F406282

General Info

Members Datasets Scaffolds Average Seq Length
322 234 644 272

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10310793|Ga0070658_103107932
Length 307
Sequence VGSRPSPSADLADRPGPEVNSGASVWHRYGVLRLAGARLLDDRDRGAVRVVLDADPVATCMVAARVELAGLDPWRLGGEMWAFGSRLDGLCFSGANLVPLHGGKQALRSFADRARRHGRGCSSIVGRAELVLPLWHDLSGHWTRPREVRADQPLMVLGGRPEIAPDPQVRPVRIEELDRYLPAAVAMFTEEVGVDPRLGDGGVGYRARVAELVQAGRAFARFEGDEVIYKAEIGALSRQVGQIQGVWVHPEHRGRGLGTIGTAAVTDRLAAMGRVSSLYVNGFNTVARRAYTRIGFRQAGSFATILF

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
103 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
110 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2508501039 Frankia saprophytica CN3 Isolate Nodule
188 2517572101 Frankia sp. DC12 Isolate Nodule
189 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
190 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
191 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
192 2671180195 Frankia sp. CcI49 Isolate Nodule
193 2687453737 Frankia sp. BMG5.36 Isolate Nodule
194 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
195 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
196 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
197 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
198 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
199 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
200 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
201 2773857922 Frankia sp. CcI49 Isolate Nodule
202 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
203 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
204 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
205 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
206 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
207 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
208 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
209 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
210 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
211 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
212 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
213 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
214 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
215 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
216 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
217 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
218 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
219 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
220 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
221 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
222 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
223 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
224 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
225 2922554459 Rhodococcus sp. 66b Isolate Unclassified
226 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
227 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
228 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
229 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
230 8002775197 Frankia nepalensis CN7 Isolate Nodule
231 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
232 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
233 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
234 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.47
Metatranscriptomes 0.62
Isolates 14.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 1.86
Rhizoplane 6.21
Rhizosphere 69.88
Stem 0
Stem Tuber 0.31
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10310793 3300005327 Bacteria 1345
2 JGI25406J46586_10000375 3300003203 Bacteria 20445
3 rootL2_10098970 3300003322 Bacteria 2219
4 JGI25405J52794_10024237 3300003911 Bacteria 1238
5 Ga0070682_100087594 3300005337 Bacteria 2030
6 Ga0070689_100196325 3300005340 Bacteria 1645
7 Ga0070668_100008519 3300005347 Bacteria 7617
8 Ga0070675_100058014 3300005354 Bacteria 3192
9 Ga0070674_100056818 3300005356 Bacteria 2714
10 Ga0070714_100023344 3300005435 Bacteria 5080
11 Ga0070714_100336854 3300005435 Bacteria 1414
12 Ga0070714_100484491 3300005435 Bacteria 1178
13 Ga0070713_100264728 3300005436 Bacteria 1572
14 Ga0070710_10000147 3300005437 Bacteria 32534
15 Ga0070700_100080671 3300005441 Bacteria 2100
16 Ga0070663_100066485 3300005455 Bacteria 2612
17 Ga0070678_100281475 3300005456 Bacteria 1407
18 Ga0070662_100145016 3300005457 Bacteria 1844
19 Ga0070681_10640022 3300005458 Bacteria 978
20 Ga0070685_10028511 3300005466 Bacteria 3093
21 Ga0070685_10227197 3300005466 Bacteria 1226
22 Ga0068853_100045156 3300005539 Bacteria 3773
23 Ga0068853_100284822 3300005539 Bacteria 1524
24 Ga0070693_100014591 3300005547 Bacteria 4029
25 Ga0070665_100116675 3300005548 Bacteria 2672
26 Ga0070665_100289492 3300005548 Bacteria 1640
27 Ga0070665_100481424 3300005548 Bacteria 1252
28 Ga0070665_100655306 3300005548 Bacteria 1063
29 Ga0068857_100359980 3300005577 Bacteria 1348
30 Ga0068856_100389343 3300005614 Bacteria 1413
31 Ga0068852_100209523 3300005616 Bacteria 1848
32 Ga0068859_100427576 3300005617 Bacteria 1421
33 Ga0068866_10017627 3300005718 Bacteria 3215
34 Ga0068861_100214094 3300005719 Bacteria 1625
35 Ga0068863_100005727 3300005841 Bacteria 12194
36 Ga0068858_100000002 3300005842 Bacteria 351633
37 Ga0068858_100099506 3300005842 Bacteria 2711
38 Ga0068862_100000110 3300005844 Bacteria 97889
39 Ga0068862_100294004 3300005844 Bacteria 1493
40 Ga0081455_10000011 3300005937 Bacteria 203132
41 Ga0081455_10000722 3300005937 Bacteria 42847
42 Ga0081539_10000102 3300005985 Bacteria 198297
43 Ga0070717_10168843 3300006028 Bacteria 1902
44 Ga0075364_10038935 3300006051 Bacteria 3081
45 Ga0075364_10139253 3300006051 Bacteria 1631
46 Ga0075370_10012967 3300006353 Bacteria 4420
47 Ga0075370_10039575 3300006353 Bacteria 2657
48 Ga0075370_10093790 3300006353 Bacteria 1733
49 Ga0075430_100424734 3300006846 Bacteria 1097
50 Ga0097620_100000322 3300006931 Bacteria 47705
51 Ga0097620_100427599 3300006931 Bacteria 1421
52 Ga0111539_10064196 3300009094 Bacteria 4345
53 Ga0105245_10033826 3300009098 Bacteria 4530
54 Ga0105245_10508468 3300009098 Bacteria 1222
55 Ga0105247_10005737 3300009101 Bacteria 7772
56 Ga0105243_10011429 3300009148 Bacteria 6719
57 Ga0105248_10000038 3300009177 Bacteria 179916
58 Ga0105248_10002460 3300009177 Bacteria 20584
59 Ga0105237_10250340 3300009545 Bacteria 1774
60 Ga0105237_10758398 3300009545 Bacteria 977
61 Ga0105238_10031751 3300009551 Bacteria 5374
62 Ga0105238_10153883 3300009551 Bacteria 2274
63 Ga0105249_10001550 3300009553 Bacteria 20173
64 Ga0105249_10233403 3300009553 Bacteria 1815
65 Ga0105249_10634903 3300009553 Bacteria 1125
66 Ga0105035_104099 3300009988 Bacteria 1149
67 Ga0105239_10236516 3300010375 Bacteria 2050
68 Ga0157371_10099137 3300013102 Bacteria 2066
69 Ga0157369_10016463 3300013105 Bacteria 8315
70 Ga0157369_10249729 3300013105 Bacteria 1852
71 Ga0157374_10266083 3300013296 Bacteria 1690
72 Ga0157378_10471745 3300013297 Bacteria 1249
73 Ga0163162_10306682 3300013306 Bacteria 1720
74 Ga0157372_10084122 3300013307 Bacteria 3605
75 Ga0157372_10518123 3300013307 Bacteria 1390
76 Ga0157375_10112416 3300013308 Bacteria 2824
77 Ga0157515_112488 3300013875 Bacteria 1224
78 Ga0163163_10150439 3300014325 Bacteria 2372
79 Ga0157380_10112104 3300014326 Bacteria 2294
80 Ga0157379_10000007 3300014968 Bacteria 142402
81 Ga0157379_10006909 3300014968 Bacteria 9816
82 Ga0157379_10147605 3300014968 Bacteria 2121
83 Ga0206353_10191711 3300020082 Bacteria 1283
84 Ga0213873_10000372 3300021358 Bacteria 7398
85 Ga0213876_10020901 3300021384 Bacteria 3461
86 Ga0213875_10006141 3300021388 Bacteria 6345
87 Ga0224712_10299586 3300022467 Bacteria 752
88 Ga0207656_10079810 3300025321 Bacteria 1468
89 Ga0207656_10099685 3300025321 Bacteria 1330
90 Ga0207692_10002066 3300025898 Bacteria 7670
91 Ga0207642_10178946 3300025899 Bacteria 1154
92 Ga0207710_10000020 3300025900 Bacteria 338425
93 Ga0207645_10053423 3300025907 Bacteria 2582
94 Ga0207643_10011289 3300025908 Bacteria 4825
95 Ga0207643_10094798 3300025908 Bacteria 1744
96 Ga0207654_10197723 3300025911 Bacteria 1322
97 Ga0207693_10361681 3300025915 Bacteria 1135
98 Ga0207662_10057378 3300025918 Bacteria 2327
99 Ga0207657_10010752 3300025919 Bacteria 9112
100 Ga0207694_10018007 3300025924 Bacteria 5339
101 Ga0207687_10018880 3300025927 Bacteria 4559
102 Ga0207687_10391966 3300025927 Bacteria 1140
103 Ga0207700_10260186 3300025928 Bacteria 1486
104 Ga0207664_10004460 3300025929 Bacteria 9480
105 Ga0207709_10004254 3300025935 Bacteria 8295
106 Ga0207670_10481227 3300025936 Bacteria 1005
107 Ga0207669_10068890 3300025937 Bacteria 2212
108 Ga0207704_10144015 3300025938 Bacteria 1671
109 Ga0207691_10045127 3300025940 Bacteria 4053
110 Ga0207711_10000152 3300025941 Bacteria 73929
111 Ga0207711_10004613 3300025941 Bacteria 11719
112 Ga0207689_10038403 3300025942 Bacteria 3966
113 Ga0207679_10497665 3300025945 Bacteria 1087
114 Ga0207712_10052902 3300025961 Bacteria 2846
115 Ga0207712_10077220 3300025961 Bacteria 2413
116 Ga0207668_10005580 3300025972 Bacteria 7417
117 Ga0207668_10163680 3300025972 Bacteria 1736
118 Ga0207668_10399440 3300025972 Bacteria 1162
119 Ga0207640_10175491 3300025981 Bacteria 1601
120 Ga0207703_10000001 3300026035 Bacteria 822925
121 Ga0207703_10000006 3300026035 Bacteria 502351
122 Ga0207703_10089222 3300026035 Bacteria 2589
123 Ga0207678_10001421 3300026067 Bacteria 21950
124 Ga0207678_10128229 3300026067 Bacteria 2164
125 Ga0207641_10010043 3300026088 Bacteria 7785
126 Ga0207674_10100443 3300026116 Bacteria 2875
127 Ga0207675_100062314 3300026118 Bacteria 3483
128 Ga0207683_10056902 3300026121 Bacteria 3432
129 Ga0207683_10414559 3300026121 Bacteria 1240
130 Ga0207698_10033960 3300026142 Bacteria 3712
131 Ga0207698_10090709 3300026142 Bacteria 2500
132 Ga0207698_10156090 3300026142 Bacteria 1988
133 Ga0207428_10321978 3300027907 Bacteria 1142
134 Ga0268265_10000019 3300028380 Bacteria 285487
135 Ga0268265_10244034 3300028380 Bacteria 1587
136 Ga0268264_10051511 3300028381 Bacteria 3430
137 Ga0307515_10078002 3300028794 Bacteria 4365
138 Ga0307515_10087176 3300028794 Bacteria 3967
139 Ga0307511_10043126 3300030521 Bacteria 3775
140 Ga0307511_10162126 3300030521 Bacteria 1252
141 Ga0307512_10006439 3300030522 Bacteria 11894
142 Ga0316177_1055133 3300030731 Bacteria 3751
143 Ga0316176_1227832 3300030732 Bacteria 5077
144 Ga0314311_1212459 3300030733 Bacteria 4080
145 Ga0316180_1140003 3300030736 Bacteria 1541
146 Ga0307509_10095756 3300031507 Bacteria 3023
147 Ga0307508_10112278 3300031616 Bacteria 2325
148 Ga0307413_10000723 3300031824 Bacteria 11349
149 Ga0307518_10000403 3300031838 Bacteria 33266
150 Ga0307518_10068331 3300031838 Bacteria 2575
151 Ga0326468_10003338 3300031889 Bacteria 1359
152 Ga0307409_100166981 3300031995 Bacteria 1932
153 Ga0307409_100895468 3300031995 Bacteria 901
154 Ga0307411_10144759 3300032005 Bacteria 1757
155 Ga0307415_100334894 3300032126 Bacteria 1268
156 Ga0307507_10008211 3300033179 Bacteria 14596
157 Ga0373956_0000712 3300035119 Bacteria 13688
158 Ga0373931_0031264 3300035691 Bacteria 2747
159 Ga0373925_0359048 3300037068 Bacteria 1184
160 Ga0436364_0587812 3300037853 Bacteria 2108
161 Ga0436364_0624094 3300037853 Bacteria 124588
162 Ga0436364_0748032 3300037853 Bacteria 3256
163 Ga0436365_0953178 3300039437 Bacteria 6277
164 Ga0436363_0426374 3300039450 Bacteria 1363
165 Ga0436362_0543778 3300039453 Bacteria 67112
166 Ga0439449_0060700 3300042007 Bacteria 1395
167 Ga0466969_0004694 3300044656 Bacteria 7277
168 Ga0466972_0003195 3300044658 Bacteria 8134
169 Ga0466972_0010390 3300044658 Bacteria 4674
170 Ga0466972_0013729 3300044658 Bacteria 4064
171 Ga0466965_0000378 3300044683 Bacteria 15176
172 Ga0466965_0024353 3300044683 Bacteria 2927
173 Ga0466965_0081841 3300044683 Bacteria 1633
174 Ga0466965_0164182 3300044683 Bacteria 1166
175 Ga0466965_0178522 3300044683 Bacteria 1119
176 Ga0466966_0003342 3300044684 Bacteria 10575
177 Ga0466966_0006804 3300044684 Bacteria 7576
178 Ga0466966_0228316 3300044684 Bacteria 1123
179 Ga0466961_0007869 3300044693 Bacteria 6786
180 Ga0466963_0000039 3300044694 Bacteria 42354
181 Ga0466963_0029366 3300044694 Bacteria 3539
182 Ga0466963_0228607 3300044694 Bacteria 1303
183 Ga0466964_0062983 3300044706 Bacteria 1548
184 Ga0466971_0002175 3300044719 Bacteria 8292
185 Ga0466968_0011920 3300044735 Bacteria 3393
186 Ga0466970_0000968 3300044765 Bacteria 13816
187 Ga0466970_0013388 3300044765 Bacteria 4205
188 Ga0466970_0173224 3300044765 Bacteria 1196
189 Ga0466970_0291367 3300044765 Bacteria 919
190 Ga0466957_0002887 3300044842 Bacteria 9312
191 Ga0466957_0105662 3300044842 Bacteria 1780
192 Ga0466960_0000584 3300044901 Bacteria 12624
193 Ga0466960_0000797 3300044901 Bacteria 11071
194 Ga0466960_0138284 3300044901 Bacteria 1291
195 Ga0466959_0010322 3300045049 Bacteria 6669
196 Ga0466959_0016441 3300045049 Bacteria 5407
197 Ga0466958_0000335 3300045836 Bacteria 18707
198 Ga0466967_0004266 3300045976 Bacteria 9607
199 Ga0466967_0029127 3300045976 Bacteria 4618
200 Ga0466967_0064283 3300045976 Bacteria 3263
201 Ga0466967_0091125 3300045976 Bacteria 2770
202 Ga0466967_0110047 3300045976 Bacteria 2530
203 Ga0466967_0382719 3300045976 Bacteria 1366
204 Ga0466967_0429426 3300045976 Bacteria 1289
205 Ga0466967_0624675 3300045976 Bacteria 1064
206 Ga0495650_0013519 3300046471 Bacteria 4311
207 Ga0495580_0322791 3300046472 Bacteria 1049
208 Ga0495665_0077492 3300046531 Bacteria 1749
209 Ga0495668_0012300 3300046616 Bacteria 5078
210 Ga0495581_0082406 3300047315 Bacteria 1863
211 Ga0496100_0033963 3300048903 Bacteria 3195
212 Ga0496101_0002313 3300048904 Bacteria 11666
213 Ga0496102_0000042 3300048905 Bacteria 196538
214 Ga0496102_0067555 3300048905 Bacteria 3280
215 Ga0496102_0394398 3300048905 Bacteria 1302
216 Ga0496103_0000194 3300048906 Bacteria 60666
217 Ga0496103_0053589 3300048906 Bacteria 2500
218 Ga0496103_0275359 3300048906 Bacteria 1083
219 Ga0496104_0234569 3300048907 Bacteria 1747
220 Ga0496104_0273973 3300048907 Bacteria 1600
221 Ga0496104_0533564 3300048907 Bacteria 1084
222 Ga0496105_0130049 3300048908 Bacteria 2076
223 Ga0496106_0167587 3300048909 Bacteria 1740
224 Ga0496108_0021561 3300048911 Bacteria 5293
225 Ga0496109_0240673 3300048912 Bacteria 1703
226 Ga0496109_0282655 3300048912 Bacteria 1564
227 Ga0496109_0564875 3300048912 Bacteria 1073
228 Ga0496110_0292707 3300048913 Bacteria 1483
229 Ga0496111_0353973 3300048914 Bacteria 1087
230 Ga0496113_0129005 3300048916 Bacteria 1983
231 Ga0496116_0000353 3300048919 Bacteria 72146
232 Ga0496116_0000464 3300048919 Bacteria 56167
233 Ga0496117_0000339 3300048920 Bacteria 82597
234 Ga0496117_0008296 3300048920 Bacteria 9885
235 Ga0496117_0059180 3300048920 Bacteria 2649
236 Ga0496118_0000241 3300048921 Bacteria 96484
237 Ga0496118_0005303 3300048921 Bacteria 14710
238 Ga0496118_0008082 3300048921 Bacteria 10968
239 Ga0496119_0003982 3300048922 Bacteria 14950
240 Ga0496119_0009521 3300048922 Bacteria 8320
241 Ga0496119_0029759 3300048922 Bacteria 3693
242 Ga0496120_0004701 3300048923 Bacteria 11265
243 Ga0496120_0116341 3300048923 Bacteria 1389
244 Ga0496121_0015729 3300048924 Bacteria 7888
245 Ga0496121_0036969 3300048924 Bacteria 4343
246 Ga0496124_0005894 3300048927 Bacteria 13560
247 Ga0496125_0012736 3300048928 Bacteria 8315
248 Ga0496126_0000006 3300048929 Bacteria 798804
249 Ga0496126_0001408 3300048929 Bacteria 38053
250 Ga0501036_0019369 3300049572 Bacteria 5712
251 Ga0501036_0172715 3300049572 Bacteria 1821
252 Ga0501039_0102359 3300049575 Bacteria 2235
253 Ga0501040_0018966 3300049576 Bacteria 4573
254 Ga0501042_0030996 3300049578 Bacteria 3782
255 Ga0501043_0330693 3300049579 Bacteria 1160
256 Ga0501048_0064329 3300049582 Bacteria 2594
257 Ga0501071_0003897 3300049587 Bacteria 9401
258 Ga0501072_0010218 3300049588 Bacteria 7153
259 Ga0501074_0215322 3300049590 Bacteria 1368
260 Ga0501075_0068719 3300049591 Bacteria 2677
261 Ga0501077_0176439 3300049593 Bacteria 1358
262 Ga0501044_0411352 3300049823 Bacteria 1264
263 Ga0501045_0055002 3300049824 Bacteria 2910
264 nmdc:mga03683_98022_c1 3300050489 Bacteria 1285
265 nmdc:mga00v17_20611_c1 3300050491 Bacteria 3779
266 nmdc:mga07m45_81236_c1 3300050496 Bacteria 1851
267 nmdc:mga07m45_89909_c1 3300050496 Bacteria 954
268 nmdc:mga0qj67_165636_c1 3300050509 Bacteria 1794
269 nmdc:mga06r32_86_c9 3300050510 Bacteria 7643
270 Ga0500559_0007412 3300053136 Bacteria 4864
271 Ga0500577_0004944 3300053142 Bacteria 3552
272 Ga0501082_0020655 3300060353 Bacteria 5677
273 Ga0466962_0000237 3300061719 Bacteria 23010
274 Ga0530510_0039783 3300061734 Bacteria 3394
275 2508677347 2508501039 Bacteria 9978592
276 2517760365 2517572101 Bacteria 6884336
277 2558910990 2558860112 Bacteria 9931328
278 2566996460 2565956761 Bacteria 6601618
279 2586059370 2585427649 Bacteria 9053857
280 2671835115 2671180195 Bacteria 9757215
281 2689960226 2687453737 Bacteria 11203906
282 2738889995 2738541308 Bacteria 7020677
283 2739238766 2738543011 Bacteria 5731169
284 2739362170 2738543034 Bacteria 6084756
285 2744957081 2744054611 Bacteria 5611514
286 2753035206 2751185725 Bacteria 5740550
287 2753070783 2751185734 Bacteria 8863695
288 2753323723 2751185792 Bacteria 5739090
289 2774853271 2773857922 Bacteria 9757215
290 2776375304 2775506925 Bacteria 7237746
291 2791915417 2791354901 Bacteria 8322202
292 2795783441 2795385470 Bacteria 8317180
293 2795795867 2795385472 Bacteria 6627535
294 2809591875 2808606522 Bacteria 9488490
295 2816504600 2816332139 Bacteria 9138787
296 2863071098 2863067949 Bacteria 8541735
297 2866552638 2866552031 Bacteria 5824618
298 2866616893 2866612099 Bacteria 7543886
299 2870726651 2870721527 Bacteria 9689237
300 2870789145 2870782633 Bacteria 9624083
301 2889301041 2889300758 Bacteria 5690814
302 2891327490 2891326441 Bacteria 6439512
303 2899367959 2899359706 Bacteria 10940472
304 2899371406 2899370129 Bacteria 6781179
305 2904538974 2904535858 Bacteria 6308016
306 2904770078 2904765812 Bacteria 5369154
307 2904771073 2904770941 Bacteria 5580202
308 2908815117 2908811453 Bacteria 5478616
309 2915775726 2915768154 Bacteria 8424322
310 2917740878 2917736166 Bacteria 9690793
311 2919424400 2919420072 Bacteria 5390363
312 2919436793 2919432681 Bacteria 5390474
313 2922555637 2922554459 Bacteria 6683962
314 2928144931 2928142448 Bacteria 5288925
315 2939744559 2939743619 Bacteria 5762299
316 2956940421 2956939328 Bacteria 3474458
317 3001121846 3001119090 Bacteria 3449530
318 8002776013 8002775197 Bacteria 10728764
319 8003322419 8003314358 Bacteria 10575343
320 8047718069 8047710418 Bacteria 11023148
321 8054477140 8054472261 Bacteria 7464355
322 8056212056 8056207758 Bacteria 8639239
323 Ga0070658_10310793
324 JGI25406J46586_10000375
325 rootL2_10098970
326 JGI25405J52794_10024237
327 Ga0070682_100087594
328 Ga0070689_100196325
329 Ga0070668_100008519
330 Ga0070675_100058014
331 Ga0070674_100056818
332 Ga0070714_100023344
333 Ga0070714_100336854
334 Ga0070714_100484491
335 Ga0070713_100264728
336 Ga0070710_10000147
337 Ga0070700_100080671
338 Ga0070663_100066485
339 Ga0070678_100281475
340 Ga0070662_100145016
341 Ga0070681_10640022
342 Ga0070685_10028511
343 Ga0070685_10227197
344 Ga0068853_100045156
345 Ga0068853_100284822
346 Ga0070693_100014591
347 Ga0070665_100116675
348 Ga0070665_100289492
349 Ga0070665_100481424
350 Ga0070665_100655306
351 Ga0068857_100359980
352 Ga0068856_100389343
353 Ga0068852_100209523
354 Ga0068859_100427576
355 Ga0068866_10017627
356 Ga0068861_100214094
357 Ga0068863_100005727
358 Ga0068858_100000002
359 Ga0068858_100099506
360 Ga0068862_100000110
361 Ga0068862_100294004
362 Ga0081455_10000011
363 Ga0081455_10000722
364 Ga0081539_10000102
365 Ga0070717_10168843
366 Ga0075364_10038935
367 Ga0075364_10139253
368 Ga0075370_10012967
369 Ga0075370_10039575
370 Ga0075370_10093790
371 Ga0075430_100424734
372 Ga0097620_100000322
373 Ga0097620_100427599
374 Ga0111539_10064196
375 Ga0105245_10033826
376 Ga0105245_10508468
377 Ga0105247_10005737
378 Ga0105243_10011429
379 Ga0105248_10000038
380 Ga0105248_10002460
381 Ga0105237_10250340
382 Ga0105237_10758398
383 Ga0105238_10031751
384 Ga0105238_10153883
385 Ga0105249_10001550
386 Ga0105249_10233403
387 Ga0105249_10634903
388 Ga0105035_104099
389 Ga0105239_10236516
390 Ga0157371_10099137
391 Ga0157369_10016463
392 Ga0157369_10249729
393 Ga0157374_10266083
394 Ga0157378_10471745
395 Ga0163162_10306682
396 Ga0157372_10084122
397 Ga0157372_10518123
398 Ga0157375_10112416
399 Ga0157515_112488
400 Ga0163163_10150439
401 Ga0157380_10112104
402 Ga0157379_10000007
403 Ga0157379_10006909
404 Ga0157379_10147605
405 Ga0206353_10191711
406 Ga0213873_10000372
407 Ga0213876_10020901
408 Ga0213875_10006141
409 Ga0224712_10299586
410 Ga0207656_10079810
411 Ga0207656_10099685
412 Ga0207692_10002066
413 Ga0207642_10178946
414 Ga0207710_10000020
415 Ga0207645_10053423
416 Ga0207643_10011289
417 Ga0207643_10094798
418 Ga0207654_10197723
419 Ga0207693_10361681
420 Ga0207662_10057378
421 Ga0207657_10010752
422 Ga0207694_10018007
423 Ga0207687_10018880
424 Ga0207687_10391966
425 Ga0207700_10260186
426 Ga0207664_10004460
427 Ga0207709_10004254
428 Ga0207670_10481227
429 Ga0207669_10068890
430 Ga0207704_10144015
431 Ga0207691_10045127
432 Ga0207711_10000152
433 Ga0207711_10004613
434 Ga0207689_10038403
435 Ga0207679_10497665
436 Ga0207712_10052902
437 Ga0207712_10077220
438 Ga0207668_10005580
439 Ga0207668_10163680
440 Ga0207668_10399440
441 Ga0207640_10175491
442 Ga0207703_10000001
443 Ga0207703_10000006
444 Ga0207703_10089222
445 Ga0207678_10001421
446 Ga0207678_10128229
447 Ga0207641_10010043
448 Ga0207674_10100443
449 Ga0207675_100062314
450 Ga0207683_10056902
451 Ga0207683_10414559
452 Ga0207698_10033960
453 Ga0207698_10090709
454 Ga0207698_10156090
455 Ga0207428_10321978
456 Ga0268265_10000019
457 Ga0268265_10244034
458 Ga0268264_10051511
459 Ga0307515_10078002
460 Ga0307515_10087176
461 Ga0307511_10043126
462 Ga0307511_10162126
463 Ga0307512_10006439
464 Ga0316177_1055133
465 Ga0316176_1227832
466 Ga0314311_1212459
467 Ga0316180_1140003
468 Ga0307509_10095756
469 Ga0307508_10112278
470 Ga0307413_10000723
471 Ga0307518_10000403
472 Ga0307518_10068331
473 Ga0326468_10003338
474 Ga0307409_100166981
475 Ga0307409_100895468
476 Ga0307411_10144759
477 Ga0307415_100334894
478 Ga0307507_10008211
479 Ga0373956_0000712
480 Ga0373931_0031264
481 Ga0373925_0359048
482 Ga0436364_0587812
483 Ga0436364_0624094
484 Ga0436364_0748032
485 Ga0436365_0953178
486 Ga0436363_0426374
487 Ga0436362_0543778
488 Ga0439449_0060700
489 Ga0466969_0004694
490 Ga0466972_0003195
491 Ga0466972_0010390
492 Ga0466972_0013729
493 Ga0466965_0000378
494 Ga0466965_0024353
495 Ga0466965_0081841
496 Ga0466965_0164182
497 Ga0466965_0178522
498 Ga0466966_0003342
499 Ga0466966_0006804
500 Ga0466966_0228316
501 Ga0466961_0007869
502 Ga0466963_0000039
503 Ga0466963_0029366
504 Ga0466963_0228607
505 Ga0466964_0062983
506 Ga0466971_0002175
507 Ga0466968_0011920
508 Ga0466970_0000968
509 Ga0466970_0013388
510 Ga0466970_0173224
511 Ga0466970_0291367
512 Ga0466957_0002887
513 Ga0466957_0105662
514 Ga0466960_0000584
515 Ga0466960_0000797
516 Ga0466960_0138284
517 Ga0466959_0010322
518 Ga0466959_0016441
519 Ga0466958_0000335
520 Ga0466967_0004266
521 Ga0466967_0029127
522 Ga0466967_0064283
523 Ga0466967_0091125
524 Ga0466967_0110047
525 Ga0466967_0382719
526 Ga0466967_0429426
527 Ga0466967_0624675
528 Ga0495650_0013519
529 Ga0495580_0322791
530 Ga0495665_0077492
531 Ga0495668_0012300
532 Ga0495581_0082406
533 Ga0496100_0033963
534 Ga0496101_0002313
535 Ga0496102_0000042
536 Ga0496102_0067555
537 Ga0496102_0394398
538 Ga0496103_0000194
539 Ga0496103_0053589
540 Ga0496103_0275359
541 Ga0496104_0234569
542 Ga0496104_0273973
543 Ga0496104_0533564
544 Ga0496105_0130049
545 Ga0496106_0167587
546 Ga0496108_0021561
547 Ga0496109_0240673
548 Ga0496109_0282655
549 Ga0496109_0564875
550 Ga0496110_0292707
551 Ga0496111_0353973
552 Ga0496113_0129005
553 Ga0496116_0000353
554 Ga0496116_0000464
555 Ga0496117_0000339
556 Ga0496117_0008296
557 Ga0496117_0059180
558 Ga0496118_0000241
559 Ga0496118_0005303
560 Ga0496118_0008082
561 Ga0496119_0003982
562 Ga0496119_0009521
563 Ga0496119_0029759
564 Ga0496120_0004701
565 Ga0496120_0116341
566 Ga0496121_0015729
567 Ga0496121_0036969
568 Ga0496124_0005894
569 Ga0496125_0012736
570 Ga0496126_0000006
571 Ga0496126_0001408
572 Ga0501036_0019369
573 Ga0501036_0172715
574 Ga0501039_0102359
575 Ga0501040_0018966
576 Ga0501042_0030996
577 Ga0501043_0330693
578 Ga0501048_0064329
579 Ga0501071_0003897
580 Ga0501072_0010218
581 Ga0501074_0215322
582 Ga0501075_0068719
583 Ga0501077_0176439
584 Ga0501044_0411352
585 Ga0501045_0055002
586 nmdc:mga03683_98022_c1
587 nmdc:mga00v17_20611_c1
588 nmdc:mga07m45_81236_c1
589 nmdc:mga07m45_89909_c1
590 nmdc:mga0qj67_165636_c1
591 nmdc:mga06r32_86_c9
592 Ga0500559_0007412
593 Ga0500577_0004944
594 Ga0501082_0020655
595 Ga0466962_0000237
596 Ga0530510_0039783
597 2508677347
598 2517760365
599 2558910990
600 2566996460
601 2586059370
602 2671835115
603 2689960226
604 2738889995
605 2739238766
606 2739362170
607 2744957081
608 2753035206
609 2753070783
610 2753323723
611 2774853271
612 2776375304
613 2791915417
614 2795783441
615 2795795867
616 2809591875
617 2816504600
618 2863071098
619 2866552638
620 2866616893
621 2870726651
622 2870789145
623 2889301041
624 2891327490
625 2899367959
626 2899371406
627 2904538974
628 2904770078
629 2904771073
630 2908815117
631 2915775726
632 2917740878
633 2919424400
634 2919436793
635 2922555637
636 2928144931
637 2939744559
638 2956940421
639 3001121846
640 8002776013
641 8003322419
642 8047718069
643 8054477140
644 8056212056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13312

DUF4081

Domain of unknown function (DUF4081)

78

180

0.99

PF08445

FR47

FR47-like protein

227

304

0.95

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

190

296

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6erd-assembly2.cif.gz_D crystal structure of a putative acetyltransferase from bacillus cereus species. 0.8188 174 263
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.8163 174 263
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8128 173 250
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8123 173 263
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8046 173 264
ID Description Score Start End Superfamily
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9944 44 264 3.40.630.30
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9597 44 264 3.40.630.30
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8744 174 256 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8503 173 262 3.40.630.30
af_Q8IQP3_53_143_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8443 174 231 3.40.630.30
ID Description Score Start End GO Terms
AF-K5B8N6-F1-model_v4 Acetyltransferase family protein 0.9976 126 257 GO:0016747
AF-A0A0U0SN66-F1-model_v4 Gcn5-related N-acetyltransferase (EC 2.3.1.-) 0.9953 112 257 GO:0016747
AF-A0A5Q3QHS4-F1-model_v4 GNAT family N-acetyltransferase 0.9889 2 264 GO:0016747
AF-A0A7W0GES4-F1-model_v4 DUF4081 domain-containing protein 0.9833 2 224 GO:0016747
AF-W7T8I1-F1-model_v4 Acetyltransferase 0.9812 2 184 GO:0016740

Map