F406232
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 264 | 642 | 290 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2895880812|2895888897 |
| Length | 323 |
| Sequence | ERMFVFDDYGELLSLLHNSIIAGAVLGVVCGVISVFVTYRDLAFAVHGVSELSFAGAAGFLLLGANVVTGSLIGALLAALLIGLLGERARDRNSVIGVLMPFGLGLGVLFLALYKGRAANKFGLLTGQIVAVDASRLAVLSAIAAVVLAALAVLWRPLTFASLDPEVATARGVPLRLLGPTFMLLLGATVAAAIQVVGALLVLSVVCTPGVAATMVTARRGLATALSVLFATVSTVGGILLALGGTLPISPYITTLSFAIYLGCRVFAAVRGVRSRRGHRSDRHGPSSSLEDRLPLTGSVTGPRLHPSVVGFYAPPEAVSRTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 103 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 113 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 114 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 115 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 120 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 121 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 122 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 125 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 126 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 127 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 128 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 129 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 130 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 131 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 132 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 133 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 188 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 191 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 192 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 193 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 194 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 195 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 196 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 197 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 198 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 199 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 200 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 201 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 202 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 203 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 204 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 205 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 206 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 207 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 208 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 209 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 210 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 211 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 212 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 213 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 214 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 215 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 216 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 217 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 218 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 219 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 220 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 221 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 222 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 223 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 224 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 225 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 226 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 227 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 228 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 229 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 230 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 231 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 232 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 233 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 234 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 235 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 236 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 237 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 238 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 239 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 240 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 241 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 242 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 243 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 244 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 245 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 246 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 247 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 248 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 249 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 250 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 251 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 252 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 253 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 254 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 255 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 256 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 257 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 258 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 259 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 260 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 261 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 262 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 263 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 264 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.95 |
| Metatranscriptomes | 0.31 |
| Isolates | 22.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0.62 |
| Rhizoplane | 6.23 |
| Rhizosphere | 74.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10013456 | 3300003316 | Bacteria | 2758 |
| 2 | rootH2_10097191 | 3300003320 | Bacteria | 1297 |
| 3 | Ga0070666_10108156 | 3300005335 | Bacteria | 1921 |
| 4 | Ga0068868_100042825 | 3300005338 | Bacteria | 3535 |
| 5 | Ga0070660_100135241 | 3300005339 | Bacteria | 1975 |
| 6 | Ga0070691_10077952 | 3300005341 | Bacteria | 1618 |
| 7 | Ga0070668_100054092 | 3300005347 | Bacteria | 3096 |
| 8 | Ga0070671_100011238 | 3300005355 | Bacteria | 7191 |
| 9 | Ga0070674_100093469 | 3300005356 | Bacteria | 2176 |
| 10 | Ga0070673_100176288 | 3300005364 | Bacteria | 1827 |
| 11 | Ga0070659_100018205 | 3300005366 | Bacteria | 5300 |
| 12 | Ga0070667_100083790 | 3300005367 | Bacteria | 2732 |
| 13 | Ga0070703_10056103 | 3300005406 | Bacteria | 1274 |
| 14 | Ga0070710_10008142 | 3300005437 | Bacteria | 5096 |
| 15 | Ga0070711_100033544 | 3300005439 | Bacteria | 3418 |
| 16 | Ga0070705_100045234 | 3300005440 | Bacteria | 2532 |
| 17 | Ga0070694_100055330 | 3300005444 | Bacteria | 2691 |
| 18 | Ga0070708_100417827 | 3300005445 | Bacteria | 1265 |
| 19 | Ga0070663_100040605 | 3300005455 | Bacteria | 3259 |
| 20 | Ga0070662_100156835 | 3300005457 | Bacteria | 1777 |
| 21 | Ga0070699_100167738 | 3300005518 | Bacteria | 1945 |
| 22 | Ga0068853_100010758 | 3300005539 | Bacteria | 7410 |
| 23 | Ga0070695_100064468 | 3300005545 | Bacteria | 2384 |
| 24 | Ga0070696_100153902 | 3300005546 | Bacteria | 1690 |
| 25 | Ga0070665_100429468 | 3300005548 | Bacteria | 1330 |
| 26 | Ga0068855_100001894 | 3300005563 | Bacteria | 25943 |
| 27 | Ga0068855_100019054 | 3300005563 | Bacteria | 8250 |
| 28 | Ga0068855_100036059 | 3300005563 | Bacteria | 5888 |
| 29 | Ga0068856_100045261 | 3300005614 | Bacteria | 4332 |
| 30 | Ga0070702_100024140 | 3300005615 | Bacteria | 3240 |
| 31 | Ga0068859_100030889 | 3300005617 | Bacteria | 5376 |
| 32 | Ga0068864_100008103 | 3300005618 | Bacteria | 8662 |
| 33 | Ga0068861_100043161 | 3300005719 | Bacteria | 3382 |
| 34 | Ga0068863_100050452 | 3300005841 | Bacteria | 3944 |
| 35 | Ga0068858_100234884 | 3300005842 | Bacteria | 1738 |
| 36 | Ga0081540_1011836 | 3300005983 | Bacteria | 5796 |
| 37 | Ga0070717_10071828 | 3300006028 | Bacteria | 2888 |
| 38 | Ga0075363_100028240 | 3300006048 | Bacteria | 2884 |
| 39 | Ga0070716_100000713 | 3300006173 | Bacteria | 14187 |
| 40 | Ga0070712_100040171 | 3300006175 | Bacteria | 3206 |
| 41 | Ga0075433_10156195 | 3300006852 | Bacteria | 2030 |
| 42 | Ga0075434_100166340 | 3300006871 | Bacteria | 2225 |
| 43 | Ga0075436_100078399 | 3300006914 | Bacteria | 2289 |
| 44 | Ga0097620_100030889 | 3300006931 | Bacteria | 5376 |
| 45 | Ga0099826_10087983 | 3300006948 | Bacteria | 1910 |
| 46 | Ga0075435_100256813 | 3300007076 | Bacteria | 1488 |
| 47 | Ga0105244_10048643 | 3300009036 | Bacteria | 2169 |
| 48 | Ga0105240_10171517 | 3300009093 | Bacteria | 2569 |
| 49 | Ga0105245_10028652 | 3300009098 | Bacteria | 4914 |
| 50 | Ga0105247_10002194 | 3300009101 | Bacteria | 13448 |
| 51 | Ga0105247_10031548 | 3300009101 | Bacteria | 3216 |
| 52 | Ga0105241_10048427 | 3300009174 | Bacteria | 3235 |
| 53 | Ga0105242_10021663 | 3300009176 | Bacteria | 5048 |
| 54 | Ga0105248_10781545 | 3300009177 | Bacteria | 1077 |
| 55 | Ga0105237_10127966 | 3300009545 | Bacteria | 2534 |
| 56 | Ga0105237_10225076 | 3300009545 | Bacteria | 1876 |
| 57 | Ga0105237_10335353 | 3300009545 | Bacteria | 1517 |
| 58 | Ga0105238_10026963 | 3300009551 | Bacteria | 5856 |
| 59 | Ga0105249_10000724 | 3300009553 | Bacteria | 30062 |
| 60 | Ga0105239_10051781 | 3300010375 | Bacteria | 4500 |
| 61 | Ga0105239_10297331 | 3300010375 | Bacteria | 1818 |
| 62 | Ga0105246_10000516 | 3300011119 | Bacteria | 21049 |
| 63 | Ga0105246_10020930 | 3300011119 | Bacteria | 4201 |
| 64 | Ga0157373_10105210 | 3300013100 | Bacteria | 1985 |
| 65 | Ga0157374_10082064 | 3300013296 | Bacteria | 3060 |
| 66 | Ga0157378_10053236 | 3300013297 | Bacteria | 3604 |
| 67 | Ga0163162_10052939 | 3300013306 | Bacteria | 4079 |
| 68 | Ga0157372_10207035 | 3300013307 | Bacteria | 2273 |
| 69 | Ga0157375_10038616 | 3300013308 | Bacteria | 4584 |
| 70 | Ga0157375_10240699 | 3300013308 | Bacteria | 1969 |
| 71 | Ga0163163_10294101 | 3300014325 | Bacteria | 1676 |
| 72 | Ga0157380_10032991 | 3300014326 | Bacteria | 3985 |
| 73 | Ga0157376_10518116 | 3300014969 | Bacteria | 1175 |
| 74 | Ga0163161_10076901 | 3300017792 | Bacteria | 2451 |
| 75 | Ga0209758_1015430 | 3300025297 | Bacteria | 3955 |
| 76 | Ga0207697_10005872 | 3300025315 | Bacteria | 5640 |
| 77 | Ga0207655_1036323 | 3300025728 | Bacteria | 2186 |
| 78 | Ga0207710_10001696 | 3300025900 | Bacteria | 10686 |
| 79 | Ga0207710_10015373 | 3300025900 | Bacteria | 3233 |
| 80 | Ga0207688_10013957 | 3300025901 | Bacteria | 4367 |
| 81 | Ga0207699_10148196 | 3300025906 | Bacteria | 1549 |
| 82 | Ga0207654_10026853 | 3300025911 | Bacteria | 3123 |
| 83 | Ga0207671_10076617 | 3300025914 | Bacteria | 2503 |
| 84 | Ga0207671_10088318 | 3300025914 | Bacteria | 2332 |
| 85 | Ga0207693_10031457 | 3300025915 | Bacteria | 4193 |
| 86 | Ga0207657_10013303 | 3300025919 | Bacteria | 8072 |
| 87 | Ga0207681_10158608 | 3300025923 | Bacteria | 1703 |
| 88 | Ga0207687_10003778 | 3300025927 | Bacteria | 10177 |
| 89 | Ga0207644_10097184 | 3300025931 | Bacteria | 2206 |
| 90 | Ga0207690_10143622 | 3300025932 | Bacteria | 1762 |
| 91 | Ga0207706_10093117 | 3300025933 | Bacteria | 2650 |
| 92 | Ga0207665_10013872 | 3300025939 | Bacteria | 5299 |
| 93 | Ga0207667_10025029 | 3300025949 | Bacteria | 6542 |
| 94 | Ga0207667_10039682 | 3300025949 | Bacteria | 5016 |
| 95 | Ga0207667_10047944 | 3300025949 | Bacteria | 4519 |
| 96 | Ga0207651_10143530 | 3300025960 | Bacteria | 1848 |
| 97 | Ga0207712_10022798 | 3300025961 | Bacteria | 4126 |
| 98 | Ga0207668_10115110 | 3300025972 | Bacteria | 2025 |
| 99 | Ga0207640_10003538 | 3300025981 | Bacteria | 8424 |
| 100 | Ga0207658_10061393 | 3300025986 | Bacteria | 2809 |
| 101 | Ga0207677_10087633 | 3300026023 | Bacteria | 2254 |
| 102 | Ga0207639_10041495 | 3300026041 | Bacteria | 3443 |
| 103 | Ga0207678_10001227 | 3300026067 | Bacteria | 23601 |
| 104 | Ga0207702_10017153 | 3300026078 | Bacteria | 5990 |
| 105 | Ga0207676_10194540 | 3300026095 | Bacteria | 1787 |
| 106 | Ga0207674_10317966 | 3300026116 | Bacteria | 1506 |
| 107 | Ga0207675_100018034 | 3300026118 | Bacteria | 6582 |
| 108 | Ga0207698_10084743 | 3300026142 | Bacteria | 2570 |
| 109 | Ga0268266_10054753 | 3300028379 | Bacteria | 3429 |
| 110 | Ga0268265_10228029 | 3300028380 | Bacteria | 1635 |
| 111 | Ga0307515_10010042 | 3300028794 | Bacteria | 18207 |
| 112 | Ga0307515_10195795 | 3300028794 | Bacteria | 1914 |
| 113 | Ga0307513_10007417 | 3300031456 | Bacteria | 14222 |
| 114 | Ga0307408_100019622 | 3300031548 | Bacteria | 4554 |
| 115 | Ga0307508_10011124 | 3300031616 | Bacteria | 8228 |
| 116 | Ga0307410_10027270 | 3300031852 | Bacteria | 3608 |
| 117 | Ga0307410_10039514 | 3300031852 | Bacteria | 3098 |
| 118 | Ga0307412_10010774 | 3300031911 | Bacteria | 5275 |
| 119 | Ga0307414_10047188 | 3300032004 | Bacteria | 2963 |
| 120 | Ga0373932_0025587 | 3300035112 | Bacteria | 1599 |
| 121 | Ga0373942_0016114 | 3300035207 | Bacteria | 1830 |
| 122 | Ga0373962_0006568 | 3300035242 | Bacteria | 2819 |
| 123 | Ga0395900_0044580 | 3300037418 | Bacteria | 4569 |
| 124 | Ga0395898_0054344 | 3300037466 | Bacteria | 3908 |
| 125 | Ga0395901_0003883 | 3300038443 | Bacteria | 15025 |
| 126 | Ga0439438_001436 | 3300041405 | Bacteria | 10514 |
| 127 | Ga0439439_0000061 | 3300041406 | Bacteria | 13847 |
| 128 | Ga0439466_0000835 | 3300041411 | Bacteria | 11718 |
| 129 | Ga0451791_1154289 | 3300041451 | Bacteria | 1182 |
| 130 | Ga0451793_0831126 | 3300041452 | Bacteria | 1296 |
| 131 | Ga0451833_0259823 | 3300041491 | Bacteria | 1398 |
| 132 | Ga0451853_1882014 | 3300041512 | Bacteria | 1036 |
| 133 | Ga0439433_0000025 | 3300041999 | Bacteria | 18287 |
| 134 | Ga0439442_000185 | 3300042002 | Bacteria | 15881 |
| 135 | Ga0439442_000430 | 3300042002 | Bacteria | 9602 |
| 136 | Ga0439442_002333 | 3300042002 | Bacteria | 3726 |
| 137 | Ga0439448_0001209 | 3300042005 | Bacteria | 6587 |
| 138 | Ga0439432_000327 | 3300042006 | Bacteria | 17281 |
| 139 | Ga0439449_0087547 | 3300042007 | Bacteria | 1149 |
| 140 | Ga0439452_000557 | 3300042010 | Bacteria | 19683 |
| 141 | Ga0439457_000065 | 3300042014 | Bacteria | 22689 |
| 142 | Ga0439462_0000461 | 3300042015 | Bacteria | 7979 |
| 143 | Ga0450903_000055 | 3300042138 | Bacteria | 23409 |
| 144 | Ga0450907_001451 | 3300042146 | Bacteria | 5117 |
| 145 | Ga0450907_002292 | 3300042146 | Bacteria | 3706 |
| 146 | Ga0439458_0000060 | 3300042157 | Bacteria | 19058 |
| 147 | Ga0450908_007368 | 3300042184 | Bacteria | 2074 |
| 148 | Ga0450909_010633 | 3300042185 | Bacteria | 1346 |
| 149 | Ga0439434_0000308 | 3300042435 | Bacteria | 13850 |
| 150 | Ga0450918_001820 | 3300042531 | Bacteria | 4159 |
| 151 | Ga0466966_0073601 | 3300044684 | Bacteria | 2136 |
| 152 | Ga0466966_0079124 | 3300044684 | Bacteria | 2049 |
| 153 | Ga0466961_0010108 | 3300044693 | Bacteria | 6012 |
| 154 | Ga0466963_0018466 | 3300044694 | Bacteria | 4361 |
| 155 | Ga0466963_0041988 | 3300044694 | Bacteria | 3001 |
| 156 | Ga0466963_0089568 | 3300044694 | Bacteria | 2093 |
| 157 | Ga0466964_0034976 | 3300044706 | Bacteria | 2007 |
| 158 | Ga0466964_0049890 | 3300044706 | Bacteria | 1714 |
| 159 | Ga0466971_0004209 | 3300044719 | Bacteria | 6201 |
| 160 | Ga0466970_0022182 | 3300044765 | Bacteria | 3314 |
| 161 | Ga0466970_0039333 | 3300044765 | Bacteria | 2509 |
| 162 | Ga0466970_0086127 | 3300044765 | Bacteria | 1703 |
| 163 | Ga0466970_0133926 | 3300044765 | Bacteria | 1362 |
| 164 | Ga0466957_0064075 | 3300044842 | Bacteria | 2261 |
| 165 | Ga0466960_0081960 | 3300044901 | Bacteria | 1628 |
| 166 | Ga0466960_0114227 | 3300044901 | Bacteria | 1407 |
| 167 | Ga0466959_0011914 | 3300045049 | Bacteria | 6268 |
| 168 | Ga0466959_0296023 | 3300045049 | Bacteria | 1109 |
| 169 | Ga0466958_0159050 | 3300045836 | Bacteria | 1426 |
| 170 | Ga0466967_0002288 | 3300045976 | Bacteria | 11823 |
| 171 | Ga0466967_0014827 | 3300045976 | Bacteria | 6088 |
| 172 | Ga0466967_0025004 | 3300045976 | Bacteria | 4918 |
| 173 | Ga0466967_0124661 | 3300045976 | Bacteria | 2385 |
| 174 | Ga0466967_0150242 | 3300045976 | Bacteria | 2176 |
| 175 | Ga0495638_0189459 | 3300046460 | Bacteria | 1168 |
| 176 | Ga0495653_0045101 | 3300046463 | Bacteria | 3419 |
| 177 | Ga0495609_0018141 | 3300046538 | Bacteria | 3264 |
| 178 | Ga0496100_0234595 | 3300048903 | Bacteria | 1351 |
| 179 | Ga0496101_0139440 | 3300048904 | Bacteria | 1847 |
| 180 | Ga0496102_0000327 | 3300048905 | Bacteria | 59228 |
| 181 | Ga0496102_0098567 | 3300048905 | Bacteria | 2712 |
| 182 | Ga0496102_0120757 | 3300048905 | Bacteria | 2447 |
| 183 | Ga0496103_0000267 | 3300048906 | Bacteria | 49943 |
| 184 | Ga0496104_0537080 | 3300048907 | Bacteria | 1080 |
| 185 | Ga0496105_0270779 | 3300048908 | Bacteria | 1371 |
| 186 | Ga0496105_0424322 | 3300048908 | Bacteria | 1053 |
| 187 | Ga0496107_0042796 | 3300048910 | Bacteria | 3253 |
| 188 | Ga0496108_0278166 | 3300048911 | Bacteria | 1457 |
| 189 | Ga0496108_0371301 | 3300048911 | Bacteria | 1249 |
| 190 | Ga0496109_0188349 | 3300048912 | Bacteria | 1938 |
| 191 | Ga0496110_0506019 | 3300048913 | Bacteria | 1099 |
| 192 | Ga0496114_0003669 | 3300048917 | Bacteria | 11811 |
| 193 | Ga0496114_0011832 | 3300048917 | Bacteria | 6980 |
| 194 | Ga0496115_0075877 | 3300048918 | Bacteria | 2732 |
| 195 | Ga0496115_0254697 | 3300048918 | Bacteria | 1444 |
| 196 | Ga0496117_0000174 | 3300048920 | Bacteria | 132648 |
| 197 | Ga0496117_0000988 | 3300048920 | Bacteria | 43571 |
| 198 | Ga0496117_0039019 | 3300048920 | Bacteria | 3511 |
| 199 | Ga0496118_0001023 | 3300048921 | Bacteria | 43511 |
| 200 | Ga0496118_0004708 | 3300048921 | Bacteria | 15978 |
| 201 | Ga0496119_0015199 | 3300048922 | Bacteria | 5954 |
| 202 | Ga0496119_0036397 | 3300048922 | Bacteria | 3213 |
| 203 | Ga0496119_0053427 | 3300048922 | Bacteria | 2468 |
| 204 | Ga0496121_0012740 | 3300048924 | Bacteria | 9113 |
| 205 | Ga0496122_0001637 | 3300048925 | Bacteria | 34821 |
| 206 | Ga0496122_0039996 | 3300048925 | Bacteria | 3733 |
| 207 | Ga0496123_0042348 | 3300048926 | Bacteria | 3143 |
| 208 | Ga0496124_0000323 | 3300048927 | Bacteria | 88352 |
| 209 | Ga0496124_0023334 | 3300048927 | Bacteria | 5649 |
| 210 | Ga0496124_0118475 | 3300048927 | Bacteria | 2119 |
| 211 | Ga0496124_0170006 | 3300048927 | Bacteria | 1689 |
| 212 | Ga0496126_0000586 | 3300048929 | Bacteria | 68837 |
| 213 | Ga0496126_0053948 | 3300048929 | Bacteria | 3644 |
| 214 | Ga0501031_0012675 | 3300049568 | Bacteria | 5506 |
| 215 | Ga0501031_0136186 | 3300049568 | Bacteria | 1604 |
| 216 | Ga0501032_0029106 | 3300049569 | Bacteria | 3793 |
| 217 | Ga0501033_0062414 | 3300049570 | Bacteria | 2744 |
| 218 | Ga0501034_0042981 | 3300049571 | Bacteria | 4574 |
| 219 | Ga0501036_0024884 | 3300049572 | Bacteria | 5049 |
| 220 | Ga0501038_0009680 | 3300049574 | Bacteria | 8839 |
| 221 | Ga0501038_0028004 | 3300049574 | Bacteria | 5006 |
| 222 | Ga0501038_0031504 | 3300049574 | Bacteria | 4686 |
| 223 | Ga0501039_0018522 | 3300049575 | Bacteria | 5346 |
| 224 | Ga0501039_0065213 | 3300049575 | Bacteria | 2825 |
| 225 | Ga0501043_0081880 | 3300049579 | Bacteria | 2536 |
| 226 | Ga0501043_0152901 | 3300049579 | Bacteria | 1805 |
| 227 | Ga0501043_0291024 | 3300049579 | Bacteria | 1250 |
| 228 | Ga0501046_0057213 | 3300049580 | Bacteria | 3059 |
| 229 | Ga0501047_0062815 | 3300049581 | Bacteria | 3582 |
| 230 | Ga0501067_0022758 | 3300049583 | Bacteria | 3469 |
| 231 | Ga0501067_0029979 | 3300049583 | Bacteria | 3016 |
| 232 | Ga0501083_0021332 | 3300049744 | Bacteria | 4500 |
| 233 | Ga0501035_0007530 | 3300049822 | Bacteria | 10173 |
| 234 | Ga0501035_0009474 | 3300049822 | Bacteria | 9054 |
| 235 | Ga0501044_0024198 | 3300049823 | Bacteria | 6451 |
| 236 | Ga0501044_0028943 | 3300049823 | Bacteria | 5843 |
| 237 | Ga0501044_0069102 | 3300049823 | Bacteria | 3597 |
| 238 | nmdc:mga0yw44_221227_c1 | 3300050492 | Bacteria | 1255 |
| 239 | nmdc:mga08y16_734666_c1 | 3300050511 | Bacteria | 984 |
| 240 | nmdc:mga0n895_181087_c1 | 3300050512 | Bacteria | 2139 |
| 241 | nmdc:mga0rr50_113532_c1 | 3300050513 | Bacteria | 2147 |
| 242 | nmdc:mga0a205_211662_c1 | 3300050515 | Bacteria | 1827 |
| 243 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 244 | Ga0500616_0024940 | 3300053153 | Bacteria | 3319 |
| 245 | Ga0587090_000109 | 3300059510 | Bacteria | 5135 |
| 246 | Ga0501082_0131181 | 3300060353 | Bacteria | 2174 |
| 247 | Ga0466962_0026796 | 3300061719 | Bacteria | 2768 |
| 248 | Ga0530510_0188391 | 3300061734 | Bacteria | 1531 |
| 249 | 2895888897 | 2895880812 | Bacteria | 11255272 |
| 250 | 2537900491 | 2537561592 | Bacteria | 4348607 |
| 251 | 2555231654 | 2554235227 | Bacteria | 3637389 |
| 252 | 2644263433 | 2643221647 | Bacteria | 10741251 |
| 253 | 2655032149 | 2654587600 | Bacteria | 3911798 |
| 254 | 2676480043 | 2675903059 | Bacteria | 8644972 |
| 255 | 2686536598 | 2684623035 | Bacteria | 8032739 |
| 256 | 2710605414 | 2710264753 | Bacteria | 5455564 |
| 257 | 2729907796 | 2728369276 | Bacteria | 5610032 |
| 258 | 2753268822 | 2751185782 | Bacteria | 11227053 |
| 259 | 2775655159 | 2775506735 | Bacteria | 4556596 |
| 260 | 2785366676 | 2784746768 | Bacteria | 10036182 |
| 261 | 2786667748 | 2786546132 | Bacteria | 10419719 |
| 262 | 2799184199 | 2799112218 | Bacteria | 4315149 |
| 263 | 2808827590 | 2808606357 | Bacteria | 4466944 |
| 264 | 2808852957 | 2808606360 | Bacteria | 4404006 |
| 265 | 2808878593 | 2808606366 | Bacteria | 4415912 |
| 266 | 2808891841 | 2808606370 | Bacteria | 4942454 |
| 267 | 2808896953 | 2808606371 | Bacteria | 4251511 |
| 268 | 2812320622 | 2811994871 | Bacteria | 4497550 |
| 269 | 2812353976 | 2811994879 | Bacteria | 9313447 |
| 270 | 2844853593 | 2844852863 | Bacteria | 3849151 |
| 271 | 2856746861 | 2856741275 | Bacteria | 8096094 |
| 272 | 2857738982 | 2857737099 | Bacteria | 3104305 |
| 273 | 2857741405 | 2857740372 | Bacteria | 4782044 |
| 274 | 2862507888 | 2862507626 | Bacteria | 9425308 |
| 275 | 2877683875 | 2877676314 | Bacteria | 9512378 |
| 276 | 2891557766 | 2891554331 | Bacteria | 8812224 |
| 277 | 2891565129 | 2891562705 | Bacteria | 8039471 |
| 278 | 2904499939 | 2904497146 | Bacteria | 4731781 |
| 279 | 2904502426 | 2904501621 | Bacteria | 3401437 |
| 280 | 2908677437 | 2908674828 | Bacteria | 3382763 |
| 281 | 2909076001 | 2909074476 | Bacteria | 3436050 |
| 282 | 2910810304 | 2910809715 | Bacteria | 4982797 |
| 283 | 2912716712 | 2912715099 | Bacteria | 9460473 |
| 284 | 2919042148 | 2919039151 | Bacteria | 3391018 |
| 285 | 2919045254 | 2919042368 | Bacteria | 3905917 |
| 286 | 2919391333 | 2919391150 | Bacteria | 4884741 |
| 287 | 2919542067 | 2919538618 | Bacteria | 4677069 |
| 288 | 2928106911 | 2928104781 | Bacteria | 3877447 |
| 289 | 2928503608 | 2928500415 | Bacteria | 3384541 |
| 290 | 2932429160 | 2932426870 | Bacteria | 4547726 |
| 291 | 2933420644 | 2933418574 | Bacteria | 4476724 |
| 292 | 2939648952 | 2939647034 | Bacteria | 4681660 |
| 293 | 2939676145 | 2939674588 | Bacteria | 4844420 |
| 294 | 2945921333 | 2945920336 | Bacteria | 4501603 |
| 295 | 2945942492 | 2945941187 | Bacteria | 4682474 |
| 296 | 2945959749 | 2945956166 | Bacteria | 5110334 |
| 297 | 2946038421 | 2946037020 | Bacteria | 4900426 |
| 298 | 2946071717 | 2946064051 | Bacteria | 8957905 |
| 299 | 2947232611 | 2947224130 | Bacteria | 9938529 |
| 300 | 2954008690 | 2954002825 | Bacteria | 9173742 |
| 301 | 2954389155 | 2954380949 | Bacteria | 10050426 |
| 302 | 2954673888 | 2954673503 | Bacteria | 9685905 |
| 303 | 2954690103 | 2954682443 | Bacteria | 9862841 |
| 304 | 2954699907 | 2954691527 | Bacteria | 10720516 |
| 305 | 2954702292 | 2954701450 | Bacteria | 10834262 |
| 306 | 2954718784 | 2954711539 | Bacteria | 10867210 |
| 307 | 2954728754 | 2954721474 | Bacteria | 10456478 |
| 308 | 2954733056 | 2954731030 | Bacteria | 10243860 |
| 309 | 2954747652 | 2954740390 | Bacteria | 10229294 |
| 310 | 2954751937 | 2954749733 | Bacteria | 10366972 |
| 311 | 2954766776 | 2954759201 | Bacteria | 9358192 |
| 312 | 2966922882 | 2966921586 | Bacteria | 3092803 |
| 313 | 2966926922 | 2966924647 | Bacteria | 3268643 |
| 314 | 2974306407 | 2974302888 | Bacteria | 4369871 |
| 315 | 2984552660 | 2984551494 | Bacteria | 3877562 |
| 316 | 3006327314 | 3006321560 | Bacteria | 8247479 |
| 317 | 8004022155 | 8004021418 | Bacteria | 4313954 |
| 318 | 8025482536 | 8025478263 | Bacteria | 8209203 |
| 319 | 8055070338 | 8055066027 | Bacteria | 9479577 |
| 320 | 8056040392 | 8056037122 | Bacteria | 3854319 |
| 321 | 8057346575 | 8057345674 | Bacteria | 4160394 |
| 322 | rootH1_10013456 | |||
| 323 | rootH2_10097191 | |||
| 324 | Ga0070666_10108156 | |||
| 325 | Ga0068868_100042825 | |||
| 326 | Ga0070660_100135241 | |||
| 327 | Ga0070691_10077952 | |||
| 328 | Ga0070668_100054092 | |||
| 329 | Ga0070671_100011238 | |||
| 330 | Ga0070674_100093469 | |||
| 331 | Ga0070673_100176288 | |||
| 332 | Ga0070659_100018205 | |||
| 333 | Ga0070667_100083790 | |||
| 334 | Ga0070703_10056103 | |||
| 335 | Ga0070710_10008142 | |||
| 336 | Ga0070711_100033544 | |||
| 337 | Ga0070705_100045234 | |||
| 338 | Ga0070694_100055330 | |||
| 339 | Ga0070708_100417827 | |||
| 340 | Ga0070663_100040605 | |||
| 341 | Ga0070662_100156835 | |||
| 342 | Ga0070699_100167738 | |||
| 343 | Ga0068853_100010758 | |||
| 344 | Ga0070695_100064468 | |||
| 345 | Ga0070696_100153902 | |||
| 346 | Ga0070665_100429468 | |||
| 347 | Ga0068855_100001894 | |||
| 348 | Ga0068855_100019054 | |||
| 349 | Ga0068855_100036059 | |||
| 350 | Ga0068856_100045261 | |||
| 351 | Ga0070702_100024140 | |||
| 352 | Ga0068859_100030889 | |||
| 353 | Ga0068864_100008103 | |||
| 354 | Ga0068861_100043161 | |||
| 355 | Ga0068863_100050452 | |||
| 356 | Ga0068858_100234884 | |||
| 357 | Ga0081540_1011836 | |||
| 358 | Ga0070717_10071828 | |||
| 359 | Ga0075363_100028240 | |||
| 360 | Ga0070716_100000713 | |||
| 361 | Ga0070712_100040171 | |||
| 362 | Ga0075433_10156195 | |||
| 363 | Ga0075434_100166340 | |||
| 364 | Ga0075436_100078399 | |||
| 365 | Ga0097620_100030889 | |||
| 366 | Ga0099826_10087983 | |||
| 367 | Ga0075435_100256813 | |||
| 368 | Ga0105244_10048643 | |||
| 369 | Ga0105240_10171517 | |||
| 370 | Ga0105245_10028652 | |||
| 371 | Ga0105247_10002194 | |||
| 372 | Ga0105247_10031548 | |||
| 373 | Ga0105241_10048427 | |||
| 374 | Ga0105242_10021663 | |||
| 375 | Ga0105248_10781545 | |||
| 376 | Ga0105237_10127966 | |||
| 377 | Ga0105237_10225076 | |||
| 378 | Ga0105237_10335353 | |||
| 379 | Ga0105238_10026963 | |||
| 380 | Ga0105249_10000724 | |||
| 381 | Ga0105239_10051781 | |||
| 382 | Ga0105239_10297331 | |||
| 383 | Ga0105246_10000516 | |||
| 384 | Ga0105246_10020930 | |||
| 385 | Ga0157373_10105210 | |||
| 386 | Ga0157374_10082064 | |||
| 387 | Ga0157378_10053236 | |||
| 388 | Ga0163162_10052939 | |||
| 389 | Ga0157372_10207035 | |||
| 390 | Ga0157375_10038616 | |||
| 391 | Ga0157375_10240699 | |||
| 392 | Ga0163163_10294101 | |||
| 393 | Ga0157380_10032991 | |||
| 394 | Ga0157376_10518116 | |||
| 395 | Ga0163161_10076901 | |||
| 396 | Ga0209758_1015430 | |||
| 397 | Ga0207697_10005872 | |||
| 398 | Ga0207655_1036323 | |||
| 399 | Ga0207710_10001696 | |||
| 400 | Ga0207710_10015373 | |||
| 401 | Ga0207688_10013957 | |||
| 402 | Ga0207699_10148196 | |||
| 403 | Ga0207654_10026853 | |||
| 404 | Ga0207671_10076617 | |||
| 405 | Ga0207671_10088318 | |||
| 406 | Ga0207693_10031457 | |||
| 407 | Ga0207657_10013303 | |||
| 408 | Ga0207681_10158608 | |||
| 409 | Ga0207687_10003778 | |||
| 410 | Ga0207644_10097184 | |||
| 411 | Ga0207690_10143622 | |||
| 412 | Ga0207706_10093117 | |||
| 413 | Ga0207665_10013872 | |||
| 414 | Ga0207667_10025029 | |||
| 415 | Ga0207667_10039682 | |||
| 416 | Ga0207667_10047944 | |||
| 417 | Ga0207651_10143530 | |||
| 418 | Ga0207712_10022798 | |||
| 419 | Ga0207668_10115110 | |||
| 420 | Ga0207640_10003538 | |||
| 421 | Ga0207658_10061393 | |||
| 422 | Ga0207677_10087633 | |||
| 423 | Ga0207639_10041495 | |||
| 424 | Ga0207678_10001227 | |||
| 425 | Ga0207702_10017153 | |||
| 426 | Ga0207676_10194540 | |||
| 427 | Ga0207674_10317966 | |||
| 428 | Ga0207675_100018034 | |||
| 429 | Ga0207698_10084743 | |||
| 430 | Ga0268266_10054753 | |||
| 431 | Ga0268265_10228029 | |||
| 432 | Ga0307515_10010042 | |||
| 433 | Ga0307515_10195795 | |||
| 434 | Ga0307513_10007417 | |||
| 435 | Ga0307408_100019622 | |||
| 436 | Ga0307508_10011124 | |||
| 437 | Ga0307410_10027270 | |||
| 438 | Ga0307410_10039514 | |||
| 439 | Ga0307412_10010774 | |||
| 440 | Ga0307414_10047188 | |||
| 441 | Ga0373932_0025587 | |||
| 442 | Ga0373942_0016114 | |||
| 443 | Ga0373962_0006568 | |||
| 444 | Ga0395900_0044580 | |||
| 445 | Ga0395898_0054344 | |||
| 446 | Ga0395901_0003883 | |||
| 447 | Ga0439438_001436 | |||
| 448 | Ga0439439_0000061 | |||
| 449 | Ga0439466_0000835 | |||
| 450 | Ga0451791_1154289 | |||
| 451 | Ga0451793_0831126 | |||
| 452 | Ga0451833_0259823 | |||
| 453 | Ga0451853_1882014 | |||
| 454 | Ga0439433_0000025 | |||
| 455 | Ga0439442_000185 | |||
| 456 | Ga0439442_000430 | |||
| 457 | Ga0439442_002333 | |||
| 458 | Ga0439448_0001209 | |||
| 459 | Ga0439432_000327 | |||
| 460 | Ga0439449_0087547 | |||
| 461 | Ga0439452_000557 | |||
| 462 | Ga0439457_000065 | |||
| 463 | Ga0439462_0000461 | |||
| 464 | Ga0450903_000055 | |||
| 465 | Ga0450907_001451 | |||
| 466 | Ga0450907_002292 | |||
| 467 | Ga0439458_0000060 | |||
| 468 | Ga0450908_007368 | |||
| 469 | Ga0450909_010633 | |||
| 470 | Ga0439434_0000308 | |||
| 471 | Ga0450918_001820 | |||
| 472 | Ga0466966_0073601 | |||
| 473 | Ga0466966_0079124 | |||
| 474 | Ga0466961_0010108 | |||
| 475 | Ga0466963_0018466 | |||
| 476 | Ga0466963_0041988 | |||
| 477 | Ga0466963_0089568 | |||
| 478 | Ga0466964_0034976 | |||
| 479 | Ga0466964_0049890 | |||
| 480 | Ga0466971_0004209 | |||
| 481 | Ga0466970_0022182 | |||
| 482 | Ga0466970_0039333 | |||
| 483 | Ga0466970_0086127 | |||
| 484 | Ga0466970_0133926 | |||
| 485 | Ga0466957_0064075 | |||
| 486 | Ga0466960_0081960 | |||
| 487 | Ga0466960_0114227 | |||
| 488 | Ga0466959_0011914 | |||
| 489 | Ga0466959_0296023 | |||
| 490 | Ga0466958_0159050 | |||
| 491 | Ga0466967_0002288 | |||
| 492 | Ga0466967_0014827 | |||
| 493 | Ga0466967_0025004 | |||
| 494 | Ga0466967_0124661 | |||
| 495 | Ga0466967_0150242 | |||
| 496 | Ga0495638_0189459 | |||
| 497 | Ga0495653_0045101 | |||
| 498 | Ga0495609_0018141 | |||
| 499 | Ga0496100_0234595 | |||
| 500 | Ga0496101_0139440 | |||
| 501 | Ga0496102_0000327 | |||
| 502 | Ga0496102_0098567 | |||
| 503 | Ga0496102_0120757 | |||
| 504 | Ga0496103_0000267 | |||
| 505 | Ga0496104_0537080 | |||
| 506 | Ga0496105_0270779 | |||
| 507 | Ga0496105_0424322 | |||
| 508 | Ga0496107_0042796 | |||
| 509 | Ga0496108_0278166 | |||
| 510 | Ga0496108_0371301 | |||
| 511 | Ga0496109_0188349 | |||
| 512 | Ga0496110_0506019 | |||
| 513 | Ga0496114_0003669 | |||
| 514 | Ga0496114_0011832 | |||
| 515 | Ga0496115_0075877 | |||
| 516 | Ga0496115_0254697 | |||
| 517 | Ga0496117_0000174 | |||
| 518 | Ga0496117_0000988 | |||
| 519 | Ga0496117_0039019 | |||
| 520 | Ga0496118_0001023 | |||
| 521 | Ga0496118_0004708 | |||
| 522 | Ga0496119_0015199 | |||
| 523 | Ga0496119_0036397 | |||
| 524 | Ga0496119_0053427 | |||
| 525 | Ga0496121_0012740 | |||
| 526 | Ga0496122_0001637 | |||
| 527 | Ga0496122_0039996 | |||
| 528 | Ga0496123_0042348 | |||
| 529 | Ga0496124_0000323 | |||
| 530 | Ga0496124_0023334 | |||
| 531 | Ga0496124_0118475 | |||
| 532 | Ga0496124_0170006 | |||
| 533 | Ga0496126_0000586 | |||
| 534 | Ga0496126_0053948 | |||
| 535 | Ga0501031_0012675 | |||
| 536 | Ga0501031_0136186 | |||
| 537 | Ga0501032_0029106 | |||
| 538 | Ga0501033_0062414 | |||
| 539 | Ga0501034_0042981 | |||
| 540 | Ga0501036_0024884 | |||
| 541 | Ga0501038_0009680 | |||
| 542 | Ga0501038_0028004 | |||
| 543 | Ga0501038_0031504 | |||
| 544 | Ga0501039_0018522 | |||
| 545 | Ga0501039_0065213 | |||
| 546 | Ga0501043_0081880 | |||
| 547 | Ga0501043_0152901 | |||
| 548 | Ga0501043_0291024 | |||
| 549 | Ga0501046_0057213 | |||
| 550 | Ga0501047_0062815 | |||
| 551 | Ga0501067_0022758 | |||
| 552 | Ga0501067_0029979 | |||
| 553 | Ga0501083_0021332 | |||
| 554 | Ga0501035_0007530 | |||
| 555 | Ga0501035_0009474 | |||
| 556 | Ga0501044_0024198 | |||
| 557 | Ga0501044_0028943 | |||
| 558 | Ga0501044_0069102 | |||
| 559 | nmdc:mga0yw44_221227_c1 | |||
| 560 | nmdc:mga08y16_734666_c1 | |||
| 561 | nmdc:mga0n895_181087_c1 | |||
| 562 | nmdc:mga0rr50_113532_c1 | |||
| 563 | nmdc:mga0a205_211662_c1 | |||
| 564 | Ga0500616_0000010 | |||
| 565 | Ga0500616_0024940 | |||
| 566 | Ga0587090_000109 | |||
| 567 | Ga0501082_0131181 | |||
| 568 | Ga0466962_0026796 | |||
| 569 | Ga0530510_0188391 | |||
| 570 | 2895888897 | |||
| 571 | 2537900491 | |||
| 572 | 2555231654 | |||
| 573 | 2644263433 | |||
| 574 | 2655032149 | |||
| 575 | 2676480043 | |||
| 576 | 2686536598 | |||
| 577 | 2710605414 | |||
| 578 | 2729907796 | |||
| 579 | 2753268822 | |||
| 580 | 2775655159 | |||
| 581 | 2785366676 | |||
| 582 | 2786667748 | |||
| 583 | 2799184199 | |||
| 584 | 2808827590 | |||
| 585 | 2808852957 | |||
| 586 | 2808878593 | |||
| 587 | 2808891841 | |||
| 588 | 2808896953 | |||
| 589 | 2812320622 | |||
| 590 | 2812353976 | |||
| 591 | 2844853593 | |||
| 592 | 2856746861 | |||
| 593 | 2857738982 | |||
| 594 | 2857741405 | |||
| 595 | 2862507888 | |||
| 596 | 2877683875 | |||
| 597 | 2891557766 | |||
| 598 | 2891565129 | |||
| 599 | 2904499939 | |||
| 600 | 2904502426 | |||
| 601 | 2908677437 | |||
| 602 | 2909076001 | |||
| 603 | 2910810304 | |||
| 604 | 2912716712 | |||
| 605 | 2919042148 | |||
| 606 | 2919045254 | |||
| 607 | 2919391333 | |||
| 608 | 2919542067 | |||
| 609 | 2928106911 | |||
| 610 | 2928503608 | |||
| 611 | 2932429160 | |||
| 612 | 2933420644 | |||
| 613 | 2939648952 | |||
| 614 | 2939676145 | |||
| 615 | 2945921333 | |||
| 616 | 2945942492 | |||
| 617 | 2945959749 | |||
| 618 | 2946038421 | |||
| 619 | 2946071717 | |||
| 620 | 2947232611 | |||
| 621 | 2954008690 | |||
| 622 | 2954389155 | |||
| 623 | 2954673888 | |||
| 624 | 2954690103 | |||
| 625 | 2954699907 | |||
| 626 | 2954702292 | |||
| 627 | 2954718784 | |||
| 628 | 2954728754 | |||
| 629 | 2954733056 | |||
| 630 | 2954747652 | |||
| 631 | 2954751937 | |||
| 632 | 2954766776 | |||
| 633 | 2966922882 | |||
| 634 | 2966926922 | |||
| 635 | 2974306407 | |||
| 636 | 2984552660 | |||
| 637 | 3006327314 | |||
| 638 | 8004022155 | |||
| 639 | 8025482536 | |||
| 640 | 8055070338 | |||
| 641 | 8056040392 | |||
| 642 | 8057346575 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.7712 | 21 | 254 |
| 5b58-assembly1.cif.gz_B | inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia | 0.7632 | 21 | 253 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.7527 | 19 | 254 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.7316 | 16 | 246 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.6955 | 19 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39832_7_260_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8238 | 23 | 256 | 1.10.3470.10 |
| af_Q2FY18_5_276_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7776 | 19 | 261 | 1.10.3470.10 |
| af_P39832_7_260_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7631 | 23 | 256 | 1.10.3470.10 |
| af_Q2FW77_7_322_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7549 | 17 | 253 | 1.10.3470.10 |
| af_P23877_5_330_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7477 | 17 | 261 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0L5P2-F1-model_v4 | Metal ABC transporter permease | 0.9356 | 21 | 194 |
GO:0010043
GO:0043190 GO:0055085 |
| AF-A0A259SGM8-F1-model_v4 | ABC transporter permease | 0.9216 | 9 | 196 |
GO:0010043
GO:0043190 GO:0055085 |
| AF-A0A356QX65-F1-model_v4 | High-affinity zinc uptake system membrane protein ZnuB | 0.9104 | 19 | 190 |
GO:0006829
GO:0010043 GO:0043190 GO:0055085 |
| AF-A0A7Y3JEV1-F1-model_v4 | Metal ABC transporter permease | 0.9054 | 21 | 177 |
GO:0010043
GO:0043190 GO:0055085 |
| AF-A0A4Q3C4P7-F1-model_v4 | deleted | 0.8886 | 15 | 192 |
|