F406328

General Info

Members Datasets Scaffolds Average Seq Length
322 168 644 163

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100988468|Ga0070705_1009884682
Length 156
Sequence MTDTLDGGCACGKLRYRMLTAPMFVHCCHCTDCQRQTGSAFVLNALIEADRVEILAGEPEPVTMPTESGLPHDIYRCPKCRIAVWSTYGGRTKIRFVRVGTLENPAALPPDVHIYTRSKLPWVALPEGVPAFEAYYDSKKLWPAESLERRAALMSS

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 0.31
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100988468 3300005440 Unclassified 682
2 JGI24741J21665_1002016 3300001915 Bacteria 5458
3 JGI24740J21852_10002851 3300001979 Bacteria 7726
4 JGI25405J52794_10063978 3300003911 Bacteria 798
5 Ga0070658_10064871 3300005327 Bacteria 2979
6 Ga0070683_100373572 3300005329 Bacteria 1358
7 Ga0070680_100000463 3300005336 Bacteria 27679
8 Ga0070680_100004344 3300005336 Bacteria 10656
9 Ga0070680_100128409 3300005336 Bacteria 2119
10 Ga0070680_100212918 3300005336 Bacteria 1630
11 Ga0070680_100303852 3300005336 Bacteria 1353
12 Ga0070682_100612462 3300005337 Bacteria 861
13 Ga0070691_10011340 3300005341 Bacteria 4069
14 Ga0070691_10016026 3300005341 Bacteria 3445
15 Ga0070661_100038348 3300005344 Bacteria 3488
16 Ga0070661_100046060 3300005344 Bacteria 3190
17 Ga0070661_100224099 3300005344 Bacteria 1443
18 Ga0070661_100316782 3300005344 Bacteria 1217
19 Ga0070668_100015058 3300005347 Bacteria 5777
20 Ga0070668_100076730 3300005347 Bacteria 2611
21 Ga0070669_100048711 3300005353 Bacteria 3093
22 Ga0070675_100334510 3300005354 Bacteria 1340
23 Ga0070675_101469557 3300005354 Bacteria 629
24 Ga0070671_100259434 3300005355 Bacteria 1477
25 Ga0070671_101717360 3300005355 Bacteria 557
26 Ga0070674_100014525 3300005356 Bacteria 4896
27 Ga0070688_100925939 3300005365 Bacteria 689
28 Ga0070659_100123377 3300005366 Bacteria 2100
29 Ga0070713_101146660 3300005436 Bacteria 752
30 Ga0070700_100036739 3300005441 Bacteria 2974
31 Ga0070663_100022666 3300005455 Bacteria 4201
32 Ga0070663_100058495 3300005455 Bacteria 2768
33 Ga0070663_100110258 3300005455 Bacteria 2067
34 Ga0070678_100104285 3300005456 Bacteria 2205
35 Ga0070662_100050932 3300005457 Bacteria 2988
36 Ga0070662_100230863 3300005457 Bacteria 1480
37 Ga0070681_10000243 3300005458 Bacteria 43157
38 Ga0070681_10001227 3300005458 Bacteria 22307
39 Ga0070681_10049108 3300005458 Bacteria 4215
40 Ga0070681_10234430 3300005458 Bacteria 1749
41 Ga0070681_10493792 3300005458 Bacteria 1137
42 Ga0070681_10695431 3300005458 Bacteria 932
43 Ga0070681_10879760 3300005458 Bacteria 814
44 Ga0068867_100153497 3300005459 Bacteria 1810
45 Ga0070679_100000779 3300005530 Bacteria 27679
46 Ga0070679_100001257 3300005530 Bacteria 22349
47 Ga0070679_100164582 3300005530 Bacteria 2192
48 Ga0070679_100204099 3300005530 Bacteria 1941
49 Ga0070679_100775231 3300005530 Bacteria 902
50 Ga0070684_100154616 3300005535 Bacteria 2079
51 Ga0070684_100189247 3300005535 Bacteria 1872
52 Ga0068853_100056024 3300005539 Bacteria 3398
53 Ga0068853_100426443 3300005539 Bacteria 1244
54 Ga0068853_100460491 3300005539 Bacteria 1197
55 Ga0070672_100030122 3300005543 Bacteria 4074
56 Ga0070696_100221934 3300005546 Bacteria 1418
57 Ga0070693_100162574 3300005547 Bacteria 1423
58 Ga0068855_100053636 3300005563 Bacteria 4742
59 Ga0068855_100732829 3300005563 Bacteria 1055
60 Ga0070664_100014262 3300005564 Bacteria 6481
61 Ga0070664_100022258 3300005564 Bacteria 5226
62 Ga0070664_100031291 3300005564 Bacteria 4444
63 Ga0070664_100318309 3300005564 Bacteria 1409
64 Ga0068857_100540999 3300005577 Bacteria 1096
65 Ga0068857_101035398 3300005577 Bacteria 791
66 Ga0068856_100008558 3300005614 Bacteria 9947
67 Ga0068852_100026927 3300005616 Bacteria 4680
68 Ga0068864_100083038 3300005618 Bacteria 2813
69 Ga0068866_10450782 3300005718 Bacteria 841
70 Ga0068861_100283979 3300005719 Bacteria 1426
71 Ga0068870_10024452 3300005840 Bacteria 2989
72 Ga0068863_100079279 3300005841 Bacteria 3110
73 Ga0068863_100422243 3300005841 Bacteria 1306
74 Ga0068863_100495598 3300005841 Bacteria 1203
75 Ga0068860_100093188 3300005843 Bacteria 2871
76 Ga0068862_100049101 3300005844 Bacteria 3604
77 Ga0068862_100088820 3300005844 Bacteria 2689
78 Ga0081455_10000243 3300005937 Bacteria 70794
79 Ga0070717_10098232 3300006028 Bacteria 2482
80 Ga0075368_10319037 3300006042 Bacteria 673
81 Ga0075432_10052344 3300006058 Bacteria 1442
82 Ga0075366_10338691 3300006195 Bacteria 922
83 Ga0075428_100192221 3300006844 Bacteria 2207
84 Ga0075430_101090882 3300006846 Bacteria 657
85 Ga0075433_10074067 3300006852 Bacteria 2996
86 Ga0068865_100043462 3300006881 Bacteria 3071
87 Ga0105240_12182442 3300009093 Bacteria 574
88 Ga0111539_10399071 3300009094 Bacteria 1602
89 Ga0105243_11038650 3300009148 Bacteria 824
90 Ga0105237_10135245 3300009545 Bacteria 2459
91 Ga0105238_10276546 3300009551 Bacteria 1660
92 Ga0157373_10076550 3300013100 Bacteria 2361
93 Ga0157373_10149420 3300013100 Bacteria 1643
94 Ga0157373_10359501 3300013100 Bacteria 1039
95 Ga0157371_10230330 3300013102 Bacteria 1331
96 Ga0157371_10246074 3300013102 Bacteria 1287
97 Ga0157370_10024329 3300013104 Bacteria 5997
98 Ga0157370_10108138 3300013104 Bacteria 2601
99 Ga0157370_11551473 3300013104 Bacteria 595
100 Ga0157369_10017011 3300013105 Bacteria 8172
101 Ga0157369_10127987 3300013105 Bacteria 2692
102 Ga0157369_10659832 3300013105 Bacteria 1078
103 Ga0157369_10669085 3300013105 Bacteria 1070
104 Ga0163162_11397086 3300013306 Bacteria 796
105 Ga0157372_10007657 3300013307 Bacteria 11484
106 Ga0157372_10039244 3300013307 Bacteria 5226
107 Ga0157372_10045185 3300013307 Bacteria 4884
108 Ga0157372_10116791 3300013307 Bacteria 3060
109 Ga0157380_10083499 3300014326 Bacteria 2617
110 Ga0157380_12401569 3300014326 Bacteria 592
111 Ga0163161_10818358 3300017792 Bacteria 784
112 Ga0197907_10364535 3300020069 Bacteria 1038
113 Ga0206356_10081882 3300020070 Bacteria 5926
114 Ga0206351_10346109 3300020077 Bacteria 843
115 Ga0206354_10658246 3300020081 Bacteria 6059
116 Ga0206353_10569941 3300020082 Bacteria 1304
117 Ga0207647_10001564 3300025904 Bacteria 17594
118 Ga0207645_10017958 3300025907 Bacteria 4665
119 Ga0207643_10007700 3300025908 Bacteria 5785
120 Ga0207705_10000515 3300025909 Bacteria 32966
121 Ga0207705_10334861 3300025909 Bacteria 1164
122 Ga0207705_10804658 3300025909 Bacteria 729
123 Ga0207707_10000042 3300025912 Bacteria 126050
124 Ga0207707_10000131 3300025912 Bacteria 77593
125 Ga0207707_10000569 3300025912 Bacteria 37436
126 Ga0207707_10000902 3300025912 Bacteria 28985
127 Ga0207707_10018534 3300025912 Bacteria 6068
128 Ga0207707_10346526 3300025912 Bacteria 1280
129 Ga0207695_10030483 3300025913 Bacteria 5937
130 Ga0207695_10148225 3300025913 Bacteria 2288
131 Ga0207695_10203053 3300025913 Bacteria 1896
132 Ga0207671_10055242 3300025914 Bacteria 2942
133 Ga0207660_10000429 3300025917 Bacteria 27667
134 Ga0207660_10002621 3300025917 Bacteria 11808
135 Ga0207660_10002733 3300025917 Bacteria 11551
136 Ga0207660_10176390 3300025917 Bacteria 1657
137 Ga0207660_10472679 3300025917 Bacteria 1015
138 Ga0207657_10031853 3300025919 Bacteria 4769
139 Ga0207657_10211825 3300025919 Bacteria 1555
140 Ga0207649_10003225 3300025920 Bacteria 8936
141 Ga0207649_10018148 3300025920 Bacteria 3995
142 Ga0207649_10078709 3300025920 Bacteria 2128
143 Ga0207649_10190354 3300025920 Bacteria 1442
144 Ga0207649_10194071 3300025920 Bacteria 1430
145 Ga0207652_10000733 3300025921 Bacteria 31742
146 Ga0207652_10003302 3300025921 Bacteria 13359
147 Ga0207652_10006544 3300025921 Bacteria 9388
148 Ga0207652_10045604 3300025921 Bacteria 3737
149 Ga0207652_10092181 3300025921 Bacteria 2664
150 Ga0207652_10097337 3300025921 Bacteria 2593
151 Ga0207652_10350509 3300025921 Bacteria 1332
152 Ga0207681_10125973 3300025923 Bacteria 1886
153 Ga0207681_10176073 3300025923 Bacteria 1625
154 Ga0207650_10112304 3300025925 Bacteria 2111
155 Ga0207644_10336579 3300025931 Bacteria 1223
156 Ga0207690_10002053 3300025932 Bacteria 12338
157 Ga0207690_10060572 3300025932 Bacteria 2570
158 Ga0207690_10236246 3300025932 Bacteria 1406
159 Ga0207706_10001080 3300025933 Bacteria 27682
160 Ga0207709_10324079 3300025935 Bacteria 1154
161 Ga0207709_10835656 3300025935 Bacteria 745
162 Ga0207669_10047680 3300025937 Unclassified 2540
163 Ga0207704_10070871 3300025938 Bacteria 2209
164 Ga0207691_10006816 3300025940 Bacteria 11013
165 Ga0207661_10002642 3300025944 Bacteria 12337
166 Ga0207661_10268256 3300025944 Bacteria 1522
167 Ga0207679_10031081 3300025945 Bacteria 3735
168 Ga0207679_10094823 3300025945 Bacteria 2318
169 Ga0207679_10176852 3300025945 Bacteria 1762
170 Ga0207667_10027205 3300025949 Bacteria 6231
171 Ga0207667_10027786 3300025949 Bacteria 6153
172 Ga0207668_10037104 3300025972 Bacteria 3259
173 Ga0207640_10002205 3300025981 Bacteria 10479
174 Ga0207640_10013510 3300025981 Bacteria 4683
175 Ga0207640_10068592 3300025981 Bacteria 2377
176 Ga0207658_10202087 3300025986 Bacteria 1660
177 Ga0207639_10053724 3300026041 Bacteria 3075
178 Ga0207639_10478347 3300026041 Bacteria 1135
179 Ga0207678_10082378 3300026067 Bacteria 2753
180 Ga0207678_10090904 3300026067 Bacteria 2609
181 Ga0207678_10297620 3300026067 Bacteria 1386
182 Ga0207708_10073216 3300026075 Bacteria 2625
183 Ga0207708_11249919 3300026075 Bacteria 650
184 Ga0207702_10004213 3300026078 Bacteria 12851
185 Ga0207702_10033038 3300026078 Bacteria 4319
186 Ga0207641_10177895 3300026088 Bacteria 1946
187 Ga0207641_10396059 3300026088 Bacteria 1325
188 Ga0207648_10003686 3300026089 Bacteria 16033
189 Ga0207648_10149944 3300026089 Bacteria 2057
190 Ga0207674_10028181 3300026116 Bacteria 5932
191 Ga0207674_10367958 3300026116 Bacteria 1390
192 Ga0207674_10590208 3300026116 Bacteria 1073
193 Ga0207675_100011422 3300026118 Bacteria 8308
194 Ga0207675_100280698 3300026118 Bacteria 1618
195 Ga0207683_10209474 3300026121 Bacteria 1774
196 Ga0207698_10179584 3300026142 Bacteria 1873
197 Ga0207698_10967354 3300026142 Bacteria 861
198 Ga0207698_11001628 3300026142 Bacteria 846
199 Ga0209970_1004774 3300027614 Bacteria 2245
200 Ga0210002_1000484 3300027617 Bacteria 5412
201 Ga0209983_1010737 3300027665 Bacteria 1872
202 Ga0209971_1001290 3300027682 Bacteria 6233
203 Ga0209966_1020649 3300027695 Bacteria 1278
204 Ga0209998_10000547 3300027717 Bacteria 10161
205 Ga0209974_10000158 3300027876 Bacteria 20766
206 Ga0207428_10023328 3300027907 Bacteria 5204
207 Ga0207428_10203190 3300027907 Bacteria 1490
208 Ga0268265_10067078 3300028380 Bacteria 2776
209 Ga0268265_10603160 3300028380 Bacteria 1049
210 Ga0268264_10113857 3300028381 Bacteria 2374
211 Ga0316182_1117619 3300030745 Bacteria 1403
212 Ga0265770_1000663 3300030878 Bacteria 4782
213 Ga0265773_1002988 3300031018 Bacteria 1075
214 Ga0265760_10000123 3300031090 Bacteria 19733
215 Ga0265332_10224912 3300031238 Archaea 778
216 Ga0265328_10016069 3300031239 Bacteria 2919
217 Ga0265329_10093724 3300031242 Unclassified 954
218 Ga0265316_10167751 3300031344 Unclassified 1639
219 Ga0316575_10006174 3300031665 Bacteria 4299
220 Ga0307405_10447516 3300031731 Bacteria 1023
221 Ga0307406_10723124 3300031901 Bacteria 833
222 Ga0307412_10110209 3300031911 Bacteria 1964
223 Ga0373926_0344437 3300035083 Unclassified 585
224 Ga0316574_0036296 3300035398 Bacteria 3017
225 Ga0395899_0242912 3300037312 Bacteria 1239
226 Ga0395900_0000078 3300037418 Bacteria 179292
227 Ga0395900_0010067 3300037418 Bacteria 9671
228 Ga0395900_0130692 3300037418 Bacteria 2573
229 Ga0395898_0164646 3300037466 Bacteria 2121
230 Ga0395901_0425786 3300038443 Bacteria 1360
231 Ga0436365_1595885 3300039437 Bacteria 1422
232 Ga0436362_0206112 3300039453 Bacteria 502
233 Ga0451807_1751200 3300041486 Bacteria 1334
234 Ga0451837_1048978 3300041494 Bacteria 1140
235 Ga0501032_0007252 3300049569 Bacteria 8109
236 Ga0501032_0113947 3300049569 Bacteria 1789
237 Ga0501032_0458784 3300049569 Bacteria 816
238 Ga0501033_0005210 3300049570 Bacteria 10329
239 Ga0501033_0027244 3300049570 Bacteria 4297
240 Ga0501034_0003836 3300049571 Bacteria 16940
241 Ga0501034_0005244 3300049571 Bacteria 14224
242 Ga0501034_0019390 3300049571 Bacteria 6956
243 Ga0501034_0081172 3300049571 Bacteria 3245
244 Ga0501034_0273973 3300049571 Bacteria 1628
245 Ga0501036_0063820 3300049572 Bacteria 3118
246 Ga0501036_0292682 3300049572 Bacteria 1362
247 Ga0501036_1096388 3300049572 Bacteria 650
248 Ga0501037_0082164 3300049573 Bacteria 2335
249 Ga0501037_0184488 3300049573 Bacteria 1479
250 Ga0501037_0270172 3300049573 Bacteria 1187
251 Ga0501038_0006500 3300049574 Bacteria 10817
252 Ga0501038_0178687 3300049574 Bacteria 1714
253 Ga0501042_0325862 3300049578 Bacteria 1110
254 Ga0501043_0492743 3300049579 Bacteria 916
255 Ga0501043_0978995 3300049579 Bacteria 603
256 Ga0501047_0001534 3300049581 Bacteria 22579
257 Ga0501047_0001578 3300049581 Bacteria 22250
258 Ga0501047_0009181 3300049581 Bacteria 9337
259 Ga0501047_0016480 3300049581 Bacteria 7054
260 Ga0501047_0024199 3300049581 Bacteria 5831
261 Ga0501067_0002460 3300049583 Bacteria 10219
262 Ga0501067_0578501 3300049583 Bacteria 629
263 Ga0501068_0025316 3300049584 Bacteria 3490
264 Ga0501068_0352511 3300049584 Bacteria 946
265 Ga0501069_0000736 3300049585 Bacteria 15270
266 Ga0501069_0026338 3300049585 Bacteria 3183
267 Ga0501069_0060812 3300049585 Bacteria 2109
268 Ga0501069_0140360 3300049585 Bacteria 1386
269 Ga0501069_0431893 3300049585 Unclassified 781
270 Ga0501070_0005258 3300049586 Bacteria 11036
271 Ga0501070_0006656 3300049586 Bacteria 9839
272 Ga0501070_0011627 3300049586 Bacteria 7430
273 Ga0501070_0015139 3300049586 Bacteria 6490
274 Ga0501070_0071770 3300049586 Bacteria 2866
275 Ga0501070_0088846 3300049586 Bacteria 2557
276 Ga0501070_0112856 3300049586 Bacteria 2246
277 Ga0501070_0233256 3300049586 Bacteria 1508
278 Ga0501070_0461376 3300049586 Bacteria 1023
279 Ga0501070_0541484 3300049586 Bacteria 932
280 Ga0501070_0649249 3300049586 Bacteria 838
281 Ga0501070_0736695 3300049586 Bacteria 777
282 Ga0501070_1257058 3300049586 Bacteria 566
283 Ga0501071_0003215 3300049587 Bacteria 10174
284 Ga0501071_0889107 3300049587 Bacteria 687
285 Ga0501072_0127161 3300049588 Bacteria 2030
286 Ga0501073_0000805 3300049589 Bacteria 22314
287 Ga0501073_0008698 3300049589 Bacteria 7517
288 Ga0501073_0041260 3300049589 Bacteria 3261
289 Ga0501073_0062297 3300049589 Bacteria 2602
290 Ga0501074_0000200 3300049590 Bacteria 32565
291 Ga0501074_0020542 3300049590 Bacteria 4799
292 Ga0501074_0027966 3300049590 Bacteria 4087
293 Ga0501074_0057026 3300049590 Bacteria 2814
294 Ga0501074_0455368 3300049590 Bacteria 907
295 Ga0501079_0150092 3300049741 Bacteria 1817
296 Ga0501080_0032971 3300049742 Bacteria 4832
297 Ga0501080_0033746 3300049742 Bacteria 4777
298 Ga0501080_0035060 3300049742 Bacteria 4684
299 Ga0501080_0040211 3300049742 Bacteria 4362
300 Ga0501080_0182238 3300049742 Bacteria 1932
301 Ga0501080_0255760 3300049742 Bacteria 1596
302 Ga0501080_0650763 3300049742 Bacteria 932
303 Ga0501083_0005354 3300049744 Bacteria 9080
304 Ga0501035_0003529 3300049822 Bacteria 14953
305 Ga0501035_0031334 3300049822 Bacteria 4843
306 Ga0501035_0050223 3300049822 Bacteria 3738
307 Ga0501044_0008611 3300049823 Bacteria 11170
308 Ga0501044_0009340 3300049823 Bacteria 10698
309 Ga0501044_0023990 3300049823 Bacteria 6481
310 Ga0501044_0048588 3300049823 Bacteria 4381
311 Ga0501044_0196120 3300049823 Bacteria 1979
312 Ga0501044_0442474 3300049823 Bacteria 1207
313 nmdc:mga03683_34941_c1 3300050489 Bacteria 1602
314 nmdc:mga0k408_349705_c1 3300050493 Bacteria 881
315 nmdc:mga09592_5933_c1 3300050508 Bacteria 9957
316 nmdc:mga0qj67_40595_c1 3300050509 Bacteria 3657
317 nmdc:mga06r32_355321_c1 3300050510 Bacteria 1450
318 nmdc:mga08y16_82381_c1 3300050511 Bacteria 3354
319 nmdc:mga0a205_84542_c1 3300050515 Bacteria 3065
320 Ga0501084_0295561 3300054114 Bacteria 1368
321 Ga0501084_0501093 3300054114 Bacteria 1026
322 Ga0501082_0692384 3300060353 Bacteria 892
323 Ga0070705_100988468
324 JGI24741J21665_1002016
325 JGI24740J21852_10002851
326 JGI25405J52794_10063978
327 Ga0070658_10064871
328 Ga0070683_100373572
329 Ga0070680_100000463
330 Ga0070680_100004344
331 Ga0070680_100128409
332 Ga0070680_100212918
333 Ga0070680_100303852
334 Ga0070682_100612462
335 Ga0070691_10011340
336 Ga0070691_10016026
337 Ga0070661_100038348
338 Ga0070661_100046060
339 Ga0070661_100224099
340 Ga0070661_100316782
341 Ga0070668_100015058
342 Ga0070668_100076730
343 Ga0070669_100048711
344 Ga0070675_100334510
345 Ga0070675_101469557
346 Ga0070671_100259434
347 Ga0070671_101717360
348 Ga0070674_100014525
349 Ga0070688_100925939
350 Ga0070659_100123377
351 Ga0070713_101146660
352 Ga0070700_100036739
353 Ga0070663_100022666
354 Ga0070663_100058495
355 Ga0070663_100110258
356 Ga0070678_100104285
357 Ga0070662_100050932
358 Ga0070662_100230863
359 Ga0070681_10000243
360 Ga0070681_10001227
361 Ga0070681_10049108
362 Ga0070681_10234430
363 Ga0070681_10493792
364 Ga0070681_10695431
365 Ga0070681_10879760
366 Ga0068867_100153497
367 Ga0070679_100000779
368 Ga0070679_100001257
369 Ga0070679_100164582
370 Ga0070679_100204099
371 Ga0070679_100775231
372 Ga0070684_100154616
373 Ga0070684_100189247
374 Ga0068853_100056024
375 Ga0068853_100426443
376 Ga0068853_100460491
377 Ga0070672_100030122
378 Ga0070696_100221934
379 Ga0070693_100162574
380 Ga0068855_100053636
381 Ga0068855_100732829
382 Ga0070664_100014262
383 Ga0070664_100022258
384 Ga0070664_100031291
385 Ga0070664_100318309
386 Ga0068857_100540999
387 Ga0068857_101035398
388 Ga0068856_100008558
389 Ga0068852_100026927
390 Ga0068864_100083038
391 Ga0068866_10450782
392 Ga0068861_100283979
393 Ga0068870_10024452
394 Ga0068863_100079279
395 Ga0068863_100422243
396 Ga0068863_100495598
397 Ga0068860_100093188
398 Ga0068862_100049101
399 Ga0068862_100088820
400 Ga0081455_10000243
401 Ga0070717_10098232
402 Ga0075368_10319037
403 Ga0075432_10052344
404 Ga0075366_10338691
405 Ga0075428_100192221
406 Ga0075430_101090882
407 Ga0075433_10074067
408 Ga0068865_100043462
409 Ga0105240_12182442
410 Ga0111539_10399071
411 Ga0105243_11038650
412 Ga0105237_10135245
413 Ga0105238_10276546
414 Ga0157373_10076550
415 Ga0157373_10149420
416 Ga0157373_10359501
417 Ga0157371_10230330
418 Ga0157371_10246074
419 Ga0157370_10024329
420 Ga0157370_10108138
421 Ga0157370_11551473
422 Ga0157369_10017011
423 Ga0157369_10127987
424 Ga0157369_10659832
425 Ga0157369_10669085
426 Ga0163162_11397086
427 Ga0157372_10007657
428 Ga0157372_10039244
429 Ga0157372_10045185
430 Ga0157372_10116791
431 Ga0157380_10083499
432 Ga0157380_12401569
433 Ga0163161_10818358
434 Ga0197907_10364535
435 Ga0206356_10081882
436 Ga0206351_10346109
437 Ga0206354_10658246
438 Ga0206353_10569941
439 Ga0207647_10001564
440 Ga0207645_10017958
441 Ga0207643_10007700
442 Ga0207705_10000515
443 Ga0207705_10334861
444 Ga0207705_10804658
445 Ga0207707_10000042
446 Ga0207707_10000131
447 Ga0207707_10000569
448 Ga0207707_10000902
449 Ga0207707_10018534
450 Ga0207707_10346526
451 Ga0207695_10030483
452 Ga0207695_10148225
453 Ga0207695_10203053
454 Ga0207671_10055242
455 Ga0207660_10000429
456 Ga0207660_10002621
457 Ga0207660_10002733
458 Ga0207660_10176390
459 Ga0207660_10472679
460 Ga0207657_10031853
461 Ga0207657_10211825
462 Ga0207649_10003225
463 Ga0207649_10018148
464 Ga0207649_10078709
465 Ga0207649_10190354
466 Ga0207649_10194071
467 Ga0207652_10000733
468 Ga0207652_10003302
469 Ga0207652_10006544
470 Ga0207652_10045604
471 Ga0207652_10092181
472 Ga0207652_10097337
473 Ga0207652_10350509
474 Ga0207681_10125973
475 Ga0207681_10176073
476 Ga0207650_10112304
477 Ga0207644_10336579
478 Ga0207690_10002053
479 Ga0207690_10060572
480 Ga0207690_10236246
481 Ga0207706_10001080
482 Ga0207709_10324079
483 Ga0207709_10835656
484 Ga0207669_10047680
485 Ga0207704_10070871
486 Ga0207691_10006816
487 Ga0207661_10002642
488 Ga0207661_10268256
489 Ga0207679_10031081
490 Ga0207679_10094823
491 Ga0207679_10176852
492 Ga0207667_10027205
493 Ga0207667_10027786
494 Ga0207668_10037104
495 Ga0207640_10002205
496 Ga0207640_10013510
497 Ga0207640_10068592
498 Ga0207658_10202087
499 Ga0207639_10053724
500 Ga0207639_10478347
501 Ga0207678_10082378
502 Ga0207678_10090904
503 Ga0207678_10297620
504 Ga0207708_10073216
505 Ga0207708_11249919
506 Ga0207702_10004213
507 Ga0207702_10033038
508 Ga0207641_10177895
509 Ga0207641_10396059
510 Ga0207648_10003686
511 Ga0207648_10149944
512 Ga0207674_10028181
513 Ga0207674_10367958
514 Ga0207674_10590208
515 Ga0207675_100011422
516 Ga0207675_100280698
517 Ga0207683_10209474
518 Ga0207698_10179584
519 Ga0207698_10967354
520 Ga0207698_11001628
521 Ga0209970_1004774
522 Ga0210002_1000484
523 Ga0209983_1010737
524 Ga0209971_1001290
525 Ga0209966_1020649
526 Ga0209998_10000547
527 Ga0209974_10000158
528 Ga0207428_10023328
529 Ga0207428_10203190
530 Ga0268265_10067078
531 Ga0268265_10603160
532 Ga0268264_10113857
533 Ga0316182_1117619
534 Ga0265770_1000663
535 Ga0265773_1002988
536 Ga0265760_10000123
537 Ga0265332_10224912
538 Ga0265328_10016069
539 Ga0265329_10093724
540 Ga0265316_10167751
541 Ga0316575_10006174
542 Ga0307405_10447516
543 Ga0307406_10723124
544 Ga0307412_10110209
545 Ga0373926_0344437
546 Ga0316574_0036296
547 Ga0395899_0242912
548 Ga0395900_0000078
549 Ga0395900_0010067
550 Ga0395900_0130692
551 Ga0395898_0164646
552 Ga0395901_0425786
553 Ga0436365_1595885
554 Ga0436362_0206112
555 Ga0451807_1751200
556 Ga0451837_1048978
557 Ga0501032_0007252
558 Ga0501032_0113947
559 Ga0501032_0458784
560 Ga0501033_0005210
561 Ga0501033_0027244
562 Ga0501034_0003836
563 Ga0501034_0005244
564 Ga0501034_0019390
565 Ga0501034_0081172
566 Ga0501034_0273973
567 Ga0501036_0063820
568 Ga0501036_0292682
569 Ga0501036_1096388
570 Ga0501037_0082164
571 Ga0501037_0184488
572 Ga0501037_0270172
573 Ga0501038_0006500
574 Ga0501038_0178687
575 Ga0501042_0325862
576 Ga0501043_0492743
577 Ga0501043_0978995
578 Ga0501047_0001534
579 Ga0501047_0001578
580 Ga0501047_0009181
581 Ga0501047_0016480
582 Ga0501047_0024199
583 Ga0501067_0002460
584 Ga0501067_0578501
585 Ga0501068_0025316
586 Ga0501068_0352511
587 Ga0501069_0000736
588 Ga0501069_0026338
589 Ga0501069_0060812
590 Ga0501069_0140360
591 Ga0501069_0431893
592 Ga0501070_0005258
593 Ga0501070_0006656
594 Ga0501070_0011627
595 Ga0501070_0015139
596 Ga0501070_0071770
597 Ga0501070_0088846
598 Ga0501070_0112856
599 Ga0501070_0233256
600 Ga0501070_0461376
601 Ga0501070_0541484
602 Ga0501070_0649249
603 Ga0501070_0736695
604 Ga0501070_1257058
605 Ga0501071_0003215
606 Ga0501071_0889107
607 Ga0501072_0127161
608 Ga0501073_0000805
609 Ga0501073_0008698
610 Ga0501073_0041260
611 Ga0501073_0062297
612 Ga0501074_0000200
613 Ga0501074_0020542
614 Ga0501074_0027966
615 Ga0501074_0057026
616 Ga0501074_0455368
617 Ga0501079_0150092
618 Ga0501080_0032971
619 Ga0501080_0033746
620 Ga0501080_0035060
621 Ga0501080_0040211
622 Ga0501080_0182238
623 Ga0501080_0255760
624 Ga0501080_0650763
625 Ga0501083_0005354
626 Ga0501035_0003529
627 Ga0501035_0031334
628 Ga0501035_0050223
629 Ga0501044_0008611
630 Ga0501044_0009340
631 Ga0501044_0023990
632 Ga0501044_0048588
633 Ga0501044_0196120
634 Ga0501044_0442474
635 nmdc:mga03683_34941_c1
636 nmdc:mga0k408_349705_c1
637 nmdc:mga09592_5933_c1
638 nmdc:mga0qj67_40595_c1
639 nmdc:mga06r32_355321_c1
640 nmdc:mga08y16_82381_c1
641 nmdc:mga0a205_84542_c1
642 Ga0501084_0295561
643 Ga0501084_0501093
644 Ga0501082_0692384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

26

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8846 1 139
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8347 1 139
6loq-assembly1.cif.gz_A crystal structure of alpha-momorcharin in complex with camp 0.7663 60 90
3n1d-assembly1.cif.gz_A crystal structure of the complex of type i ribosome inactivating protein with ribose at 1.7a resolution 0.7625 60 90
1mom-assembly1.cif.gz_A crystal structure of momordin, a type i ribosome inactivating protein from the seeds of momordica charantia 0.7601 60 88
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7777 4 134 3.90.1590.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7616 60 90 3.40.420.10
af_Q4CKB7_124_268_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7425 60 89 2.130.10.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.742 7 105 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7374 4 134 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A422QX46-F1-model_v4 GFA family protein 0.9914 3 157 GO:0016846
GO:0046872
AF-A0A6P1T209-F1-model_v4 Aldehyde-activating protein 0.9893 7 157 GO:0016846
GO:0046872
AF-A0A534BLW2-F1-model_v4 GFA family protein 0.9893 6 127 GO:0016846
GO:0046872
AF-A0A534CBP3-F1-model_v4 GFA family protein 0.9879 6 156 GO:0016846
GO:0046872
AF-A0A0R3M6V1-F1-model_v4 Aldehyde-activating protein 0.9876 7 161 GO:0016846
GO:0046872

Map