F406232

General Info

Members Datasets Scaffolds Average Seq Length
321 264 642 290

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895880812|2895888897
Length 323
Sequence ERMFVFDDYGELLSLLHNSIIAGAVLGVVCGVISVFVTYRDLAFAVHGVSELSFAGAAGFLLLGANVVTGSLIGALLAALLIGLLGERARDRNSVIGVLMPFGLGLGVLFLALYKGRAANKFGLLTGQIVAVDASRLAVLSAIAAVVLAALAVLWRPLTFASLDPEVATARGVPLRLLGPTFMLLLGATVAAAIQVVGALLVLSVVCTPGVAATMVTARRGLATALSVLFATVSTVGGILLALGGTLPISPYITTLSFAIYLGCRVFAAVRGVRSRRGHRSDRHGPSSSLEDRLPLTGSVTGPRLHPSVVGFYAPPEAVSRTE

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
120 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
125 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
128 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
193 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
194 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
195 2643221647 Streptomyces sp. Root369 Isolate Unclassified
196 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
197 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
198 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
199 2710264753 Frankia sp. KB5 Isolate Nodule
200 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
201 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
202 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
203 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
204 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
205 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
206 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
207 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
208 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
209 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
210 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
211 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
212 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
213 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
214 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
215 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
216 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
217 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
218 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
219 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
220 2891562705 Microbispora tritici MT50 Isolate Unclassified
221 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
222 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
223 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
224 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
225 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
226 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
227 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
228 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
229 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
230 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
231 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
232 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
233 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
234 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
235 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
236 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
237 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
238 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
239 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
240 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
241 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
242 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
243 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
244 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
245 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
246 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
247 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
248 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
249 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
250 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
251 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
252 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
253 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
254 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
255 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
256 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
257 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
258 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
259 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
260 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
261 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
262 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
263 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
264 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.95
Metatranscriptomes 0.31
Isolates 22.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 1.56
Nodule 0.62
Rhizoplane 6.23
Rhizosphere 74.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10013456 3300003316 Bacteria 2758
2 rootH2_10097191 3300003320 Bacteria 1297
3 Ga0070666_10108156 3300005335 Bacteria 1921
4 Ga0068868_100042825 3300005338 Bacteria 3535
5 Ga0070660_100135241 3300005339 Bacteria 1975
6 Ga0070691_10077952 3300005341 Bacteria 1618
7 Ga0070668_100054092 3300005347 Bacteria 3096
8 Ga0070671_100011238 3300005355 Bacteria 7191
9 Ga0070674_100093469 3300005356 Bacteria 2176
10 Ga0070673_100176288 3300005364 Bacteria 1827
11 Ga0070659_100018205 3300005366 Bacteria 5300
12 Ga0070667_100083790 3300005367 Bacteria 2732
13 Ga0070703_10056103 3300005406 Bacteria 1274
14 Ga0070710_10008142 3300005437 Bacteria 5096
15 Ga0070711_100033544 3300005439 Bacteria 3418
16 Ga0070705_100045234 3300005440 Bacteria 2532
17 Ga0070694_100055330 3300005444 Bacteria 2691
18 Ga0070708_100417827 3300005445 Bacteria 1265
19 Ga0070663_100040605 3300005455 Bacteria 3259
20 Ga0070662_100156835 3300005457 Bacteria 1777
21 Ga0070699_100167738 3300005518 Bacteria 1945
22 Ga0068853_100010758 3300005539 Bacteria 7410
23 Ga0070695_100064468 3300005545 Bacteria 2384
24 Ga0070696_100153902 3300005546 Bacteria 1690
25 Ga0070665_100429468 3300005548 Bacteria 1330
26 Ga0068855_100001894 3300005563 Bacteria 25943
27 Ga0068855_100019054 3300005563 Bacteria 8250
28 Ga0068855_100036059 3300005563 Bacteria 5888
29 Ga0068856_100045261 3300005614 Bacteria 4332
30 Ga0070702_100024140 3300005615 Bacteria 3240
31 Ga0068859_100030889 3300005617 Bacteria 5376
32 Ga0068864_100008103 3300005618 Bacteria 8662
33 Ga0068861_100043161 3300005719 Bacteria 3382
34 Ga0068863_100050452 3300005841 Bacteria 3944
35 Ga0068858_100234884 3300005842 Bacteria 1738
36 Ga0081540_1011836 3300005983 Bacteria 5796
37 Ga0070717_10071828 3300006028 Bacteria 2888
38 Ga0075363_100028240 3300006048 Bacteria 2884
39 Ga0070716_100000713 3300006173 Bacteria 14187
40 Ga0070712_100040171 3300006175 Bacteria 3206
41 Ga0075433_10156195 3300006852 Bacteria 2030
42 Ga0075434_100166340 3300006871 Bacteria 2225
43 Ga0075436_100078399 3300006914 Bacteria 2289
44 Ga0097620_100030889 3300006931 Bacteria 5376
45 Ga0099826_10087983 3300006948 Bacteria 1910
46 Ga0075435_100256813 3300007076 Bacteria 1488
47 Ga0105244_10048643 3300009036 Bacteria 2169
48 Ga0105240_10171517 3300009093 Bacteria 2569
49 Ga0105245_10028652 3300009098 Bacteria 4914
50 Ga0105247_10002194 3300009101 Bacteria 13448
51 Ga0105247_10031548 3300009101 Bacteria 3216
52 Ga0105241_10048427 3300009174 Bacteria 3235
53 Ga0105242_10021663 3300009176 Bacteria 5048
54 Ga0105248_10781545 3300009177 Bacteria 1077
55 Ga0105237_10127966 3300009545 Bacteria 2534
56 Ga0105237_10225076 3300009545 Bacteria 1876
57 Ga0105237_10335353 3300009545 Bacteria 1517
58 Ga0105238_10026963 3300009551 Bacteria 5856
59 Ga0105249_10000724 3300009553 Bacteria 30062
60 Ga0105239_10051781 3300010375 Bacteria 4500
61 Ga0105239_10297331 3300010375 Bacteria 1818
62 Ga0105246_10000516 3300011119 Bacteria 21049
63 Ga0105246_10020930 3300011119 Bacteria 4201
64 Ga0157373_10105210 3300013100 Bacteria 1985
65 Ga0157374_10082064 3300013296 Bacteria 3060
66 Ga0157378_10053236 3300013297 Bacteria 3604
67 Ga0163162_10052939 3300013306 Bacteria 4079
68 Ga0157372_10207035 3300013307 Bacteria 2273
69 Ga0157375_10038616 3300013308 Bacteria 4584
70 Ga0157375_10240699 3300013308 Bacteria 1969
71 Ga0163163_10294101 3300014325 Bacteria 1676
72 Ga0157380_10032991 3300014326 Bacteria 3985
73 Ga0157376_10518116 3300014969 Bacteria 1175
74 Ga0163161_10076901 3300017792 Bacteria 2451
75 Ga0209758_1015430 3300025297 Bacteria 3955
76 Ga0207697_10005872 3300025315 Bacteria 5640
77 Ga0207655_1036323 3300025728 Bacteria 2186
78 Ga0207710_10001696 3300025900 Bacteria 10686
79 Ga0207710_10015373 3300025900 Bacteria 3233
80 Ga0207688_10013957 3300025901 Bacteria 4367
81 Ga0207699_10148196 3300025906 Bacteria 1549
82 Ga0207654_10026853 3300025911 Bacteria 3123
83 Ga0207671_10076617 3300025914 Bacteria 2503
84 Ga0207671_10088318 3300025914 Bacteria 2332
85 Ga0207693_10031457 3300025915 Bacteria 4193
86 Ga0207657_10013303 3300025919 Bacteria 8072
87 Ga0207681_10158608 3300025923 Bacteria 1703
88 Ga0207687_10003778 3300025927 Bacteria 10177
89 Ga0207644_10097184 3300025931 Bacteria 2206
90 Ga0207690_10143622 3300025932 Bacteria 1762
91 Ga0207706_10093117 3300025933 Bacteria 2650
92 Ga0207665_10013872 3300025939 Bacteria 5299
93 Ga0207667_10025029 3300025949 Bacteria 6542
94 Ga0207667_10039682 3300025949 Bacteria 5016
95 Ga0207667_10047944 3300025949 Bacteria 4519
96 Ga0207651_10143530 3300025960 Bacteria 1848
97 Ga0207712_10022798 3300025961 Bacteria 4126
98 Ga0207668_10115110 3300025972 Bacteria 2025
99 Ga0207640_10003538 3300025981 Bacteria 8424
100 Ga0207658_10061393 3300025986 Bacteria 2809
101 Ga0207677_10087633 3300026023 Bacteria 2254
102 Ga0207639_10041495 3300026041 Bacteria 3443
103 Ga0207678_10001227 3300026067 Bacteria 23601
104 Ga0207702_10017153 3300026078 Bacteria 5990
105 Ga0207676_10194540 3300026095 Bacteria 1787
106 Ga0207674_10317966 3300026116 Bacteria 1506
107 Ga0207675_100018034 3300026118 Bacteria 6582
108 Ga0207698_10084743 3300026142 Bacteria 2570
109 Ga0268266_10054753 3300028379 Bacteria 3429
110 Ga0268265_10228029 3300028380 Bacteria 1635
111 Ga0307515_10010042 3300028794 Bacteria 18207
112 Ga0307515_10195795 3300028794 Bacteria 1914
113 Ga0307513_10007417 3300031456 Bacteria 14222
114 Ga0307408_100019622 3300031548 Bacteria 4554
115 Ga0307508_10011124 3300031616 Bacteria 8228
116 Ga0307410_10027270 3300031852 Bacteria 3608
117 Ga0307410_10039514 3300031852 Bacteria 3098
118 Ga0307412_10010774 3300031911 Bacteria 5275
119 Ga0307414_10047188 3300032004 Bacteria 2963
120 Ga0373932_0025587 3300035112 Bacteria 1599
121 Ga0373942_0016114 3300035207 Bacteria 1830
122 Ga0373962_0006568 3300035242 Bacteria 2819
123 Ga0395900_0044580 3300037418 Bacteria 4569
124 Ga0395898_0054344 3300037466 Bacteria 3908
125 Ga0395901_0003883 3300038443 Bacteria 15025
126 Ga0439438_001436 3300041405 Bacteria 10514
127 Ga0439439_0000061 3300041406 Bacteria 13847
128 Ga0439466_0000835 3300041411 Bacteria 11718
129 Ga0451791_1154289 3300041451 Bacteria 1182
130 Ga0451793_0831126 3300041452 Bacteria 1296
131 Ga0451833_0259823 3300041491 Bacteria 1398
132 Ga0451853_1882014 3300041512 Bacteria 1036
133 Ga0439433_0000025 3300041999 Bacteria 18287
134 Ga0439442_000185 3300042002 Bacteria 15881
135 Ga0439442_000430 3300042002 Bacteria 9602
136 Ga0439442_002333 3300042002 Bacteria 3726
137 Ga0439448_0001209 3300042005 Bacteria 6587
138 Ga0439432_000327 3300042006 Bacteria 17281
139 Ga0439449_0087547 3300042007 Bacteria 1149
140 Ga0439452_000557 3300042010 Bacteria 19683
141 Ga0439457_000065 3300042014 Bacteria 22689
142 Ga0439462_0000461 3300042015 Bacteria 7979
143 Ga0450903_000055 3300042138 Bacteria 23409
144 Ga0450907_001451 3300042146 Bacteria 5117
145 Ga0450907_002292 3300042146 Bacteria 3706
146 Ga0439458_0000060 3300042157 Bacteria 19058
147 Ga0450908_007368 3300042184 Bacteria 2074
148 Ga0450909_010633 3300042185 Bacteria 1346
149 Ga0439434_0000308 3300042435 Bacteria 13850
150 Ga0450918_001820 3300042531 Bacteria 4159
151 Ga0466966_0073601 3300044684 Bacteria 2136
152 Ga0466966_0079124 3300044684 Bacteria 2049
153 Ga0466961_0010108 3300044693 Bacteria 6012
154 Ga0466963_0018466 3300044694 Bacteria 4361
155 Ga0466963_0041988 3300044694 Bacteria 3001
156 Ga0466963_0089568 3300044694 Bacteria 2093
157 Ga0466964_0034976 3300044706 Bacteria 2007
158 Ga0466964_0049890 3300044706 Bacteria 1714
159 Ga0466971_0004209 3300044719 Bacteria 6201
160 Ga0466970_0022182 3300044765 Bacteria 3314
161 Ga0466970_0039333 3300044765 Bacteria 2509
162 Ga0466970_0086127 3300044765 Bacteria 1703
163 Ga0466970_0133926 3300044765 Bacteria 1362
164 Ga0466957_0064075 3300044842 Bacteria 2261
165 Ga0466960_0081960 3300044901 Bacteria 1628
166 Ga0466960_0114227 3300044901 Bacteria 1407
167 Ga0466959_0011914 3300045049 Bacteria 6268
168 Ga0466959_0296023 3300045049 Bacteria 1109
169 Ga0466958_0159050 3300045836 Bacteria 1426
170 Ga0466967_0002288 3300045976 Bacteria 11823
171 Ga0466967_0014827 3300045976 Bacteria 6088
172 Ga0466967_0025004 3300045976 Bacteria 4918
173 Ga0466967_0124661 3300045976 Bacteria 2385
174 Ga0466967_0150242 3300045976 Bacteria 2176
175 Ga0495638_0189459 3300046460 Bacteria 1168
176 Ga0495653_0045101 3300046463 Bacteria 3419
177 Ga0495609_0018141 3300046538 Bacteria 3264
178 Ga0496100_0234595 3300048903 Bacteria 1351
179 Ga0496101_0139440 3300048904 Bacteria 1847
180 Ga0496102_0000327 3300048905 Bacteria 59228
181 Ga0496102_0098567 3300048905 Bacteria 2712
182 Ga0496102_0120757 3300048905 Bacteria 2447
183 Ga0496103_0000267 3300048906 Bacteria 49943
184 Ga0496104_0537080 3300048907 Bacteria 1080
185 Ga0496105_0270779 3300048908 Bacteria 1371
186 Ga0496105_0424322 3300048908 Bacteria 1053
187 Ga0496107_0042796 3300048910 Bacteria 3253
188 Ga0496108_0278166 3300048911 Bacteria 1457
189 Ga0496108_0371301 3300048911 Bacteria 1249
190 Ga0496109_0188349 3300048912 Bacteria 1938
191 Ga0496110_0506019 3300048913 Bacteria 1099
192 Ga0496114_0003669 3300048917 Bacteria 11811
193 Ga0496114_0011832 3300048917 Bacteria 6980
194 Ga0496115_0075877 3300048918 Bacteria 2732
195 Ga0496115_0254697 3300048918 Bacteria 1444
196 Ga0496117_0000174 3300048920 Bacteria 132648
197 Ga0496117_0000988 3300048920 Bacteria 43571
198 Ga0496117_0039019 3300048920 Bacteria 3511
199 Ga0496118_0001023 3300048921 Bacteria 43511
200 Ga0496118_0004708 3300048921 Bacteria 15978
201 Ga0496119_0015199 3300048922 Bacteria 5954
202 Ga0496119_0036397 3300048922 Bacteria 3213
203 Ga0496119_0053427 3300048922 Bacteria 2468
204 Ga0496121_0012740 3300048924 Bacteria 9113
205 Ga0496122_0001637 3300048925 Bacteria 34821
206 Ga0496122_0039996 3300048925 Bacteria 3733
207 Ga0496123_0042348 3300048926 Bacteria 3143
208 Ga0496124_0000323 3300048927 Bacteria 88352
209 Ga0496124_0023334 3300048927 Bacteria 5649
210 Ga0496124_0118475 3300048927 Bacteria 2119
211 Ga0496124_0170006 3300048927 Bacteria 1689
212 Ga0496126_0000586 3300048929 Bacteria 68837
213 Ga0496126_0053948 3300048929 Bacteria 3644
214 Ga0501031_0012675 3300049568 Bacteria 5506
215 Ga0501031_0136186 3300049568 Bacteria 1604
216 Ga0501032_0029106 3300049569 Bacteria 3793
217 Ga0501033_0062414 3300049570 Bacteria 2744
218 Ga0501034_0042981 3300049571 Bacteria 4574
219 Ga0501036_0024884 3300049572 Bacteria 5049
220 Ga0501038_0009680 3300049574 Bacteria 8839
221 Ga0501038_0028004 3300049574 Bacteria 5006
222 Ga0501038_0031504 3300049574 Bacteria 4686
223 Ga0501039_0018522 3300049575 Bacteria 5346
224 Ga0501039_0065213 3300049575 Bacteria 2825
225 Ga0501043_0081880 3300049579 Bacteria 2536
226 Ga0501043_0152901 3300049579 Bacteria 1805
227 Ga0501043_0291024 3300049579 Bacteria 1250
228 Ga0501046_0057213 3300049580 Bacteria 3059
229 Ga0501047_0062815 3300049581 Bacteria 3582
230 Ga0501067_0022758 3300049583 Bacteria 3469
231 Ga0501067_0029979 3300049583 Bacteria 3016
232 Ga0501083_0021332 3300049744 Bacteria 4500
233 Ga0501035_0007530 3300049822 Bacteria 10173
234 Ga0501035_0009474 3300049822 Bacteria 9054
235 Ga0501044_0024198 3300049823 Bacteria 6451
236 Ga0501044_0028943 3300049823 Bacteria 5843
237 Ga0501044_0069102 3300049823 Bacteria 3597
238 nmdc:mga0yw44_221227_c1 3300050492 Bacteria 1255
239 nmdc:mga08y16_734666_c1 3300050511 Bacteria 984
240 nmdc:mga0n895_181087_c1 3300050512 Bacteria 2139
241 nmdc:mga0rr50_113532_c1 3300050513 Bacteria 2147
242 nmdc:mga0a205_211662_c1 3300050515 Bacteria 1827
243 Ga0500616_0000010 3300053153 Bacteria 761410
244 Ga0500616_0024940 3300053153 Bacteria 3319
245 Ga0587090_000109 3300059510 Bacteria 5135
246 Ga0501082_0131181 3300060353 Bacteria 2174
247 Ga0466962_0026796 3300061719 Bacteria 2768
248 Ga0530510_0188391 3300061734 Bacteria 1531
249 2895888897 2895880812 Bacteria 11255272
250 2537900491 2537561592 Bacteria 4348607
251 2555231654 2554235227 Bacteria 3637389
252 2644263433 2643221647 Bacteria 10741251
253 2655032149 2654587600 Bacteria 3911798
254 2676480043 2675903059 Bacteria 8644972
255 2686536598 2684623035 Bacteria 8032739
256 2710605414 2710264753 Bacteria 5455564
257 2729907796 2728369276 Bacteria 5610032
258 2753268822 2751185782 Bacteria 11227053
259 2775655159 2775506735 Bacteria 4556596
260 2785366676 2784746768 Bacteria 10036182
261 2786667748 2786546132 Bacteria 10419719
262 2799184199 2799112218 Bacteria 4315149
263 2808827590 2808606357 Bacteria 4466944
264 2808852957 2808606360 Bacteria 4404006
265 2808878593 2808606366 Bacteria 4415912
266 2808891841 2808606370 Bacteria 4942454
267 2808896953 2808606371 Bacteria 4251511
268 2812320622 2811994871 Bacteria 4497550
269 2812353976 2811994879 Bacteria 9313447
270 2844853593 2844852863 Bacteria 3849151
271 2856746861 2856741275 Bacteria 8096094
272 2857738982 2857737099 Bacteria 3104305
273 2857741405 2857740372 Bacteria 4782044
274 2862507888 2862507626 Bacteria 9425308
275 2877683875 2877676314 Bacteria 9512378
276 2891557766 2891554331 Bacteria 8812224
277 2891565129 2891562705 Bacteria 8039471
278 2904499939 2904497146 Bacteria 4731781
279 2904502426 2904501621 Bacteria 3401437
280 2908677437 2908674828 Bacteria 3382763
281 2909076001 2909074476 Bacteria 3436050
282 2910810304 2910809715 Bacteria 4982797
283 2912716712 2912715099 Bacteria 9460473
284 2919042148 2919039151 Bacteria 3391018
285 2919045254 2919042368 Bacteria 3905917
286 2919391333 2919391150 Bacteria 4884741
287 2919542067 2919538618 Bacteria 4677069
288 2928106911 2928104781 Bacteria 3877447
289 2928503608 2928500415 Bacteria 3384541
290 2932429160 2932426870 Bacteria 4547726
291 2933420644 2933418574 Bacteria 4476724
292 2939648952 2939647034 Bacteria 4681660
293 2939676145 2939674588 Bacteria 4844420
294 2945921333 2945920336 Bacteria 4501603
295 2945942492 2945941187 Bacteria 4682474
296 2945959749 2945956166 Bacteria 5110334
297 2946038421 2946037020 Bacteria 4900426
298 2946071717 2946064051 Bacteria 8957905
299 2947232611 2947224130 Bacteria 9938529
300 2954008690 2954002825 Bacteria 9173742
301 2954389155 2954380949 Bacteria 10050426
302 2954673888 2954673503 Bacteria 9685905
303 2954690103 2954682443 Bacteria 9862841
304 2954699907 2954691527 Bacteria 10720516
305 2954702292 2954701450 Bacteria 10834262
306 2954718784 2954711539 Bacteria 10867210
307 2954728754 2954721474 Bacteria 10456478
308 2954733056 2954731030 Bacteria 10243860
309 2954747652 2954740390 Bacteria 10229294
310 2954751937 2954749733 Bacteria 10366972
311 2954766776 2954759201 Bacteria 9358192
312 2966922882 2966921586 Bacteria 3092803
313 2966926922 2966924647 Bacteria 3268643
314 2974306407 2974302888 Bacteria 4369871
315 2984552660 2984551494 Bacteria 3877562
316 3006327314 3006321560 Bacteria 8247479
317 8004022155 8004021418 Bacteria 4313954
318 8025482536 8025478263 Bacteria 8209203
319 8055070338 8055066027 Bacteria 9479577
320 8056040392 8056037122 Bacteria 3854319
321 8057346575 8057345674 Bacteria 4160394
322 rootH1_10013456
323 rootH2_10097191
324 Ga0070666_10108156
325 Ga0068868_100042825
326 Ga0070660_100135241
327 Ga0070691_10077952
328 Ga0070668_100054092
329 Ga0070671_100011238
330 Ga0070674_100093469
331 Ga0070673_100176288
332 Ga0070659_100018205
333 Ga0070667_100083790
334 Ga0070703_10056103
335 Ga0070710_10008142
336 Ga0070711_100033544
337 Ga0070705_100045234
338 Ga0070694_100055330
339 Ga0070708_100417827
340 Ga0070663_100040605
341 Ga0070662_100156835
342 Ga0070699_100167738
343 Ga0068853_100010758
344 Ga0070695_100064468
345 Ga0070696_100153902
346 Ga0070665_100429468
347 Ga0068855_100001894
348 Ga0068855_100019054
349 Ga0068855_100036059
350 Ga0068856_100045261
351 Ga0070702_100024140
352 Ga0068859_100030889
353 Ga0068864_100008103
354 Ga0068861_100043161
355 Ga0068863_100050452
356 Ga0068858_100234884
357 Ga0081540_1011836
358 Ga0070717_10071828
359 Ga0075363_100028240
360 Ga0070716_100000713
361 Ga0070712_100040171
362 Ga0075433_10156195
363 Ga0075434_100166340
364 Ga0075436_100078399
365 Ga0097620_100030889
366 Ga0099826_10087983
367 Ga0075435_100256813
368 Ga0105244_10048643
369 Ga0105240_10171517
370 Ga0105245_10028652
371 Ga0105247_10002194
372 Ga0105247_10031548
373 Ga0105241_10048427
374 Ga0105242_10021663
375 Ga0105248_10781545
376 Ga0105237_10127966
377 Ga0105237_10225076
378 Ga0105237_10335353
379 Ga0105238_10026963
380 Ga0105249_10000724
381 Ga0105239_10051781
382 Ga0105239_10297331
383 Ga0105246_10000516
384 Ga0105246_10020930
385 Ga0157373_10105210
386 Ga0157374_10082064
387 Ga0157378_10053236
388 Ga0163162_10052939
389 Ga0157372_10207035
390 Ga0157375_10038616
391 Ga0157375_10240699
392 Ga0163163_10294101
393 Ga0157380_10032991
394 Ga0157376_10518116
395 Ga0163161_10076901
396 Ga0209758_1015430
397 Ga0207697_10005872
398 Ga0207655_1036323
399 Ga0207710_10001696
400 Ga0207710_10015373
401 Ga0207688_10013957
402 Ga0207699_10148196
403 Ga0207654_10026853
404 Ga0207671_10076617
405 Ga0207671_10088318
406 Ga0207693_10031457
407 Ga0207657_10013303
408 Ga0207681_10158608
409 Ga0207687_10003778
410 Ga0207644_10097184
411 Ga0207690_10143622
412 Ga0207706_10093117
413 Ga0207665_10013872
414 Ga0207667_10025029
415 Ga0207667_10039682
416 Ga0207667_10047944
417 Ga0207651_10143530
418 Ga0207712_10022798
419 Ga0207668_10115110
420 Ga0207640_10003538
421 Ga0207658_10061393
422 Ga0207677_10087633
423 Ga0207639_10041495
424 Ga0207678_10001227
425 Ga0207702_10017153
426 Ga0207676_10194540
427 Ga0207674_10317966
428 Ga0207675_100018034
429 Ga0207698_10084743
430 Ga0268266_10054753
431 Ga0268265_10228029
432 Ga0307515_10010042
433 Ga0307515_10195795
434 Ga0307513_10007417
435 Ga0307408_100019622
436 Ga0307508_10011124
437 Ga0307410_10027270
438 Ga0307410_10039514
439 Ga0307412_10010774
440 Ga0307414_10047188
441 Ga0373932_0025587
442 Ga0373942_0016114
443 Ga0373962_0006568
444 Ga0395900_0044580
445 Ga0395898_0054344
446 Ga0395901_0003883
447 Ga0439438_001436
448 Ga0439439_0000061
449 Ga0439466_0000835
450 Ga0451791_1154289
451 Ga0451793_0831126
452 Ga0451833_0259823
453 Ga0451853_1882014
454 Ga0439433_0000025
455 Ga0439442_000185
456 Ga0439442_000430
457 Ga0439442_002333
458 Ga0439448_0001209
459 Ga0439432_000327
460 Ga0439449_0087547
461 Ga0439452_000557
462 Ga0439457_000065
463 Ga0439462_0000461
464 Ga0450903_000055
465 Ga0450907_001451
466 Ga0450907_002292
467 Ga0439458_0000060
468 Ga0450908_007368
469 Ga0450909_010633
470 Ga0439434_0000308
471 Ga0450918_001820
472 Ga0466966_0073601
473 Ga0466966_0079124
474 Ga0466961_0010108
475 Ga0466963_0018466
476 Ga0466963_0041988
477 Ga0466963_0089568
478 Ga0466964_0034976
479 Ga0466964_0049890
480 Ga0466971_0004209
481 Ga0466970_0022182
482 Ga0466970_0039333
483 Ga0466970_0086127
484 Ga0466970_0133926
485 Ga0466957_0064075
486 Ga0466960_0081960
487 Ga0466960_0114227
488 Ga0466959_0011914
489 Ga0466959_0296023
490 Ga0466958_0159050
491 Ga0466967_0002288
492 Ga0466967_0014827
493 Ga0466967_0025004
494 Ga0466967_0124661
495 Ga0466967_0150242
496 Ga0495638_0189459
497 Ga0495653_0045101
498 Ga0495609_0018141
499 Ga0496100_0234595
500 Ga0496101_0139440
501 Ga0496102_0000327
502 Ga0496102_0098567
503 Ga0496102_0120757
504 Ga0496103_0000267
505 Ga0496104_0537080
506 Ga0496105_0270779
507 Ga0496105_0424322
508 Ga0496107_0042796
509 Ga0496108_0278166
510 Ga0496108_0371301
511 Ga0496109_0188349
512 Ga0496110_0506019
513 Ga0496114_0003669
514 Ga0496114_0011832
515 Ga0496115_0075877
516 Ga0496115_0254697
517 Ga0496117_0000174
518 Ga0496117_0000988
519 Ga0496117_0039019
520 Ga0496118_0001023
521 Ga0496118_0004708
522 Ga0496119_0015199
523 Ga0496119_0036397
524 Ga0496119_0053427
525 Ga0496121_0012740
526 Ga0496122_0001637
527 Ga0496122_0039996
528 Ga0496123_0042348
529 Ga0496124_0000323
530 Ga0496124_0023334
531 Ga0496124_0118475
532 Ga0496124_0170006
533 Ga0496126_0000586
534 Ga0496126_0053948
535 Ga0501031_0012675
536 Ga0501031_0136186
537 Ga0501032_0029106
538 Ga0501033_0062414
539 Ga0501034_0042981
540 Ga0501036_0024884
541 Ga0501038_0009680
542 Ga0501038_0028004
543 Ga0501038_0031504
544 Ga0501039_0018522
545 Ga0501039_0065213
546 Ga0501043_0081880
547 Ga0501043_0152901
548 Ga0501043_0291024
549 Ga0501046_0057213
550 Ga0501047_0062815
551 Ga0501067_0022758
552 Ga0501067_0029979
553 Ga0501083_0021332
554 Ga0501035_0007530
555 Ga0501035_0009474
556 Ga0501044_0024198
557 Ga0501044_0028943
558 Ga0501044_0069102
559 nmdc:mga0yw44_221227_c1
560 nmdc:mga08y16_734666_c1
561 nmdc:mga0n895_181087_c1
562 nmdc:mga0rr50_113532_c1
563 nmdc:mga0a205_211662_c1
564 Ga0500616_0000010
565 Ga0500616_0024940
566 Ga0587090_000109
567 Ga0501082_0131181
568 Ga0466962_0026796
569 Ga0530510_0188391
570 2895888897
571 2537900491
572 2555231654
573 2644263433
574 2655032149
575 2676480043
576 2686536598
577 2710605414
578 2729907796
579 2753268822
580 2775655159
581 2785366676
582 2786667748
583 2799184199
584 2808827590
585 2808852957
586 2808878593
587 2808891841
588 2808896953
589 2812320622
590 2812353976
591 2844853593
592 2856746861
593 2857738982
594 2857741405
595 2862507888
596 2877683875
597 2891557766
598 2891565129
599 2904499939
600 2904502426
601 2908677437
602 2909076001
603 2910810304
604 2912716712
605 2919042148
606 2919045254
607 2919391333
608 2919542067
609 2928106911
610 2928503608
611 2932429160
612 2933420644
613 2939648952
614 2939676145
615 2945921333
616 2945942492
617 2945959749
618 2946038421
619 2946071717
620 2947232611
621 2954008690
622 2954389155
623 2954673888
624 2954690103
625 2954699907
626 2954702292
627 2954718784
628 2954728754
629 2954733056
630 2954747652
631 2954751937
632 2954766776
633 2966922882
634 2966926922
635 2974306407
636 2984552660
637 3006327314
638 8004022155
639 8025482536
640 8055070338
641 8056040392
642 8057346575

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

13

268

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.7712 21 254
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.7632 21 253
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.7527 19 254
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.7316 16 246
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.6955 19 254
ID Description Score Start End Superfamily
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8238 23 256 1.10.3470.10
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7776 19 261 1.10.3470.10
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7631 23 256 1.10.3470.10
af_Q2FW77_7_322_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7549 17 253 1.10.3470.10
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7477 17 261 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7W0L5P2-F1-model_v4 Metal ABC transporter permease 0.9356 21 194 GO:0010043
GO:0043190
GO:0055085
AF-A0A259SGM8-F1-model_v4 ABC transporter permease 0.9216 9 196 GO:0010043
GO:0043190
GO:0055085
AF-A0A356QX65-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9104 19 190 GO:0006829
GO:0010043
GO:0043190
GO:0055085
AF-A0A7Y3JEV1-F1-model_v4 Metal ABC transporter permease 0.9054 21 177 GO:0010043
GO:0043190
GO:0055085
AF-A0A4Q3C4P7-F1-model_v4 deleted 0.8886 15 192

Map