669_0108941
555 Ga0495672_0210948
556 Ga0495615_0025820
557 Ga0496102_0490198
558 Ga0496104_0264755
559 Ga0496109_0565118
560 Ga0496110_0186161
561 Ga0496110_0214265
562 Ga0496111_0146367
563 Ga0496112_0682616
564 Ga0501031_0084808
565 Ga0501039_0689806
566 Ga0501040_0058081
567 Ga0501041_0301080
568 Ga0501046_0065249
569 Ga0501047_0017621
570 Ga0501048_0429739
571 Ga0501069_0402613
572 Ga0501071_0068723
573 Ga0501071_0101851
574 Ga0501072_0138423
575 Ga0501073_0026071
576 Ga0501074_0289257
577 Ga0501074_0431333
578 Ga0501075_0021893
579 Ga0501075_0682468
580 Ga0501076_0131260
581 Ga0501080_0113032
582 Ga0501080_0265551
583 Ga0501083_0070476
584 Ga0501044_0016662
585 Ga0501045_0250366
586 nmdc:mga03683_120962_c1
587 nmdc:mga03n38_122879_c1
588 nmdc:mga03n38_40364_c1
589 nmdc:mga03n38_500622_c1
590 nmdc:mga00v17_155651_c1
591 nmdc:mga00v17_493886_c1
592 nmdc:mga0yw44_43929_c1
593 nmdc:mga0yw44_85771_c1
594 nmdc:mga0k408_12110_c2
595 nmdc:mga0k408_3507_c1
596 nmdc:mga06z11_123674_c1
597 nmdc:mga06z11_53889_c1
598 nmdc:mga04h51_129158_c1
599 nmdc:mga04h51_223495_c1
600 nmdc:mga07m45_445899_c1
601 nmdc:mga05p37_234875_c1
602 nmdc:mga05p37_678203_c1
603 nmdc:mga09592_131471_c1
604 nmdc:mga0qj67_231_c1
605 nmdc:mga0qj67_357027_c1
606 nmdc:mga0qj67_41322_c1
607 nmdc:mga0qj67_455955_c1
608 nmdc:mga0qj67_939095_c1
609 nmdc:mga06r32_268303_c1
610 nmdc:mga0n895_16087_c1
611 nmdc:mga0rr50_43786_c1
612 nmdc:mga0sz30_222202_c1
613 Ga0500610_0052039
614 Ga0500578_0315998
615 Ga0500644_0167281
616 Ga0500583_0213715
617 Ga0500651_0286213
618 Ga0500641_0073201
619 Ga0500556_0196038
620 Ga0500594_0011744
621 Ga0500642_0000854
622 Ga0500642_0016856
623 Ga0500642_0125286
624 Ga0500658_0080643
625 Ga0500658_0229485
626 Ga0500568_0005022
627 Ga0500577_0068682
628 Ga0500577_0173519
629 Ga0500588_0009962
630 Ga0500588_0046007
631 Ga0500588_0183122
632 Ga0500589_112767
633 Ga0500604_0000622
634 Ga0500616_0059122
635 Ga0500609_032242
636 Ga0500599_001326
637 Ga0500587_015416
638 Ga0501084_0119115
639 Ga0501084_0434539
640 Ga0501082_0039289
641 Ga0501082_0090331
642 Ga0501082_0636949
643 Ga0530510_0182051
644 2821449080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

14

201

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4757 1 199
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4659 1 199
7xq1-assembly1.cif.gz_A structure of hslc19a1+2'3'-cdas 0.4555 8 200
7bp3-assembly1.cif.gz_B cryo-em structure of the human mct2 0.4517 49 201
8e6l-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter d296a mutant in an inward-open, manganese-bound state 0.4302 12 199
ID Description Score Start End Superfamily
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6175 9 198 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.581 9 198 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5745 2 200 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5607 2 200 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5541 3 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0S6UF71-F1-model_v4 Homoserine/homoserine lactone efflux protein 0.947 1 204 GO:0005886
GO:0015171
AF-A0A0S6UF71-F1-model_v4 Homoserine/homoserine lactone efflux protein 0.9425 1 204 GO:0005886
GO:0015171
AF-F0KPN9-F1-model_v4 Lysine exporter protein (LysE/YggA) 0.9408 8 200 GO:0005886
GO:0015171
AF-A0A3D5IM58-F1-model_v4 deleted 0.9371 2 202
AF-A0A1X7D5E6-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9312 2 202 GO:0005886
GO:0015171

Map