F406276

General Info

Members Datasets Scaffolds Average Seq Length
322 146 644 174

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10203476|Ga0065715_102034762
Length 183
Sequence MSDIQTRQASSDDAQLLTDLAYTTFWDAFAHHPKNAPDDLAHYMRQAFNLEQTTEELADPKSVFLIAEIDGEAAGYAKLIFDTTEPEIIAEWPVELNRLYSHQKFLGKGVGQALMDACLARAAEAGRDVMWLGVWEYNPRAQRFYEKNGFEFVGKHTFLLGSDPQTDLLMQKRLDVTTSVNAS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.55
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 31.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10203476 3300005293 Bacteria 1349
2 Ga0065704_10146728 3300005289 Unclassified 1465
3 Ga0065707_10096661 3300005295 Unclassified 3246
4 Ga0070658_10410941 3300005327 Unclassified 1163
5 Ga0070676_10485985 3300005328 Unclassified 874
6 Ga0070683_100495103 3300005329 Unclassified 1167
7 Ga0070683_100692121 3300005329 Unclassified 976
8 Ga0070683_101392505 3300005329 Unclassified 674
9 Ga0070670_100024624 3300005331 Bacteria 5176
10 Ga0070670_100036493 3300005331 Bacteria 4230
11 Ga0070670_100064216 3300005331 Bacteria 3151
12 Ga0070670_100112591 3300005331 Bacteria 2345
13 Ga0070670_100372604 3300005331 Bacteria 1257
14 Ga0070670_100375213 3300005331 Bacteria 1252
15 Ga0070670_100693519 3300005331 Unclassified 915
16 Ga0068869_100206261 3300005334 Bacteria 1552
17 Ga0070666_10578530 3300005335 Unclassified 818
18 Ga0070680_100019418 3300005336 Bacteria 5386
19 Ga0070680_100556481 3300005336 Bacteria 983
20 Ga0070682_100389458 3300005337 Unclassified 1051
21 Ga0068868_100629458 3300005338 Bacteria 953
22 Ga0070689_101307687 3300005340 Bacteria 653
23 Ga0070661_100033221 3300005344 Bacteria 3736
24 Ga0070661_100066325 3300005344 Bacteria 2652
25 Ga0070661_100465262 3300005344 Unclassified 1008
26 Ga0070668_100220456 3300005347 Bacteria 1564
27 Ga0070668_100255061 3300005347 Bacteria 1457
28 Ga0070675_100025501 3300005354 Bacteria 4739
29 Ga0070675_100056683 3300005354 Bacteria 3230
30 Ga0070671_100007335 3300005355 Bacteria 8806
31 Ga0070671_100233943 3300005355 Bacteria 1559
32 Ga0070674_100020460 3300005356 Bacteria 4229
33 Ga0070667_100057743 3300005367 Bacteria 3280
34 Ga0070667_101268008 3300005367 Bacteria 690
35 Ga0070705_100143867 3300005440 Unclassified 1573
36 Ga0070700_100694673 3300005441 Bacteria 808
37 Ga0070678_100305306 3300005456 Bacteria 1354
38 Ga0070678_100483053 3300005456 Bacteria 1090
39 Ga0070678_101766808 3300005456 Unclassified 583
40 Ga0070681_10018387 3300005458 Bacteria 6985
41 Ga0070681_10118026 3300005458 Bacteria 2589
42 Ga0070685_10051363 3300005466 Bacteria 2384
43 Ga0070679_100216426 3300005530 Bacteria 1878
44 Ga0070679_100547624 3300005530 Bacteria 1101
45 Ga0070679_100606645 3300005530 Bacteria 1038
46 Ga0068853_100003650 3300005539 Bacteria 11801
47 Ga0068853_100083066 3300005539 Unclassified 2806
48 Ga0068853_100085403 3300005539 Bacteria 2767
49 Ga0068853_100234956 3300005539 Unclassified 1678
50 Ga0068853_100783023 3300005539 Unclassified 913
51 Ga0068853_100963083 3300005539 Unclassified 821
52 Ga0070672_100304308 3300005543 Unclassified 1352
53 Ga0070704_100060982 3300005549 Bacteria 2697
54 Ga0068855_100064630 3300005563 Bacteria 4267
55 Ga0068855_100141026 3300005563 Bacteria 2747
56 Ga0068855_100310730 3300005563 Bacteria 1744
57 Ga0070664_100012754 3300005564 Bacteria 6839
58 Ga0070664_100043700 3300005564 Bacteria 3781
59 Ga0070664_100374142 3300005564 Bacteria 1299
60 Ga0070664_100383498 3300005564 Bacteria 1283
61 Ga0068857_100210262 3300005577 Bacteria 1775
62 Ga0068854_100391099 3300005578 Unclassified 1148
63 Ga0068854_100451413 3300005578 Bacteria 1074
64 Ga0070702_100287285 3300005615 Bacteria 1132
65 Ga0068852_100187129 3300005616 Unclassified 1951
66 Ga0068852_100478893 3300005616 Unclassified 1237
67 Ga0068852_100698724 3300005616 Bacteria 1024
68 Ga0068859_100021360 3300005617 Bacteria 6496
69 Ga0068859_100088921 3300005617 Unclassified 3138
70 Ga0068859_100348675 3300005617 Bacteria 1575
71 Ga0068859_100391542 3300005617 Bacteria 1485
72 Ga0068859_100684674 3300005617 Bacteria 1116
73 Ga0068859_102254134 3300005617 Unclassified 601
74 Ga0068864_100038331 3300005618 Bacteria 4093
75 Ga0068864_100089335 3300005618 Bacteria 2714
76 Ga0068864_100196187 3300005618 Bacteria 1853
77 Ga0068864_100550645 3300005618 Bacteria 1115
78 Ga0068866_10133429 3300005718 Bacteria 1416
79 Ga0068851_10166514 3300005834 Bacteria 1214
80 Ga0068870_10505335 3300005840 Bacteria 806
81 Ga0068863_100115344 3300005841 Bacteria 2559
82 Ga0068863_100265443 3300005841 Bacteria 1660
83 Ga0068858_100137709 3300005842 Unclassified 2291
84 Ga0068858_100597147 3300005842 Bacteria 1071
85 Ga0068860_100048164 3300005843 Bacteria 4062
86 Ga0068860_100270095 3300005843 Bacteria 1659
87 Ga0068862_100076264 3300005844 Bacteria 2901
88 Ga0068862_100139736 3300005844 Unclassified 2149
89 Ga0068862_100147087 3300005844 Bacteria 2095
90 Ga0068862_100299306 3300005844 Unclassified 1479
91 Ga0097621_100106753 3300006237 Bacteria 2362
92 Ga0097621_100472848 3300006237 Bacteria 1132
93 Ga0068871_100115918 3300006358 Unclassified 2258
94 Ga0068871_100317711 3300006358 Bacteria 1370
95 Ga0068871_100340101 3300006358 Bacteria 1325
96 Ga0097620_100021361 3300006931 Bacteria 6496
97 Ga0097620_100088919 3300006931 Unclassified 3138
98 Ga0097620_100348720 3300006931 Bacteria 1575
99 Ga0097620_100391559 3300006931 Bacteria 1485
100 Ga0097620_100684705 3300006931 Bacteria 1116
101 Ga0097620_102253948 3300006931 Unclassified 601
102 Ga0105240_10302474 3300009093 Bacteria 1829
103 Ga0111539_10103999 3300009094 Bacteria 3332
104 Ga0111539_10221940 3300009094 Unclassified 2201
105 Ga0105247_10019143 3300009101 Bacteria 4110
106 Ga0105247_10029756 3300009101 Unclassified 3310
107 Ga0105247_10122082 3300009101 Bacteria 1689
108 Ga0105243_10016587 3300009148 Bacteria 5569
109 Ga0105243_10271685 3300009148 Unclassified 1522
110 Ga0105241_10054187 3300009174 Bacteria 3069
111 Ga0105242_10140905 3300009176 Unclassified 2092
112 Ga0105248_10369548 3300009177 Bacteria 1615
113 Ga0105248_10413624 3300009177 Unclassified 1519
114 Ga0105248_11275073 3300009177 Unclassified 831
115 Ga0105248_11285922 3300009177 Bacteria 827
116 Ga0105237_10120100 3300009545 Bacteria 2622
117 Ga0105249_10153796 3300009553 Bacteria 2217
118 Ga0105249_10165363 3300009553 Unclassified 2141
119 Ga0105249_10334961 3300009553 Bacteria 1528
120 Ga0105249_10417738 3300009553 Bacteria 1374
121 Ga0105249_10456286 3300009553 Bacteria 1317
122 Ga0105239_10300911 3300010375 Bacteria 1806
123 Ga0157373_10053524 3300013100 Bacteria 2870
124 Ga0157371_10317276 3300013102 Unclassified 1130
125 Ga0157370_10307169 3300013104 Bacteria 1464
126 Ga0157370_10447141 3300013104 Bacteria 1188
127 Ga0157369_10058659 3300013105 Bacteria 4152
128 Ga0157369_10200016 3300013105 Bacteria 2097
129 Ga0157369_10815548 3300013105 Bacteria 958
130 Ga0157374_10039142 3300013296 Unclassified 4362
131 Ga0157374_10097975 3300013296 Bacteria 2806
132 Ga0157374_10323243 3300013296 Bacteria 1529
133 Ga0157378_10508277 3300013297 Bacteria 1205
134 Ga0163162_10043058 3300013306 Bacteria 4520
135 Ga0163162_10292953 3300013306 Bacteria 1759
136 Ga0163162_10317735 3300013306 Bacteria 1690
137 Ga0163162_10461507 3300013306 Bacteria 1402
138 Ga0163162_10589908 3300013306 Bacteria 1238
139 Ga0163162_11686747 3300013306 Bacteria 724
140 Ga0157372_10206551 3300013307 Bacteria 2276
141 Ga0157372_10234812 3300013307 Bacteria 2127
142 Ga0157372_10334445 3300013307 Bacteria 1764
143 Ga0157372_10451593 3300013307 Bacteria 1498
144 Ga0157375_10092773 3300013308 Bacteria 3084
145 Ga0157375_10523999 3300013308 Unclassified 1348
146 Ga0157375_10613283 3300013308 Unclassified 1247
147 Ga0163163_10122678 3300014325 Bacteria 2633
148 Ga0163163_10310618 3300014325 Unclassified 1629
149 Ga0157380_10017013 3300014326 Bacteria 5371
150 Ga0157380_10127142 3300014326 Bacteria 2168
151 Ga0157380_10497577 3300014326 Unclassified 1183
152 Ga0157377_10077933 3300014745 Bacteria 1931
153 Ga0157376_10246710 3300014969 Bacteria 1666
154 Ga0157376_10681407 3300014969 Unclassified 1031
155 Ga0157376_10782800 3300014969 Bacteria 965
156 Ga0163161_10006168 3300017792 Bacteria 8303
157 Ga0163161_10013398 3300017792 Bacteria 5706
158 Ga0163161_10542458 3300017792 Bacteria 952
159 Ga0207710_10034018 3300025900 Bacteria 2238
160 Ga0207680_10069649 3300025903 Bacteria 2174
161 Ga0207647_10622432 3300025904 Unclassified 594
162 Ga0207707_10002559 3300025912 Bacteria 16309
163 Ga0207671_10219635 3300025914 Bacteria 1489
164 Ga0207660_10319750 3300025917 Bacteria 1239
165 Ga0207662_10169593 3300025918 Bacteria 1399
166 Ga0207649_10041960 3300025920 Bacteria 2788
167 Ga0207649_10058534 3300025920 Bacteria 2413
168 Ga0207649_10649122 3300025920 Unclassified 815
169 Ga0207652_10168689 3300025921 Bacteria 1963
170 Ga0207652_10438354 3300025921 Bacteria 1178
171 Ga0207652_10476477 3300025921 Bacteria 1124
172 Ga0207681_10332044 3300025923 Unclassified 1212
173 Ga0207681_10627810 3300025923 Bacteria 890
174 Ga0207650_10024128 3300025925 Bacteria 4320
175 Ga0207650_10108389 3300025925 Bacteria 2147
176 Ga0207650_10329286 3300025925 Bacteria 1252
177 Ga0207650_10447244 3300025925 Bacteria 1075
178 Ga0207659_10026595 3300025926 Bacteria 3905
179 Ga0207659_10049808 3300025926 Bacteria 2972
180 Ga0207659_10963722 3300025926 Unclassified 734
181 Ga0207644_10034505 3300025931 Bacteria 3540
182 Ga0207644_10145123 3300025931 Unclassified 1832
183 Ga0207644_10479494 3300025931 Unclassified 1024
184 Ga0207690_10267164 3300025932 Bacteria 1327
185 Ga0207706_10332357 3300025933 Bacteria 1322
186 Ga0207686_10393603 3300025934 Unclassified 1054
187 Ga0207709_10201961 3300025935 Unclassified 1420
188 Ga0207704_10577268 3300025938 Unclassified 917
189 Ga0207691_10067444 3300025940 Unclassified 3235
190 Ga0207691_10110199 3300025940 Bacteria 2449
191 Ga0207691_10173811 3300025940 Unclassified 1885
192 Ga0207711_10004562 3300025941 Bacteria 11782
193 Ga0207689_10114709 3300025942 Unclassified 2214
194 Ga0207661_10169664 3300025944 Unclassified 1899
195 Ga0207661_10949583 3300025944 Unclassified 792
196 Ga0207679_10346323 3300025945 Bacteria 1294
197 Ga0207667_10082244 3300025949 Bacteria 3336
198 Ga0207667_10679551 3300025949 Bacteria 1033
199 Ga0207651_10150094 3300025960 Unclassified 1813
200 Ga0207712_10092383 3300025961 Bacteria 2231
201 Ga0207712_10282224 3300025961 Bacteria 1356
202 Ga0207712_10283163 3300025961 Bacteria 1354
203 Ga0207712_10356073 3300025961 Unclassified 1218
204 Ga0207712_10642217 3300025961 Bacteria 922
205 Ga0207668_10215805 3300025972 Bacteria 1537
206 Ga0207640_10059738 3300025981 Bacteria 2517
207 Ga0207640_10091423 3300025981 Bacteria 2108
208 Ga0207640_10157636 3300025981 Bacteria 1675
209 Ga0207640_10659718 3300025981 Bacteria 892
210 Ga0207658_10091683 3300025986 Bacteria 2358
211 Ga0207677_10349372 3300026023 Bacteria 1239
212 Ga0207703_10069616 3300026035 Unclassified 2902
213 Ga0207703_10172200 3300026035 Bacteria 1905
214 Ga0207703_10372036 3300026035 Unclassified 1320
215 Ga0207703_10508851 3300026035 Bacteria 1131
216 Ga0207639_10005366 3300026041 Bacteria 8663
217 Ga0207639_10045838 3300026041 Bacteria 3296
218 Ga0207639_10287437 3300026041 Bacteria 1448
219 Ga0207639_11440625 3300026041 Bacteria 646
220 Ga0207678_11083971 3300026067 Unclassified 709
221 Ga0207641_10033155 3300026088 Bacteria 4292
222 Ga0207641_10047795 3300026088 Bacteria 3610
223 Ga0207641_10146413 3300026088 Unclassified 2136
224 Ga0207648_10132123 3300026089 Unclassified 2197
225 Ga0207676_10025508 3300026095 Bacteria 4385
226 Ga0207676_10040126 3300026095 Unclassified 3586
227 Ga0207676_10040878 3300026095 Bacteria 3556
228 Ga0207676_10125459 3300026095 Bacteria 2173
229 Ga0207676_10239289 3300026095 Bacteria 1627
230 Ga0207676_10893234 3300026095 Unclassified 871
231 Ga0207674_10017858 3300026116 Bacteria 7732
232 Ga0207674_10154199 3300026116 Bacteria 2252
233 Ga0207674_10991268 3300026116 Unclassified 809
234 Ga0207675_100061322 3300026118 Bacteria 3511
235 Ga0207675_101832255 3300026118 Unclassified 626
236 Ga0207683_10081254 3300026121 Bacteria 2877
237 Ga0207698_10219643 3300026142 Unclassified 1716
238 Ga0207698_10322993 3300026142 Bacteria 1446
239 Ga0207698_10331583 3300026142 Unclassified 1429
240 Ga0207698_11631567 3300026142 Unclassified 660
241 Ga0209974_10043740 3300027876 Bacteria 1493
242 Ga0268265_10144782 3300028380 Unclassified 1995
243 Ga0268265_10178579 3300028380 Bacteria 1822
244 Ga0268265_10465849 3300028380 Bacteria 1183
245 Ga0268264_10098019 3300028381 Bacteria 2542
246 Ga0268264_10433755 3300028381 Bacteria 1269
247 Ga0307408_100017998 3300031548 Bacteria 4740
248 Ga0307408_100049666 3300031548 Bacteria 3014
249 Ga0307408_101509768 3300031548 Unclassified 636
250 Ga0307516_10292581 3300031730 Bacteria 1307
251 Ga0307405_10022762 3300031731 Bacteria 3549
252 Ga0307405_10048439 3300031731 Bacteria 2620
253 Ga0307405_10114759 3300031731 Bacteria 1831
254 Ga0307405_10801133 3300031731 Bacteria 789
255 Ga0307413_10003974 3300031824 Bacteria 6345
256 Ga0307413_10004155 3300031824 Bacteria 6249
257 Ga0307413_10007893 3300031824 Bacteria 4980
258 Ga0307413_10059443 3300031824 Bacteria 2348
259 Ga0307413_10255977 3300031824 Unclassified 1302
260 Ga0307413_10323279 3300031824 Unclassified 1179
261 Ga0307410_10001442 3300031852 Bacteria 10717
262 Ga0307410_10005716 3300031852 Bacteria 6625
263 Ga0307410_10194810 3300031852 Unclassified 1543
264 Ga0307410_10437797 3300031852 Unclassified 1064
265 Ga0307410_11431050 3300031852 Unclassified 607
266 Ga0307406_10001658 3300031901 Bacteria 12248
267 Ga0307406_10004149 3300031901 Bacteria 7888
268 Ga0307406_10479218 3300031901 Unclassified 1004
269 Ga0307406_10627806 3300031901 Bacteria 889
270 Ga0307407_10003823 3300031903 Bacteria 6270
271 Ga0307407_10013706 3300031903 Bacteria 3944
272 Ga0307407_10019620 3300031903 Bacteria 3447
273 Ga0307407_10082611 3300031903 Bacteria 1947
274 Ga0307407_10103976 3300031903 Unclassified 1769
275 Ga0307412_10029534 3300031911 Unclassified 3441
276 Ga0307412_10081630 3300031911 Bacteria 2237
277 Ga0307412_10461831 3300031911 Unclassified 1049
278 Ga0307409_100003116 3300031995 Bacteria 8895
279 Ga0307409_100008890 3300031995 Bacteria 6131
280 Ga0307409_100096112 3300031995 Bacteria 2443
281 Ga0307409_100144008 3300031995 Unclassified 2058
282 Ga0307409_100930781 3300031995 Bacteria 884
283 Ga0307409_101513429 3300031995 Unclassified 698
284 Ga0307416_100000935 3300032002 Bacteria 15453
285 Ga0307416_100035623 3300032002 Bacteria 3804
286 Ga0307416_100091743 3300032002 Unclassified 2610
287 Ga0307416_100262026 3300032002 Unclassified 1690
288 Ga0307416_100324387 3300032002 Bacteria 1544
289 Ga0307416_101414679 3300032002 Unclassified 801
290 Ga0307416_102443164 3300032002 Unclassified 622
291 Ga0307414_10100436 3300032004 Unclassified 2176
292 Ga0307414_10308881 3300032004 Bacteria 1341
293 Ga0307414_10510715 3300032004 Unclassified 1065
294 Ga0307411_10000868 3300032005 Bacteria 11397
295 Ga0307411_10002073 3300032005 Bacteria 8623
296 Ga0307411_10085436 3300032005 Unclassified 2186
297 Ga0307411_10147946 3300032005 Bacteria 1741
298 Ga0307411_10305917 3300032005 Unclassified 1277
299 Ga0307411_10930253 3300032005 Unclassified 774
300 Ga0307415_100010600 3300032126 Bacteria 5226
301 Ga0307415_100018927 3300032126 Bacteria 4170
302 Ga0307415_100979363 3300032126 Unclassified 785
303 Ga0395900_0253335 3300037418 Bacteria 1761
304 Ga0395905_0096809 3300037471 Bacteria 2771
305 Ga0395901_0079486 3300038443 Bacteria 3425
306 Ga0451837_1167650 3300041494 Unclassified 732
307 Ga0451853_1784415 3300041512 Unclassified 624
308 Ga0439432_069208 3300042006 Bacteria 1078
309 Ga0450914_010313 3300042118 Bacteria 901
310 Ga0439435_0159992 3300042436 Bacteria 727
311 Ga0495629_0419384 3300046459 Unclassified 908
312 Ga0496100_0158718 3300048903 Unclassified 1620
313 Ga0496101_0233662 3300048904 Bacteria 1430
314 Ga0496109_0053256 3300048912 Bacteria 3690
315 Ga0496112_0313433 3300048915 Bacteria 1514
316 Ga0496114_0137449 3300048917 Bacteria 2114
317 Ga0501072_0048502 3300049588 Bacteria 3345
318 Ga0501214_035581 3300049659 Unclassified 702
319 Ga0501223_059934 3300049663 Bacteria 743
320 Ga0501268_099803 3300049765 Unclassified 621
321 Ga0495601_0077442 3300053077 Bacteria 2130
322 Ga0501082_1418921 3300060353 Unclassified 606
323 Ga0065715_10203476
324 Ga0065704_10146728
325 Ga0065707_10096661
326 Ga0070658_10410941
327 Ga0070676_10485985
328 Ga0070683_100495103
329 Ga0070683_100692121
330 Ga0070683_101392505
331 Ga0070670_100024624
332 Ga0070670_100036493
333 Ga0070670_100064216
334 Ga0070670_100112591
335 Ga0070670_100372604
336 Ga0070670_100375213
337 Ga0070670_100693519
338 Ga0068869_100206261
339 Ga0070666_10578530
340 Ga0070680_100019418
341 Ga0070680_100556481
342 Ga0070682_100389458
343 Ga0068868_100629458
344 Ga0070689_101307687
345 Ga0070661_100033221
346 Ga0070661_100066325
347 Ga0070661_100465262
348 Ga0070668_100220456
349 Ga0070668_100255061
350 Ga0070675_100025501
351 Ga0070675_100056683
352 Ga0070671_100007335
353 Ga0070671_100233943
354 Ga0070674_100020460
355 Ga0070667_100057743
356 Ga0070667_101268008
357 Ga0070705_100143867
358 Ga0070700_100694673
359 Ga0070678_100305306
360 Ga0070678_100483053
361 Ga0070678_101766808
362 Ga0070681_10018387
363 Ga0070681_10118026
364 Ga0070685_10051363
365 Ga0070679_100216426
366 Ga0070679_100547624
367 Ga0070679_100606645
368 Ga0068853_100003650
369 Ga0068853_100083066
370 Ga0068853_100085403
371 Ga0068853_100234956
372 Ga0068853_100783023
373 Ga0068853_100963083
374 Ga0070672_100304308
375 Ga0070704_100060982
376 Ga0068855_100064630
377 Ga0068855_100141026
378 Ga0068855_100310730
379 Ga0070664_100012754
380 Ga0070664_100043700
381 Ga0070664_100374142
382 Ga0070664_100383498
383 Ga0068857_100210262
384 Ga0068854_100391099
385 Ga0068854_100451413
386 Ga0070702_100287285
387 Ga0068852_100187129
388 Ga0068852_100478893
389 Ga0068852_100698724
390 Ga0068859_100021360
391 Ga0068859_100088921
392 Ga0068859_100348675
393 Ga0068859_100391542
394 Ga0068859_100684674
395 Ga0068859_102254134
396 Ga0068864_100038331
397 Ga0068864_100089335
398 Ga0068864_100196187
399 Ga0068864_100550645
400 Ga0068866_10133429
401 Ga0068851_10166514
402 Ga0068870_10505335
403 Ga0068863_100115344
404 Ga0068863_100265443
405 Ga0068858_100137709
406 Ga0068858_100597147
407 Ga0068860_100048164
408 Ga0068860_100270095
409 Ga0068862_100076264
410 Ga0068862_100139736
411 Ga0068862_100147087
412 Ga0068862_100299306
413 Ga0097621_100106753
414 Ga0097621_100472848
415 Ga0068871_100115918
416 Ga0068871_100317711
417 Ga0068871_100340101
418 Ga0097620_100021361
419 Ga0097620_100088919
420 Ga0097620_100348720
421 Ga0097620_100391559
422 Ga0097620_100684705
423 Ga0097620_102253948
424 Ga0105240_10302474
425 Ga0111539_10103999
426 Ga0111539_10221940
427 Ga0105247_10019143
428 Ga0105247_10029756
429 Ga0105247_10122082
430 Ga0105243_10016587
431 Ga0105243_10271685
432 Ga0105241_10054187
433 Ga0105242_10140905
434 Ga0105248_10369548
435 Ga0105248_10413624
436 Ga0105248_11275073
437 Ga0105248_11285922
438 Ga0105237_10120100
439 Ga0105249_10153796
440 Ga0105249_10165363
441 Ga0105249_10334961
442 Ga0105249_10417738
443 Ga0105249_10456286
444 Ga0105239_10300911
445 Ga0157373_10053524
446 Ga0157371_10317276
447 Ga0157370_10307169
448 Ga0157370_10447141
449 Ga0157369_10058659
450 Ga0157369_10200016
451 Ga0157369_10815548
452 Ga0157374_10039142
453 Ga0157374_10097975
454 Ga0157374_10323243
455 Ga0157378_10508277
456 Ga0163162_10043058
457 Ga0163162_10292953
458 Ga0163162_10317735
459 Ga0163162_10461507
460 Ga0163162_10589908
461 Ga0163162_11686747
462 Ga0157372_10206551
463 Ga0157372_10234812
464 Ga0157372_10334445
465 Ga0157372_10451593
466 Ga0157375_10092773
467 Ga0157375_10523999
468 Ga0157375_10613283
469 Ga0163163_10122678
470 Ga0163163_10310618
471 Ga0157380_10017013
472 Ga0157380_10127142
473 Ga0157380_10497577
474 Ga0157377_10077933
475 Ga0157376_10246710
476 Ga0157376_10681407
477 Ga0157376_10782800
478 Ga0163161_10006168
479 Ga0163161_10013398
480 Ga0163161_10542458
481 Ga0207710_10034018
482 Ga0207680_10069649
483 Ga0207647_10622432
484 Ga0207707_10002559
485 Ga0207671_10219635
486 Ga0207660_10319750
487 Ga0207662_10169593
488 Ga0207649_10041960
489 Ga0207649_10058534
490 Ga0207649_10649122
491 Ga0207652_10168689
492 Ga0207652_10438354
493 Ga0207652_10476477
494 Ga0207681_10332044
495 Ga0207681_10627810
496 Ga0207650_10024128
497 Ga0207650_10108389
498 Ga0207650_10329286
499 Ga0207650_10447244
500 Ga0207659_10026595
501 Ga0207659_10049808
502 Ga0207659_10963722
503 Ga0207644_10034505
504 Ga0207644_10145123
505 Ga0207644_10479494
506 Ga0207690_10267164
507 Ga0207706_10332357
508 Ga0207686_10393603
509 Ga0207709_10201961
510 Ga0207704_10577268
511 Ga0207691_10067444
512 Ga0207691_10110199
513 Ga0207691_10173811
514 Ga0207711_10004562
515 Ga0207689_10114709
516 Ga0207661_10169664
517 Ga0207661_10949583
518 Ga0207679_10346323
519 Ga0207667_10082244
520 Ga0207667_10679551
521 Ga0207651_10150094
522 Ga0207712_10092383
523 Ga0207712_10282224
524 Ga0207712_10283163
525 Ga0207712_10356073
526 Ga0207712_10642217
527 Ga0207668_10215805
528 Ga0207640_10059738
529 Ga0207640_10091423
530 Ga0207640_10157636
531 Ga0207640_10659718
532 Ga0207658_10091683
533 Ga0207677_10349372
534 Ga0207703_10069616
535 Ga0207703_10172200
536 Ga0207703_10372036
537 Ga0207703_10508851
538 Ga0207639_10005366
539 Ga0207639_10045838
540 Ga0207639_10287437
541 Ga0207639_11440625
542 Ga0207678_11083971
543 Ga0207641_10033155
544 Ga0207641_10047795
545 Ga0207641_10146413
546 Ga0207648_10132123
547 Ga0207676_10025508
548 Ga0207676_10040126
549 Ga0207676_10040878
550 Ga0207676_10125459
551 Ga0207676_10239289
552 Ga0207676_10893234
553 Ga0207674_10017858
554 Ga0207674_10154199
555 Ga0207674_10991268
556 Ga0207675_100061322
557 Ga0207675_101832255
558 Ga0207683_10081254
559 Ga0207698_10219643
560 Ga0207698_10322993
561 Ga0207698_10331583
562 Ga0207698_11631567
563 Ga0209974_10043740
564 Ga0268265_10144782
565 Ga0268265_10178579
566 Ga0268265_10465849
567 Ga0268264_10098019
568 Ga0268264_10433755
569 Ga0307408_100017998
570 Ga0307408_100049666
571 Ga0307408_101509768
572 Ga0307516_10292581
573 Ga0307405_10022762
574 Ga0307405_10048439
575 Ga0307405_10114759
576 Ga0307405_10801133
577 Ga0307413_10003974
578 Ga0307413_10004155
579 Ga0307413_10007893
580 Ga0307413_10059443
581 Ga0307413_10255977
582 Ga0307413_10323279
583 Ga0307410_10001442
584 Ga0307410_10005716
585 Ga0307410_10194810
586 Ga0307410_10437797
587 Ga0307410_11431050
588 Ga0307406_10001658
589 Ga0307406_10004149
590 Ga0307406_10479218
591 Ga0307406_10627806
592 Ga0307407_10003823
593 Ga0307407_10013706
594 Ga0307407_10019620
595 Ga0307407_10082611
596 Ga0307407_10103976
597 Ga0307412_10029534
598 Ga0307412_10081630
599 Ga0307412_10461831
600 Ga0307409_100003116
601 Ga0307409_100008890
602 Ga0307409_100096112
603 Ga0307409_100144008
604 Ga0307409_100930781
605 Ga0307409_101513429
606 Ga0307416_100000935
607 Ga0307416_100035623
608 Ga0307416_100091743
609 Ga0307416_100262026
610 Ga0307416_100324387
611 Ga0307416_101414679
612 Ga0307416_102443164
613 Ga0307414_10100436
614 Ga0307414_10308881
615 Ga0307414_10510715
616 Ga0307411_10000868
617 Ga0307411_10002073
618 Ga0307411_10085436
619 Ga0307411_10147946
620 Ga0307411_10305917
621 Ga0307411_10930253
622 Ga0307415_100010600
623 Ga0307415_100018927
624 Ga0307415_100979363
625 Ga0395900_0253335
626 Ga0395905_0096809
627 Ga0395901_0079486
628 Ga0451837_1167650
629 Ga0451853_1784415
630 Ga0439432_069208
631 Ga0450914_010313
632 Ga0439435_0159992
633 Ga0495629_0419384
634 Ga0496100_0158718
635 Ga0496101_0233662
636 Ga0496109_0053256
637 Ga0496112_0313433
638 Ga0496114_0137449
639 Ga0501072_0048502
640 Ga0501214_035581
641 Ga0501223_059934
642 Ga0501268_099803
643 Ga0495601_0077442
644 Ga0501082_1418921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

32

162

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

150

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

60

152

0.78

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

4

151

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9318 3 174
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9314 1 174
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9296 3 174
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9113 3 174
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8926 3 174
ID Description Score Start End Superfamily
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9311 5 174 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9258 5 174 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9228 13 174 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9093 4 170 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9058 13 174 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W0SMT3-F1-model_v4 GNAT family N-acetyltransferase 1 62 174 GO:0016747
AF-A0A2V8RKB1-F1-model_v4 N-acetyltransferase 0.9888 1 122 GO:0016747
AF-A0A7V9TZJ2-F1-model_v4 GNAT family N-acetyltransferase 0.9861 41 173 GO:0016747
AF-A0A1I0KUX6-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9851 79 174 GO:0016747
AF-A0A1H7UDE7-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9821 2 174 GO:0005840
GO:0016747

Map