F406316

General Info

Members Datasets Scaffolds Average Seq Length
322 205 644 336

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100077583|Ga0070674_1000775832
Length 357
Sequence MTPMMISAQFATSLQSPAHIAVAERLGYDRAWLFDTPHESPDVWMILAMAAERTTTIGLGPGVLVPTLRHPMVNASAAAALAAVAPGRVAVAFGTGFAGARALGATPASWSYLRDYVHAFRGLLSGARVSWQGTRIQMMHPDGHAPRRPIDMPLLISALGPKGVDVATKLADGLFTVNGQTRYAPQFAWAALGVHGTVLADGESLDSPRVQAAAGPGNALAYHAAYEFGGDVTALPAGDVWLDFVNQTPAQDRHLAVHDQHLVGLNQADAAAWAAGSWHAIGQTTLTGTADEICRRVGELAADGITEIIYQPTGPNITGELEAFHTAARAAVSAAAQNNTTHPGSTRRPVRDRQPHH

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0
Rhizoplane 7.14
Rhizosphere 83.85
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100077583 3300005356 Bacteria 2365
2 JGI24744J21845_10000556 3300002077 Bacteria 6730
3 JGI24034J26672_10016219 3300002239 Bacteria 1146
4 JGI24742J22300_10004876 3300002244 Bacteria 2201
5 Ga0070658_10000679 3300005327 Bacteria 29418
6 Ga0070676_10010457 3300005328 Bacteria 5037
7 Ga0070676_10030049 3300005328 Bacteria 3095
8 Ga0068869_100053032 3300005334 Bacteria 2946
9 Ga0070680_100031779 3300005336 Bacteria 4245
10 Ga0068868_100002937 3300005338 Bacteria 11827
11 Ga0070689_100006815 3300005340 Bacteria 7945
12 Ga0070691_10080291 3300005341 Bacteria 1596
13 Ga0070687_100117575 3300005343 Bacteria 1515
14 Ga0070661_100070147 3300005344 Bacteria 2577
15 Ga0070668_100001019 3300005347 Bacteria 19611
16 Ga0070668_100034576 3300005347 Bacteria 3852
17 Ga0070668_100061120 3300005347 Bacteria 2918
18 Ga0070668_100250438 3300005347 Bacteria 1470
19 Ga0070668_100268690 3300005347 Bacteria 1421
20 Ga0070669_100169989 3300005353 Bacteria 1699
21 Ga0070671_100013286 3300005355 Bacteria 6638
22 Ga0070674_100032843 3300005356 Bacteria 3449
23 Ga0070674_100424916 3300005356 Bacteria 1091
24 Ga0070659_100104863 3300005366 Bacteria 2278
25 Ga0070667_100258964 3300005367 Bacteria 1557
26 Ga0070709_10027105 3300005434 Bacteria 3404
27 Ga0070710_10008040 3300005437 Bacteria 5127
28 Ga0070701_10014456 3300005438 Bacteria 3620
29 Ga0070711_100011988 3300005439 Bacteria 5400
30 Ga0070711_100032094 3300005439 Bacteria 3490
31 Ga0070705_100042584 3300005440 Bacteria 2597
32 Ga0070700_100128400 3300005441 Bacteria 1707
33 Ga0070708_100001781 3300005445 Bacteria 16542
34 Ga0070663_100159257 3300005455 Bacteria 1737
35 Ga0070678_100011150 3300005456 Bacteria 5532
36 Ga0070678_100045360 3300005456 Bacteria 3145
37 Ga0070662_100033270 3300005457 Bacteria 3629
38 Ga0070662_100235808 3300005457 Bacteria 1465
39 Ga0068867_100005101 3300005459 Bacteria 9282
40 Ga0068867_100049921 3300005459 Bacteria 3081
41 Ga0068867_100052600 3300005459 Bacteria 3006
42 Ga0070706_100029087 3300005467 Bacteria 5090
43 Ga0070707_100008798 3300005468 Bacteria 9366
44 Ga0070707_100280911 3300005468 Bacteria 1618
45 Ga0070699_100314250 3300005518 Bacteria 1407
46 Ga0070679_100092284 3300005530 Bacteria 3016
47 Ga0070684_100042371 3300005535 Bacteria 3929
48 Ga0070697_100333472 3300005536 Bacteria 1308
49 Ga0068853_100012531 3300005539 Bacteria 6899
50 Ga0068853_100129912 3300005539 Bacteria 2254
51 Ga0068853_100332803 3300005539 Bacteria 1409
52 Ga0070672_100151199 3300005543 Bacteria 1920
53 Ga0070695_100005543 3300005545 Bacteria 7432
54 Ga0070696_100007933 3300005546 Bacteria 7087
55 Ga0070693_100049553 3300005547 Bacteria 2397
56 Ga0070665_100020000 3300005548 Bacteria 6723
57 Ga0070665_100052978 3300005548 Bacteria 4070
58 Ga0070665_100172613 3300005548 Unclassified 2163
59 Ga0070704_100031237 3300005549 Bacteria 3580
60 Ga0070704_100046792 3300005549 Bacteria 3020
61 Ga0070704_100084606 3300005549 Bacteria 2345
62 Ga0068855_100108884 3300005563 Bacteria 3182
63 Ga0068854_100000454 3300005578 Bacteria 25266
64 Ga0068854_100198288 3300005578 Bacteria 1576
65 Ga0070702_100003150 3300005615 Bacteria 7312
66 Ga0068852_100208686 3300005616 Bacteria 1852
67 Ga0068859_100001006 3300005617 Bacteria 28909
68 Ga0068859_100087380 3300005617 Bacteria 3165
69 Ga0068866_10016001 3300005718 Bacteria 3344
70 Ga0068866_10044064 3300005718 Bacteria 2230
71 Ga0068861_100010968 3300005719 Bacteria 6297
72 Ga0068861_100015594 3300005719 Bacteria 5359
73 Ga0068861_100078221 3300005719 Bacteria 2582
74 Ga0068861_100233125 3300005719 Bacteria 1562
75 Ga0068851_10160593 3300005834 Bacteria 1234
76 Ga0068858_100015502 3300005842 Bacteria 7167
77 Ga0068858_100077619 3300005842 Bacteria 3086
78 Ga0068858_100139461 3300005842 Bacteria 2275
79 Ga0068860_100326002 3300005843 Bacteria 1508
80 Ga0068860_100445679 3300005843 Bacteria 1287
81 Ga0068862_100004640 3300005844 Bacteria 11580
82 Ga0068862_100037277 3300005844 Bacteria 4121
83 Ga0081455_10022201 3300005937 Bacteria 5937
84 Ga0081455_10035096 3300005937 Bacteria 4486
85 Ga0081539_10004501 3300005985 Bacteria 15324
86 Ga0070717_10189179 3300006028 Bacteria 1798
87 Ga0075365_10007914 3300006038 Bacteria 5990
88 Ga0075365_10011844 3300006038 Bacteria 5147
89 Ga0075365_10058147 3300006038 Bacteria 2574
90 Ga0075365_10065037 3300006038 Bacteria 2444
91 Ga0075365_10117702 3300006038 Bacteria 1831
92 Ga0075364_10013592 3300006051 Bacteria 5010
93 Ga0070715_10013850 3300006163 Bacteria 2972
94 Ga0070716_100023351 3300006173 Bacteria 3279
95 Ga0070716_100031111 3300006173 Bacteria 2901
96 Ga0070712_100010292 3300006175 Bacteria 5895
97 Ga0070712_100066837 3300006175 Bacteria 2556
98 Ga0097621_100064926 3300006237 Bacteria 3003
99 Ga0075428_100001171 3300006844 Bacteria 28061
100 Ga0075428_100058878 3300006844 Bacteria 4207
101 Ga0075428_100304301 3300006844 Bacteria 1714
102 Ga0075431_100006607 3300006847 Bacteria 11523
103 Ga0075431_100059166 3300006847 Bacteria 3955
104 Ga0075429_100013838 3300006880 Bacteria 6997
105 Ga0068865_100046948 3300006881 Bacteria 2965
106 Ga0068865_100310272 3300006881 Bacteria 1266
107 Ga0097620_100001006 3300006931 Bacteria 28909
108 Ga0097620_100087380 3300006931 Bacteria 3165
109 Ga0099795_10007388 3300007788 Bacteria 3064
110 Ga0105245_10034046 3300009098 Bacteria 4516
111 Ga0105247_10012924 3300009101 Bacteria 5008
112 Ga0114129_10000201 3300009147 Bacteria 66395
113 Ga0114129_10042044 3300009147 Bacteria 6436
114 Ga0114129_10158591 3300009147 Bacteria 3093
115 Ga0105243_10052160 3300009148 Bacteria 3239
116 Ga0105241_10140706 3300009174 Bacteria 1964
117 Ga0105242_10005523 3300009176 Bacteria 9760
118 Ga0105248_10300944 3300009177 Bacteria 1806
119 Ga0105237_10010044 3300009545 Bacteria 10097
120 Ga0105237_10034920 3300009545 Bacteria 5088
121 Ga0105237_10065304 3300009545 Bacteria 3635
122 Ga0105238_10174824 3300009551 Bacteria 2124
123 Ga0105249_10007309 3300009553 Bacteria 9629
124 Ga0105249_10115686 3300009553 Bacteria 2541
125 Ga0105249_10160306 3300009553 Bacteria 2173
126 Ga0105239_10003799 3300010375 Bacteria 18386
127 Ga0105239_10035812 3300010375 Bacteria 5449
128 Ga0105239_10092588 3300010375 Bacteria 3337
129 Ga0157369_10044018 3300013105 Bacteria 4862
130 Ga0157369_10918819 3300013105 Bacteria 897
131 Ga0157374_10117671 3300013296 Bacteria 2562
132 Ga0157378_10028434 3300013297 Bacteria 4933
133 Ga0163162_10098091 3300013306 Bacteria 3019
134 Ga0163162_10285558 3300013306 Bacteria 1782
135 Ga0157372_10294292 3300013307 Bacteria 1888
136 Ga0157375_10001679 3300013308 Bacteria 19058
137 Ga0157375_10031514 3300013308 Bacteria 5013
138 Ga0157375_10045236 3300013308 Bacteria 4284
139 Ga0157380_10000781 3300014326 Bacteria 19947
140 Ga0157377_10009666 3300014745 Bacteria 4743
141 Ga0157379_10123994 3300014968 Bacteria 2324
142 Ga0157376_10299295 3300014969 Bacteria 1522
143 Ga0163161_10006126 3300017792 Bacteria 8334
144 Ga0206354_11504306 3300020081 Bacteria 2435
145 Ga0213874_10000606 3300021377 Bacteria 7221
146 Ga0213876_10012482 3300021384 Bacteria 4523
147 Ga0213875_10012751 3300021388 Bacteria 4140
148 Ga0224712_10005562 3300022467 Bacteria 3522
149 Ga0207642_10003707 3300025899 Bacteria 4858
150 Ga0207642_10107965 3300025899 Bacteria 1411
151 Ga0207688_10006243 3300025901 Bacteria 6484
152 Ga0207688_10064386 3300025901 Bacteria 2070
153 Ga0207680_10051982 3300025903 Bacteria 2453
154 Ga0207699_10065077 3300025906 Bacteria 2208
155 Ga0207699_10105944 3300025906 Bacteria 1794
156 Ga0207684_10094178 3300025910 Bacteria 2554
157 Ga0207671_10015991 3300025914 Bacteria 5848
158 Ga0207693_10000552 3300025915 Bacteria 33795
159 Ga0207693_10004324 3300025915 Bacteria 12022
160 Ga0207693_10094649 3300025915 Bacteria 2341
161 Ga0207663_10219912 3300025916 Bacteria 1381
162 Ga0207660_10109166 3300025917 Bacteria 2079
163 Ga0207657_10041595 3300025919 Bacteria 4063
164 Ga0207657_10050758 3300025919 Bacteria 3608
165 Ga0207652_10122606 3300025921 Bacteria 2313
166 Ga0207646_10019516 3300025922 Bacteria 6299
167 Ga0207681_10124727 3300025923 Bacteria 1894
168 Ga0207687_10066118 3300025927 Bacteria 2569
169 Ga0207687_10075977 3300025927 Bacteria 2412
170 Ga0207687_10089989 3300025927 Bacteria 2236
171 Ga0207687_10099325 3300025927 Bacteria 2139
172 Ga0207706_10005520 3300025933 Bacteria 11793
173 Ga0207706_10096669 3300025933 Bacteria 2597
174 Ga0207686_10006532 3300025934 Bacteria 6280
175 Ga0207709_10024331 3300025935 Bacteria 3457
176 Ga0207670_10010823 3300025936 Bacteria 5263
177 Ga0207670_10120613 3300025936 Bacteria 1905
178 Ga0207669_10158204 3300025937 Bacteria 1596
179 Ga0207669_10199426 3300025937 Bacteria 1451
180 Ga0207665_10001442 3300025939 Bacteria 15991
181 Ga0207665_10003123 3300025939 Bacteria 11109
182 Ga0207691_10147102 3300025940 Bacteria 2073
183 Ga0207661_10089560 3300025944 Bacteria 2560
184 Ga0207661_10271465 3300025944 Bacteria 1513
185 Ga0207679_10109718 3300025945 Bacteria 2175
186 Ga0207679_10319080 3300025945 Bacteria 1345
187 Ga0207712_10087483 3300025961 Bacteria 2285
188 Ga0207712_10420359 3300025961 Unclassified 1128
189 Ga0207668_10089911 3300025972 Bacteria 2252
190 Ga0207668_10173258 3300025972 Bacteria 1694
191 Ga0207668_10264250 3300025972 Bacteria 1404
192 Ga0207640_10010288 3300025981 Bacteria 5264
193 Ga0207640_10101553 3300025981 Bacteria 2018
194 Ga0207658_10170669 3300025986 Bacteria 1792
195 Ga0207677_10209592 3300026023 Bacteria 1555
196 Ga0207703_10071503 3300026035 Bacteria 2866
197 Ga0207703_10098238 3300026035 Bacteria 2476
198 Ga0207639_10036844 3300026041 Bacteria 3628
199 Ga0207678_10011048 3300026067 Bacteria 7932
200 Ga0207708_10008278 3300026075 Bacteria 7703
201 Ga0207708_10129757 3300026075 Bacteria 1970
202 Ga0207708_10225277 3300026075 Bacteria 1504
203 Ga0207702_10019462 3300026078 Bacteria 5617
204 Ga0207648_10006222 3300026089 Bacteria 11889
205 Ga0207675_100001898 3300026118 Bacteria 20884
206 Ga0207675_100268236 3300026118 Bacteria 1656
207 Ga0207683_10000761 3300026121 Bacteria 29280
208 Ga0207683_10028576 3300026121 Bacteria 4823
209 Ga0207683_10103920 3300026121 Bacteria 2538
210 Ga0268266_10151280 3300028379 Bacteria 2092
211 Ga0268265_10043609 3300028380 Bacteria 3336
212 Ga0268265_10173043 3300028380 Bacteria 1847
213 Ga0268264_10041004 3300028381 Bacteria 3826
214 Ga0268264_10074937 3300028381 Bacteria 2876
215 Ga0307511_10000176 3300030521 Bacteria 62985
216 Ga0307513_10000742 3300031456 Bacteria 46923
217 Ga0307513_10141375 3300031456 Bacteria 2333
218 Ga0307405_10024817 3300031731 Bacteria 3432
219 Ga0307413_10041461 3300031824 Bacteria 2696
220 Ga0307406_10045646 3300031901 Bacteria 2752
221 Ga0307406_10073620 3300031901 Bacteria 2247
222 Ga0307407_10030492 3300031903 Bacteria 2910
223 Ga0307409_100054242 3300031995 Bacteria 3086
224 Ga0307409_100522090 3300031995 Bacteria 1160
225 Ga0307416_100010325 3300032002 Bacteria 6163
226 Ga0307414_10334608 3300032004 Bacteria 1294
227 Ga0307415_100161021 3300032126 Bacteria 1739
228 Ga0373931_0026074 3300035691 Bacteria 2971
229 Ga0373931_0062728 3300035691 Bacteria 2007
230 Ga0436365_0700388 3300039437 Bacteria 19437
231 Ga0436361_1208810 3300039447 Bacteria 1806
232 Ga0436363_0236693 3300039450 Unclassified 2455
233 Ga0436363_0357411 3300039450 Bacteria 40060
234 Ga0436363_1125928 3300039450 Bacteria 1128
235 Ga0436363_1175990 3300039450 Bacteria 1929
236 Ga0436362_1038588 3300039453 Bacteria 2488
237 Ga0436362_1165336 3300039453 Bacteria 1500
238 Ga0436362_1292633 3300039453 Bacteria 2008
239 Ga0466969_0034981 3300044656 Bacteria 2544
240 Ga0466965_0138944 3300044683 Bacteria 1264
241 Ga0466966_0016421 3300044684 Bacteria 4892
242 Ga0466966_0024643 3300044684 Bacteria 3935
243 Ga0466961_0175048 3300044693 Bacteria 1334
244 Ga0466963_0043623 3300044694 Bacteria 2950
245 Ga0466963_0052913 3300044694 Bacteria 2695
246 Ga0466963_0087078 3300044694 Bacteria 2123
247 Ga0466963_0132033 3300044694 Bacteria 1726
248 Ga0466963_0416443 3300044694 Bacteria 948
249 Ga0466964_0134937 3300044706 Bacteria 1128
250 Ga0466968_0004062 3300044735 Bacteria 5441
251 Ga0466970_0020784 3300044765 Bacteria 3415
252 Ga0466957_0017884 3300044842 Bacteria 4159
253 Ga0466957_0058325 3300044842 Bacteria 2365
254 Ga0466957_0119095 3300044842 Bacteria 1682
255 Ga0466960_0043218 3300044901 Bacteria 2142
256 Ga0466959_0242829 3300045049 Bacteria 1243
257 Ga0466958_0010014 3300045836 Bacteria 5296
258 Ga0466958_0141077 3300045836 Bacteria 1517
259 Ga0466958_0165057 3300045836 Bacteria 1401
260 Ga0466967_0000842 3300045976 Bacteria 16214
261 Ga0466967_0019758 3300045976 Bacteria 5425
262 Ga0466967_0058233 3300045976 Bacteria 3414
263 Ga0466967_0082789 3300045976 Bacteria 2901
264 Ga0466967_0127472 3300045976 Bacteria 2359
265 Ga0466967_0231221 3300045976 Bacteria 1760
266 Ga0466967_0330095 3300045976 Bacteria 1473
267 Ga0495583_0038957 3300046506 Bacteria 2242
268 Ga0495606_0017152 3300046507 Bacteria 5488
269 Ga0495618_0175047 3300046514 Bacteria 1365
270 Ga0495648_0006723 3300046524 Bacteria 9302
271 Ga0495667_0076981 3300046559 Bacteria 2170
272 Ga0495657_0246715 3300046675 Bacteria 1076
273 Ga0495672_0000819 3300047320 Bacteria 33438
274 Ga0495673_0000817 3300047469 Bacteria 29236
275 Ga0496100_0031346 3300048903 Bacteria 3305
276 Ga0496100_0165298 3300048903 Bacteria 1589
277 Ga0496101_0000019 3300048904 Bacteria 220382
278 Ga0496102_0000007 3300048905 Bacteria 417224
279 Ga0496102_0019780 3300048905 Bacteria 5934
280 Ga0496102_0051146 3300048905 Bacteria 3764
281 Ga0496102_0118923 3300048905 Bacteria 2467
282 Ga0496102_0130078 3300048905 Bacteria 2355
283 Ga0496103_0000013 3300048906 Bacteria 297928
284 Ga0496103_0057048 3300048906 Bacteria 2424
285 Ga0496103_0098902 3300048906 Bacteria 1845
286 Ga0496105_0048247 3300048908 Bacteria 3515
287 Ga0496106_0016017 3300048909 Bacteria 5544
288 Ga0496107_0021457 3300048910 Bacteria 4564
289 Ga0496107_0047330 3300048910 Bacteria 3097
290 Ga0496108_0012183 3300048911 Bacteria 6992
291 Ga0496109_0016601 3300048912 Bacteria 6439
292 Ga0496109_0279203 3300048912 Bacteria 1574
293 Ga0496110_0207913 3300048913 Bacteria 1779
294 Ga0496110_0389822 3300048913 Bacteria 1270
295 Ga0496112_0214397 3300048915 Bacteria 1882
296 Ga0496114_0170470 3300048917 Bacteria 1896
297 Ga0496115_0044839 3300048918 Bacteria 3529
298 Ga0496116_0000033 3300048919 Bacteria 418191
299 Ga0496117_0000025 3300048920 Bacteria 418106
300 Ga0496118_0000023 3300048921 Bacteria 418106
301 Ga0496120_0070660 3300048923 Bacteria 1919
302 Ga0496121_0000039 3300048924 Bacteria 351444
303 Ga0496126_0000689 3300048929 Bacteria 61852
304 Ga0501032_0000434 3300049569 Bacteria 34423
305 Ga0501034_0207000 3300049571 Bacteria 1918
306 Ga0501037_0000602 3300049573 Bacteria 28080
307 Ga0501038_0000030 3300049574 Bacteria 132455
308 Ga0501039_0000128 3300049575 Bacteria 52738
309 Ga0501043_0000958 3300049579 Bacteria 25584
310 Ga0501070_0000369 3300049586 Bacteria 40971
311 Ga0501073_0062657 3300049589 Bacteria 2594
312 nmdc:mga00v17_6637_c1 3300050491 Bacteria 6144
313 nmdc:mga0yw44_26149_c1 3300050492 Bacteria 3330
314 nmdc:mga0yw44_8871_c1 3300050492 Bacteria 5039
315 nmdc:mga05p37_10570_c1 3300050507 Bacteria 10944
316 nmdc:mga05p37_282953_c1 3300050507 Bacteria 1977
317 nmdc:mga09592_156600_c1 3300050508 Bacteria 1967
318 nmdc:mga06r32_33420_c1 3300050510 Bacteria 4844
319 nmdc:mga06r32_43793_c1 3300050510 Bacteria 4259
320 Ga0500643_004315 3300053087 Bacteria 6484
321 Ga0500644_0012340 3300053088 Bacteria 2360
322 Ga0500641_0028915 3300053096 Bacteria 2168
323 Ga0070674_100077583
324 JGI24744J21845_10000556
325 JGI24034J26672_10016219
326 JGI24742J22300_10004876
327 Ga0070658_10000679
328 Ga0070676_10010457
329 Ga0070676_10030049
330 Ga0068869_100053032
331 Ga0070680_100031779
332 Ga0068868_100002937
333 Ga0070689_100006815
334 Ga0070691_10080291
335 Ga0070687_100117575
336 Ga0070661_100070147
337 Ga0070668_100001019
338 Ga0070668_100034576
339 Ga0070668_100061120
340 Ga0070668_100250438
341 Ga0070668_100268690
342 Ga0070669_100169989
343 Ga0070671_100013286
344 Ga0070674_100032843
345 Ga0070674_100424916
346 Ga0070659_100104863
347 Ga0070667_100258964
348 Ga0070709_10027105
349 Ga0070710_10008040
350 Ga0070701_10014456
351 Ga0070711_100011988
352 Ga0070711_100032094
353 Ga0070705_100042584
354 Ga0070700_100128400
355 Ga0070708_100001781
356 Ga0070663_100159257
357 Ga0070678_100011150
358 Ga0070678_100045360
359 Ga0070662_100033270
360 Ga0070662_100235808
361 Ga0068867_100005101
362 Ga0068867_100049921
363 Ga0068867_100052600
364 Ga0070706_100029087
365 Ga0070707_100008798
366 Ga0070707_100280911
367 Ga0070699_100314250
368 Ga0070679_100092284
369 Ga0070684_100042371
370 Ga0070697_100333472
371 Ga0068853_100012531
372 Ga0068853_100129912
373 Ga0068853_100332803
374 Ga0070672_100151199
375 Ga0070695_100005543
376 Ga0070696_100007933
377 Ga0070693_100049553
378 Ga0070665_100020000
379 Ga0070665_100052978
380 Ga0070665_100172613
381 Ga0070704_100031237
382 Ga0070704_100046792
383 Ga0070704_100084606
384 Ga0068855_100108884
385 Ga0068854_100000454
386 Ga0068854_100198288
387 Ga0070702_100003150
388 Ga0068852_100208686
389 Ga0068859_100001006
390 Ga0068859_100087380
391 Ga0068866_10016001
392 Ga0068866_10044064
393 Ga0068861_100010968
394 Ga0068861_100015594
395 Ga0068861_100078221
396 Ga0068861_100233125
397 Ga0068851_10160593
398 Ga0068858_100015502
399 Ga0068858_100077619
400 Ga0068858_100139461
401 Ga0068860_100326002
402 Ga0068860_100445679
403 Ga0068862_100004640
404 Ga0068862_100037277
405 Ga0081455_10022201
406 Ga0081455_10035096
407 Ga0081539_10004501
408 Ga0070717_10189179
409 Ga0075365_10007914
410 Ga0075365_10011844
411 Ga0075365_10058147
412 Ga0075365_10065037
413 Ga0075365_10117702
414 Ga0075364_10013592
415 Ga0070715_10013850
416 Ga0070716_100023351
417 Ga0070716_100031111
418 Ga0070712_100010292
419 Ga0070712_100066837
420 Ga0097621_100064926
421 Ga0075428_100001171
422 Ga0075428_100058878
423 Ga0075428_100304301
424 Ga0075431_100006607
425 Ga0075431_100059166
426 Ga0075429_100013838
427 Ga0068865_100046948
428 Ga0068865_100310272
429 Ga0097620_100001006
430 Ga0097620_100087380
431 Ga0099795_10007388
432 Ga0105245_10034046
433 Ga0105247_10012924
434 Ga0114129_10000201
435 Ga0114129_10042044
436 Ga0114129_10158591
437 Ga0105243_10052160
438 Ga0105241_10140706
439 Ga0105242_10005523
440 Ga0105248_10300944
441 Ga0105237_10010044
442 Ga0105237_10034920
443 Ga0105237_10065304
444 Ga0105238_10174824
445 Ga0105249_10007309
446 Ga0105249_10115686
447 Ga0105249_10160306
448 Ga0105239_10003799
449 Ga0105239_10035812
450 Ga0105239_10092588
451 Ga0157369_10044018
452 Ga0157369_10918819
453 Ga0157374_10117671
454 Ga0157378_10028434
455 Ga0163162_10098091
456 Ga0163162_10285558
457 Ga0157372_10294292
458 Ga0157375_10001679
459 Ga0157375_10031514
460 Ga0157375_10045236
461 Ga0157380_10000781
462 Ga0157377_10009666
463 Ga0157379_10123994
464 Ga0157376_10299295
465 Ga0163161_10006126
466 Ga0206354_11504306
467 Ga0213874_10000606
468 Ga0213876_10012482
469 Ga0213875_10012751
470 Ga0224712_10005562
471 Ga0207642_10003707
472 Ga0207642_10107965
473 Ga0207688_10006243
474 Ga0207688_10064386
475 Ga0207680_10051982
476 Ga0207699_10065077
477 Ga0207699_10105944
478 Ga0207684_10094178
479 Ga0207671_10015991
480 Ga0207693_10000552
481 Ga0207693_10004324
482 Ga0207693_10094649
483 Ga0207663_10219912
484 Ga0207660_10109166
485 Ga0207657_10041595
486 Ga0207657_10050758
487 Ga0207652_10122606
488 Ga0207646_10019516
489 Ga0207681_10124727
490 Ga0207687_10066118
491 Ga0207687_10075977
492 Ga0207687_10089989
493 Ga0207687_10099325
494 Ga0207706_10005520
495 Ga0207706_10096669
496 Ga0207686_10006532
497 Ga0207709_10024331
498 Ga0207670_10010823
499 Ga0207670_10120613
500 Ga0207669_10158204
501 Ga0207669_10199426
502 Ga0207665_10001442
503 Ga0207665_10003123
504 Ga0207691_10147102
505 Ga0207661_10089560
506 Ga0207661_10271465
507 Ga0207679_10109718
508 Ga0207679_10319080
509 Ga0207712_10087483
510 Ga0207712_10420359
511 Ga0207668_10089911
512 Ga0207668_10173258
513 Ga0207668_10264250
514 Ga0207640_10010288
515 Ga0207640_10101553
516 Ga0207658_10170669
517 Ga0207677_10209592
518 Ga0207703_10071503
519 Ga0207703_10098238
520 Ga0207639_10036844
521 Ga0207678_10011048
522 Ga0207708_10008278
523 Ga0207708_10129757
524 Ga0207708_10225277
525 Ga0207702_10019462
526 Ga0207648_10006222
527 Ga0207675_100001898
528 Ga0207675_100268236
529 Ga0207683_10000761
530 Ga0207683_10028576
531 Ga0207683_10103920
532 Ga0268266_10151280
533 Ga0268265_10043609
534 Ga0268265_10173043
535 Ga0268264_10041004
536 Ga0268264_10074937
537 Ga0307511_10000176
538 Ga0307513_10000742
539 Ga0307513_10141375
540 Ga0307405_10024817
541 Ga0307413_10041461
542 Ga0307406_10045646
543 Ga0307406_10073620
544 Ga0307407_10030492
545 Ga0307409_100054242
546 Ga0307409_100522090
547 Ga0307416_100010325
548 Ga0307414_10334608
549 Ga0307415_100161021
550 Ga0373931_0026074
551 Ga0373931_0062728
552 Ga0436365_0700388
553 Ga0436361_1208810
554 Ga0436363_0236693
555 Ga0436363_0357411
556 Ga0436363_1125928
557 Ga0436363_1175990
558 Ga0436362_1038588
559 Ga0436362_1165336
560 Ga0436362_1292633
561 Ga0466969_0034981
562 Ga0466965_0138944
563 Ga0466966_0016421
564 Ga0466966_0024643
565 Ga0466961_0175048
566 Ga0466963_0043623
567 Ga0466963_0052913
568 Ga0466963_0087078
569 Ga0466963_0132033
570 Ga0466963_0416443
571 Ga0466964_0134937
572 Ga0466968_0004062
573 Ga0466970_0020784
574 Ga0466957_0017884
575 Ga0466957_0058325
576 Ga0466957_0119095
577 Ga0466960_0043218
578 Ga0466959_0242829
579 Ga0466958_0010014
580 Ga0466958_0141077
581 Ga0466958_0165057
582 Ga0466967_0000842
583 Ga0466967_0019758
584 Ga0466967_0058233
585 Ga0466967_0082789
586 Ga0466967_0127472
587 Ga0466967_0231221
588 Ga0466967_0330095
589 Ga0495583_0038957
590 Ga0495606_0017152
591 Ga0495618_0175047
592 Ga0495648_0006723
593 Ga0495667_0076981
594 Ga0495657_0246715
595 Ga0495672_0000819
596 Ga0495673_0000817
597 Ga0496100_0031346
598 Ga0496100_0165298
599 Ga0496101_0000019
600 Ga0496102_0000007
601 Ga0496102_0019780
602 Ga0496102_0051146
603 Ga0496102_0118923
604 Ga0496102_0130078
605 Ga0496103_0000013
606 Ga0496103_0057048
607 Ga0496103_0098902
608 Ga0496105_0048247
609 Ga0496106_0016017
610 Ga0496107_0021457
611 Ga0496107_0047330
612 Ga0496108_0012183
613 Ga0496109_0016601
614 Ga0496109_0279203
615 Ga0496110_0207913
616 Ga0496110_0389822
617 Ga0496112_0214397
618 Ga0496114_0170470
619 Ga0496115_0044839
620 Ga0496116_0000033
621 Ga0496117_0000025
622 Ga0496118_0000023
623 Ga0496120_0070660
624 Ga0496121_0000039
625 Ga0496126_0000689
626 Ga0501032_0000434
627 Ga0501034_0207000
628 Ga0501037_0000602
629 Ga0501038_0000030
630 Ga0501039_0000128
631 Ga0501043_0000958
632 Ga0501070_0000369
633 Ga0501073_0062657
634 nmdc:mga00v17_6637_c1
635 nmdc:mga0yw44_26149_c1
636 nmdc:mga0yw44_8871_c1
637 nmdc:mga05p37_10570_c1
638 nmdc:mga05p37_282953_c1
639 nmdc:mga09592_156600_c1
640 nmdc:mga06r32_33420_c1
641 nmdc:mga06r32_43793_c1
642 Ga0500643_004315
643 Ga0500644_0012340
644 Ga0500641_0028915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

15

307

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.7317 1 326
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.7275 1 326
4dqw-assembly1.cif.gz_A crystal structure analysis of pa3770 0.727 1 164
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.7077 1 326
4x3z-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp and nad 0.7076 1 119
ID Description Score Start End Superfamily
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7077 1 326 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7023 13 320 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6808 1 329 3.20.20.30
6mgrC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6802 4 117 3.20.20.70
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6755 2 323 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1E7KI67-F1-model_v4 Methylene-tetrahydromethanopterin reductase 0.9916 1 325 GO:0016705
AF-A0A4U0S0S4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.991 1 326 GO:0016705
AF-A0A3C0E9G9-F1-model_v4 Methylene-tetrahydromethanopterin reductase 0.9803 1 88 GO:0016705
AF-A0A1Q8CV21-F1-model_v4 Methylene-tetrahydromethanopterin reductase 0.978 1 219 GO:0016705
AF-A0A1E7KI67-F1-model_v4 Methylene-tetrahydromethanopterin reductase 0.9767 1 325 GO:0016705

Map