F406194

General Info

Members Datasets Scaffolds Average Seq Length
321 191 642 458

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000395|Ga0500555_000395_784_2151
Length 455
Sequence MLSLDALHTQVRDGAIDTVIVGFTDHYGRLMGKRFDGDMFVEQTAAHGTHGCDYLLTTDMEMEPVAGYRYANWELGYGDFHLAPDLSTLRLASWLDRTALVICDVRDEKTGLDVPLAPRAILRKQLANARALDGYESFAASELEYYVFTQSYAAAAKQHYHALEPAGWYLEDYHIQQGTRTEPFTAAVRRHLKRSGVPVESSKGEWGLGQHELNVRYADTLSMADRHVVFKQCLKEVAEQQGLSATFMAKPIADRAGSSCHVHLSLWKDGANAFAGDQTCGPVQGVSDLFRWFLGGWLAHAPELMVFYAPTVNSYKRFVDASWAPTRLAWSFDNRTAGFRVVGHGNSLRIECRIPGADCNPYLAFAAALASGLDGIRRQIAPPDCFVGDIYAARHLPRVAHSLADATDAFAASDFARETFGADVVEHYTHFFRTEQSAFDKAVTDWERQRYFERI

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
132 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 3.12
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_000395 3300053103 Bacteria 18332
2 JGI25406J46586_10013365 3300003203 Bacteria 3529
3 Ga0065165_1000083 3300005262 Bacteria 156204
4 Ga0065712_10086088 3300005290 Bacteria 2657
5 Ga0065715_10144388 3300005293 Bacteria 1808
6 Ga0065707_10084202 3300005295 Bacteria 7492
7 Ga0070683_100093486 3300005329 Bacteria 2825
8 Ga0070690_100019571 3300005330 Bacteria 4112
9 Ga0070670_100023711 3300005331 Bacteria 5281
10 Ga0070670_100155587 3300005331 Bacteria 1979
11 Ga0068869_100001828 3300005334 Bacteria 12783
12 Ga0070680_100000389 3300005336 Bacteria 29853
13 Ga0068868_100002449 3300005338 Bacteria 12874
14 Ga0070689_100001036 3300005340 Bacteria 17435
15 Ga0070689_100005578 3300005340 Bacteria 8610
16 Ga0070687_100000696 3300005343 Bacteria 11238
17 Ga0070661_100010682 3300005344 Bacteria 6389
18 Ga0070692_10002386 3300005345 Bacteria 7274
19 Ga0070669_100018158 3300005353 Bacteria 5024
20 Ga0070671_100089765 3300005355 Bacteria 2573
21 Ga0070671_100163574 3300005355 Bacteria 1881
22 Ga0070713_100212465 3300005436 Unclassified 1752
23 Ga0070701_10004043 3300005438 Bacteria 5882
24 Ga0070705_100000265 3300005440 Bacteria 31468
25 Ga0070700_100027133 3300005441 Bacteria 3392
26 Ga0070694_100000696 3300005444 Bacteria 18697
27 Ga0070681_10005589 3300005458 Bacteria 12143
28 Ga0068867_100000776 3300005459 Bacteria 21576
29 Ga0070707_100001175 3300005468 Bacteria 25758
30 Ga0070699_100007098 3300005518 Bacteria 9730
31 Ga0070699_100091901 3300005518 Bacteria 2654
32 Ga0070679_100063280 3300005530 Bacteria 3688
33 Ga0070679_100334800 3300005530 Bacteria 1462
34 Ga0070697_100006638 3300005536 Bacteria 8971
35 Ga0070686_100001892 3300005544 Bacteria 11656
36 Ga0070695_100000426 3300005545 Bacteria 21798
37 Ga0070696_100001285 3300005546 Bacteria 16351
38 Ga0070693_100000356 3300005547 Bacteria 20752
39 Ga0070665_100005847 3300005548 Bacteria 12619
40 Ga0070665_100079050 3300005548 Bacteria 3295
41 Ga0070704_100000099 3300005549 Bacteria 30058
42 Ga0070704_100118316 3300005549 Bacteria 2030
43 Ga0068855_100002434 3300005563 Bacteria 22992
44 Ga0070664_100000238 3300005564 Bacteria 39441
45 Ga0070664_100045830 3300005564 Bacteria 3692
46 Ga0068857_100022501 3300005577 Bacteria 5546
47 Ga0068857_100065956 3300005577 Unclassified 3220
48 Ga0068857_100085270 3300005577 Bacteria 2823
49 Ga0068856_100025526 3300005614 Bacteria 5762
50 Ga0070702_100013599 3300005615 Bacteria 4112
51 Ga0068859_100002131 3300005617 Bacteria 20153
52 Ga0068859_100003980 3300005617 Bacteria 15078
53 Ga0068866_10000453 3300005718 Bacteria 18807
54 Ga0068861_100065385 3300005719 Bacteria 2801
55 Ga0068861_100115578 3300005719 Bacteria 2156
56 Ga0068858_100007753 3300005842 Bacteria 10363
57 Ga0068860_100063165 3300005843 Bacteria 3518
58 Ga0068860_100158192 3300005843 Bacteria 2184
59 Ga0068862_100040017 3300005844 Bacteria 3983
60 Ga0081455_10029979 3300005937 Unclassified 4950
61 Ga0081455_10036306 3300005937 Bacteria 4390
62 Ga0081455_10051569 3300005937 Bacteria 3528
63 Ga0081539_10000178 3300005985 Bacteria 149201
64 Ga0081539_10001026 3300005985 Bacteria 51455
65 Ga0097621_100001473 3300006237 Bacteria 16111
66 Ga0097621_100193621 3300006237 Unclassified 1762
67 Ga0068871_100004183 3300006358 Bacteria 9993
68 Ga0075428_100008199 3300006844 Bacteria 11593
69 Ga0075428_100012427 3300006844 Bacteria 9471
70 Ga0075428_100124542 3300006844 Bacteria 2805
71 Ga0075428_100212927 3300006844 Bacteria 2088
72 Ga0075430_100002130 3300006846 Bacteria 16385
73 Ga0075430_100006044 3300006846 Bacteria 10209
74 Ga0075431_100006322 3300006847 Bacteria 11766
75 Ga0075431_100014169 3300006847 Bacteria 8062
76 Ga0075431_100066977 3300006847 Bacteria 3707
77 Ga0075431_100069948 3300006847 Bacteria 3621
78 Ga0075431_100128509 3300006847 Bacteria 2615
79 Ga0075431_100162442 3300006847 Bacteria 2296
80 Ga0075433_10001799 3300006852 Bacteria 16072
81 Ga0075433_10067769 3300006852 Bacteria 3132
82 Ga0075433_10181370 3300006852 Bacteria 1874
83 Ga0075434_100008281 3300006871 Bacteria 9658
84 Ga0075434_100012960 3300006871 Bacteria 7919
85 Ga0075429_100003956 3300006880 Bacteria 12668
86 Ga0075429_100005420 3300006880 Bacteria 10985
87 Ga0075429_100067858 3300006880 Unclassified 3104
88 Ga0075429_100086292 3300006880 Bacteria 2736
89 Ga0068865_100001090 3300006881 Bacteria 15658
90 Ga0075436_100001134 3300006914 Bacteria 18009
91 Ga0075436_100005365 3300006914 Bacteria 8824
92 Ga0075436_100007921 3300006914 Bacteria 7273
93 Ga0075436_100010210 3300006914 Bacteria 6431
94 Ga0075436_100069550 3300006914 Bacteria 2432
95 Ga0097620_100002131 3300006931 Bacteria 20153
96 Ga0097620_100003980 3300006931 Bacteria 15078
97 Ga0075435_100000928 3300007076 Bacteria 18503
98 Ga0099794_10025669 3300007265 Bacteria 2717
99 Ga0105240_10095834 3300009093 Bacteria 3617
100 Ga0111539_10001942 3300009094 Bacteria 27552
101 Ga0111539_10017874 3300009094 Bacteria 8781
102 Ga0111539_10066002 3300009094 Bacteria 4275
103 Ga0111539_10083541 3300009094 Unclassified 3755
104 Ga0111539_10106219 3300009094 Bacteria 3294
105 Ga0111539_10119527 3300009094 Bacteria 3088
106 Ga0111539_10142122 3300009094 Bacteria 2809
107 Ga0105245_10031828 3300009098 Bacteria 4671
108 Ga0105245_10108094 3300009098 Unclassified 2583
109 Ga0114129_10000518 3300009147 Bacteria 47108
110 Ga0114129_10004553 3300009147 Bacteria 19563
111 Ga0114129_10004998 3300009147 Bacteria 18679
112 Ga0114129_10015225 3300009147 Bacteria 10948
113 Ga0114129_10024477 3300009147 Bacteria 8555
114 Ga0114129_10044161 3300009147 Bacteria 6269
115 Ga0114129_10075330 3300009147 Unclassified 4699
116 Ga0114129_10213070 3300009147 Bacteria 2610
117 Ga0114129_10489063 3300009147 Bacteria 1609
118 Ga0105243_10001402 3300009148 Bacteria 21324
119 Ga0105241_10033972 3300009174 Bacteria 3831
120 Ga0105242_10002122 3300009176 Bacteria 15648
121 Ga0105249_10003929 3300009553 Bacteria 12837
122 Ga0105239_10001685 3300010375 Bacteria 29132
123 Ga0105239_10247437 3300010375 Bacteria 2002
124 Ga0157369_10062458 3300013105 Bacteria 4014
125 Ga0157374_10065174 3300013296 Bacteria 3420
126 Ga0157374_10066161 3300013296 Bacteria 3396
127 Ga0157374_10122151 3300013296 Bacteria 2514
128 Ga0157378_10041195 3300013297 Bacteria 4096
129 Ga0157379_10183211 3300014968 Bacteria 1892
130 Ga0157376_10003135 3300014969 Bacteria 11359
131 Ga0157376_10006869 3300014969 Bacteria 8058
132 Ga0157376_10137210 3300014969 Bacteria 2190
133 Ga0209676_1000443 3300025292 Bacteria 70660
134 Ga0207642_10002709 3300025899 Bacteria 5532
135 Ga0207647_10006415 3300025904 Bacteria 8549
136 Ga0207660_10000038 3300025917 Bacteria 64382
137 Ga0207662_10003255 3300025918 Bacteria 8326
138 Ga0207649_10041416 3300025920 Bacteria 2803
139 Ga0207652_10180493 3300025921 Bacteria 1897
140 Ga0207646_10000201 3300025922 Bacteria 81271
141 Ga0207681_10029102 3300025923 Bacteria 3583
142 Ga0207687_10001349 3300025927 Bacteria 16797
143 Ga0207687_10081459 3300025927 Unclassified 2339
144 Ga0207644_10049415 3300025931 Bacteria 3011
145 Ga0207644_10150551 3300025931 Unclassified 1800
146 Ga0207644_10211069 3300025931 Bacteria 1535
147 Ga0207686_10002042 3300025934 Bacteria 11126
148 Ga0207709_10002069 3300025935 Bacteria 12959
149 Ga0207670_10020941 3300025936 Bacteria 4025
150 Ga0207670_10035981 3300025936 Bacteria 3216
151 Ga0207670_10042691 3300025936 Bacteria 2990
152 Ga0207704_10000960 3300025938 Bacteria 12763
153 Ga0207711_10238648 3300025941 Bacteria 1666
154 Ga0207689_10000736 3300025942 Bacteria 31515
155 Ga0207679_10068651 3300025945 Bacteria 2664
156 Ga0207667_10130843 3300025949 Bacteria 2585
157 Ga0207640_10009746 3300025981 Bacteria 5385
158 Ga0207677_10006656 3300026023 Bacteria 6343
159 Ga0207703_10026370 3300026035 Bacteria 4573
160 Ga0207678_10105823 3300026067 Unclassified 2400
161 Ga0207702_10061864 3300026078 Bacteria 3195
162 Ga0207648_10001026 3300026089 Bacteria 31434
163 Ga0207648_10237097 3300026089 Bacteria 1624
164 Ga0207676_10067133 3300026095 Bacteria 2864
165 Ga0207674_10019871 3300026116 Bacteria 7268
166 Ga0207675_100002828 3300026118 Bacteria 17075
167 Ga0207675_100024843 3300026118 Bacteria 5576
168 Ga0207428_10004907 3300027907 Bacteria 12605
169 Ga0207428_10009045 3300027907 Bacteria 8962
170 Ga0207428_10028744 3300027907 Bacteria 4616
171 Ga0268266_10019058 3300028379 Bacteria 5844
172 Ga0268265_10004562 3300028380 Bacteria 9580
173 Ga0268265_10150382 3300028380 Bacteria 1963
174 Ga0268264_10004292 3300028381 Bacteria 12165
175 Ga0268264_10102562 3300028381 Bacteria 2490
176 Ga0265339_10000423 3300031249 Bacteria 33519
177 Ga0307408_100029416 3300031548 Bacteria 3806
178 Ga0307408_100063524 3300031548 Bacteria 2701
179 Ga0316579_10002681 3300031691 Bacteria 6769
180 Ga0265314_10000196 3300031711 Bacteria 90241
181 Ga0316576_10067456 3300031727 Unclassified 2633
182 Ga0316578_10004797 3300031728 Bacteria 6448
183 Ga0307405_10010206 3300031731 Bacteria 4853
184 Ga0316577_10000272 3300031733 Bacteria 18394
185 Ga0307410_10127407 3300031852 Bacteria 1865
186 Ga0307407_10025227 3300031903 Unclassified 3130
187 Ga0307407_10090698 3300031903 Bacteria 1872
188 Ga0307412_10010975 3300031911 Bacteria 5231
189 Ga0307409_100044752 3300031995 Bacteria 3336
190 Ga0307416_100043927 3300032002 Bacteria 3504
191 Ga0307416_100222823 3300032002 Bacteria 1810
192 Ga0307414_10135990 3300032004 Bacteria 1916
193 Ga0307411_10017790 3300032005 Bacteria 4062
194 Ga0307415_100091597 3300032126 Bacteria 2202
195 Ga0316583_10004035 3300032133 Bacteria 5216
196 Ga0316580_10004660 3300032139 Bacteria 3983
197 Ga0316574_0030471 3300035398 Bacteria 3267
198 Ga0373931_0038869 3300035691 Bacteria 2491
199 Ga0373937_0042671 3300036401 Bacteria 4139
200 Ga0316582_0004569 3300036647 Bacteria 7011
201 Ga0316582_0019688 3300036647 Bacteria 3956
202 Ga0316584_0003052 3300036712 Bacteria 10787
203 Ga0439441_000287 3300042001 Bacteria 5022
204 Ga0439443_000233 3300042003 Bacteria 4300
205 Ga0439460_0000328 3300042461 Bacteria 10020
206 Ga0453683_0003742 3300044673 Bacteria 11095
207 Ga0451576_0006834 3300045051 Bacteria 13856
208 Ga0495608_0004186 3300046511 Bacteria 10341
209 Ga0495628_0000309 3300046516 Bacteria 43966
210 Ga0495628_0027865 3300046516 Bacteria 4592
211 Ga0495628_0110301 3300046516 Bacteria 2117
212 Ga0495652_0187628 3300046529 Bacteria 1581
213 Ga0495645_0045640 3300046543 Bacteria 3198
214 Ga0495667_0014741 3300046559 Bacteria 5282
215 Ga0495667_0030227 3300046559 Unclassified 3642
216 Ga0495635_0123881 3300046663 Bacteria 1763
217 Ga0495599_0094415 3300046678 Unclassified 1866
218 Ga0495624_0128444 3300046690 Bacteria 1555
219 Ga0495600_0046631 3300046809 Unclassified 2827
220 Ga0495674_0000591 3300047319 Bacteria 33921
221 Ga0495680_0100836 3300047322 Bacteria 2151
222 Ga0495675_0020494 3300047444 Bacteria 4206
223 Ga0496104_0001554 3300048907 Bacteria 19771
224 Ga0496104_0012011 3300048907 Bacteria 7771
225 Ga0496109_0000234 3300048912 Bacteria 53901
226 Ga0496109_0040148 3300048912 Bacteria 4238
227 Ga0496109_0330575 3300048912 Bacteria 1439
228 Ga0496110_0046739 3300048913 Bacteria 3787
229 Ga0496112_0002304 3300048915 Bacteria 15296
230 Ga0496112_0074977 3300048915 Bacteria 3345
231 Ga0496113_0017882 3300048916 Bacteria 4928
232 Ga0496113_0172995 3300048916 Bacteria 1711
233 Ga0501031_0021196 3300049568 Bacteria 4238
234 Ga0501036_0004348 3300049572 Bacteria 11433
235 Ga0501036_0033660 3300049572 Bacteria 4333
236 Ga0501037_0002406 3300049573 Bacteria 13524
237 Ga0501037_0035821 3300049573 Bacteria 3657
238 Ga0501038_0052412 3300049574 Bacteria 3518
239 Ga0501040_0000563 3300049576 Bacteria 22467
240 Ga0501040_0009908 3300049576 Bacteria 6219
241 Ga0501041_0003063 3300049577 Bacteria 9592
242 Ga0501041_0015300 3300049577 Bacteria 4555
243 Ga0501042_0000996 3300049578 Bacteria 16058
244 Ga0501042_0004644 3300049578 Bacteria 8766
245 Ga0501043_0012878 3300049579 Bacteria 6538
246 Ga0501046_0001437 3300049580 Bacteria 22916
247 Ga0501046_0005451 3300049580 Bacteria 11375
248 Ga0501048_0009232 3300049582 Bacteria 7410
249 Ga0501048_0016042 3300049582 Bacteria 5524
250 Ga0501068_0001264 3300049584 Bacteria 13424
251 Ga0501069_0067041 3300049585 Bacteria 2007
252 Ga0501071_0001524 3300049587 Bacteria 13495
253 Ga0501072_0002198 3300049588 Bacteria 14583
254 Ga0501072_0018970 3300049588 Bacteria 5309
255 Ga0501073_0021827 3300049589 Bacteria 4612
256 Ga0501074_0001374 3300049590 Bacteria 16135
257 Ga0501074_0007230 3300049590 Bacteria 8021
258 Ga0501075_0002074 3300049591 Bacteria 13228
259 Ga0501076_0022124 3300049592 Bacteria 4885
260 Ga0501077_0005722 3300049593 Bacteria 7568
261 Ga0501077_0006227 3300049593 Bacteria 7293
262 Ga0501225_0008396 3300049705 Bacteria 2964
263 Ga0501079_0001786 3300049741 Bacteria 15350
264 Ga0501079_0030960 3300049741 Bacteria 4111
265 Ga0501080_0000918 3300049742 Bacteria 24125
266 Ga0501080_0062233 3300049742 Bacteria 3473
267 Ga0501081_0002255 3300049743 Bacteria 12128
268 Ga0501081_0005687 3300049743 Bacteria 8067
269 Ga0501081_0020740 3300049743 Bacteria 4383
270 Ga0501035_0016208 3300049822 Bacteria 6878
271 Ga0501035_0041498 3300049822 Bacteria 4154
272 Ga0501045_0004093 3300049824 Bacteria 10065
273 Ga0501045_0082646 3300049824 Bacteria 2369
274 Ga0501045_0128155 3300049824 Bacteria 1886
275 nmdc:mga05p37_13980_c1 3300050507 Bacteria 9625
276 nmdc:mga05p37_143670_c1 3300050507 Bacteria 2923
277 nmdc:mga05p37_271922_c1 3300050507 Bacteria 2024
278 nmdc:mga05p37_4745_c1 3300050507 Bacteria 15881
279 nmdc:mga05p37_99037_c1 3300050507 Bacteria 3591
280 nmdc:mga09592_21845_c1 3300050508 Bacteria 5277
281 nmdc:mga09592_4324_c1 3300050508 Bacteria 11475
282 nmdc:mga09592_52690_c1 3300050508 Bacteria 3434
283 nmdc:mga09592_6634_c1 3300050508 Bacteria 9426
284 nmdc:mga0qj67_7537_c1 3300050509 Bacteria 8040
285 nmdc:mga0qj67_97624_c1 3300050509 Bacteria 2366
286 nmdc:mga06r32_115559_c1 3300050510 Bacteria 2643
287 nmdc:mga06r32_118185_c1 3300050510 Unclassified 2613
288 nmdc:mga06r32_140457_c1 3300050510 Bacteria 2391
289 nmdc:mga06r32_20573_c1 3300050510 Bacteria 6076
290 nmdc:mga06r32_28537_c1 3300050510 Bacteria 5224
291 nmdc:mga06r32_4221_c1 3300050510 Bacteria 12876
292 nmdc:mga06r32_49213_c1 3300050510 Bacteria 4030
293 nmdc:mga08y16_10539_c1 3300050511 Bacteria 9701
294 nmdc:mga08y16_129782_c1 3300050511 Bacteria 2622
295 nmdc:mga08y16_1639_c1 3300050511 Bacteria 22669
296 nmdc:mga08y16_5102_c1 3300050511 Bacteria 13721
297 nmdc:mga08y16_52945_c1 3300050511 Bacteria 4245
298 nmdc:mga08y16_93533_c1 3300050511 Bacteria 3132
299 nmdc:mga0n895_1710_c2 3300050512 Bacteria 14958
300 nmdc:mga0n895_189233_c1 3300050512 Bacteria 2089
301 nmdc:mga0n895_259246_c1 3300050512 Bacteria 1764
302 nmdc:mga0n895_4336_c1 3300050512 Bacteria 11626
303 nmdc:mga0rr50_4321_c1 3300050513 Bacteria 8330
304 nmdc:mga08x19_125676_c1 3300050514 Bacteria 1722
305 nmdc:mga08x19_37872_c1 3300050514 Bacteria 3062
306 nmdc:mga08x19_4639_c1 3300050514 Bacteria 8154
307 nmdc:mga08x19_565_c1 3300050514 Bacteria 24233
308 nmdc:mga08x19_7509_c1 3300050514 Bacteria 6477
309 nmdc:mga0a205_44441_c1 3300050515 Bacteria 4282
310 nmdc:mga0a205_67611_c1 3300050515 Bacteria 3452
311 Ga0500555_024531 3300053103 Bacteria 1727
312 Ga0500616_0000449 3300053153 Bacteria 53975
313 Ga0500645_000248 3300053730 Bacteria 40377
314 Ga0501084_0006037 3300054114 Bacteria 9962
315 Ga0501084_0019299 3300054114 Bacteria 5680
316 Ga0501084_0045891 3300054114 Bacteria 3658
317 Ga0501082_0002315 3300060353 Bacteria 16656
318 Ga0501082_0011143 3300060353 Bacteria 7729
319 Ga0530510_0011689 3300061734 Bacteria 6160
320 Ga0530510_0020877 3300061734 Bacteria 4658
321 Ga0530510_0082119 3300061734 Bacteria 2347
322 Ga0500555_000395
323 JGI25406J46586_10013365
324 Ga0065165_1000083
325 Ga0065712_10086088
326 Ga0065715_10144388
327 Ga0065707_10084202
328 Ga0070683_100093486
329 Ga0070690_100019571
330 Ga0070670_100023711
331 Ga0070670_100155587
332 Ga0068869_100001828
333 Ga0070680_100000389
334 Ga0068868_100002449
335 Ga0070689_100001036
336 Ga0070689_100005578
337 Ga0070687_100000696
338 Ga0070661_100010682
339 Ga0070692_10002386
340 Ga0070669_100018158
341 Ga0070671_100089765
342 Ga0070671_100163574
343 Ga0070713_100212465
344 Ga0070701_10004043
345 Ga0070705_100000265
346 Ga0070700_100027133
347 Ga0070694_100000696
348 Ga0070681_10005589
349 Ga0068867_100000776
350 Ga0070707_100001175
351 Ga0070699_100007098
352 Ga0070699_100091901
353 Ga0070679_100063280
354 Ga0070679_100334800
355 Ga0070697_100006638
356 Ga0070686_100001892
357 Ga0070695_100000426
358 Ga0070696_100001285
359 Ga0070693_100000356
360 Ga0070665_100005847
361 Ga0070665_100079050
362 Ga0070704_100000099
363 Ga0070704_100118316
364 Ga0068855_100002434
365 Ga0070664_100000238
366 Ga0070664_100045830
367 Ga0068857_100022501
368 Ga0068857_100065956
369 Ga0068857_100085270
370 Ga0068856_100025526
371 Ga0070702_100013599
372 Ga0068859_100002131
373 Ga0068859_100003980
374 Ga0068866_10000453
375 Ga0068861_100065385
376 Ga0068861_100115578
377 Ga0068858_100007753
378 Ga0068860_100063165
379 Ga0068860_100158192
380 Ga0068862_100040017
381 Ga0081455_10029979
382 Ga0081455_10036306
383 Ga0081455_10051569
384 Ga0081539_10000178
385 Ga0081539_10001026
386 Ga0097621_100001473
387 Ga0097621_100193621
388 Ga0068871_100004183
389 Ga0075428_100008199
390 Ga0075428_100012427
391 Ga0075428_100124542
392 Ga0075428_100212927
393 Ga0075430_100002130
394 Ga0075430_100006044
395 Ga0075431_100006322
396 Ga0075431_100014169
397 Ga0075431_100066977
398 Ga0075431_100069948
399 Ga0075431_100128509
400 Ga0075431_100162442
401 Ga0075433_10001799
402 Ga0075433_10067769
403 Ga0075433_10181370
404 Ga0075434_100008281
405 Ga0075434_100012960
406 Ga0075429_100003956
407 Ga0075429_100005420
408 Ga0075429_100067858
409 Ga0075429_100086292
410 Ga0068865_100001090
411 Ga0075436_100001134
412 Ga0075436_100005365
413 Ga0075436_100007921
414 Ga0075436_100010210
415 Ga0075436_100069550
416 Ga0097620_100002131
417 Ga0097620_100003980
418 Ga0075435_100000928
419 Ga0099794_10025669
420 Ga0105240_10095834
421 Ga0111539_10001942
422 Ga0111539_10017874
423 Ga0111539_10066002
424 Ga0111539_10083541
425 Ga0111539_10106219
426 Ga0111539_10119527
427 Ga0111539_10142122
428 Ga0105245_10031828
429 Ga0105245_10108094
430 Ga0114129_10000518
431 Ga0114129_10004553
432 Ga0114129_10004998
433 Ga0114129_10015225
434 Ga0114129_10024477
435 Ga0114129_10044161
436 Ga0114129_10075330
437 Ga0114129_10213070
438 Ga0114129_10489063
439 Ga0105243_10001402
440 Ga0105241_10033972
441 Ga0105242_10002122
442 Ga0105249_10003929
443 Ga0105239_10001685
444 Ga0105239_10247437
445 Ga0157369_10062458
446 Ga0157374_10065174
447 Ga0157374_10066161
448 Ga0157374_10122151
449 Ga0157378_10041195
450 Ga0157379_10183211
451 Ga0157376_10003135
452 Ga0157376_10006869
453 Ga0157376_10137210
454 Ga0209676_1000443
455 Ga0207642_10002709
456 Ga0207647_10006415
457 Ga0207660_10000038
458 Ga0207662_10003255
459 Ga0207649_10041416
460 Ga0207652_10180493
461 Ga0207646_10000201
462 Ga0207681_10029102
463 Ga0207687_10001349
464 Ga0207687_10081459
465 Ga0207644_10049415
466 Ga0207644_10150551
467 Ga0207644_10211069
468 Ga0207686_10002042
469 Ga0207709_10002069
470 Ga0207670_10020941
471 Ga0207670_10035981
472 Ga0207670_10042691
473 Ga0207704_10000960
474 Ga0207711_10238648
475 Ga0207689_10000736
476 Ga0207679_10068651
477 Ga0207667_10130843
478 Ga0207640_10009746
479 Ga0207677_10006656
480 Ga0207703_10026370
481 Ga0207678_10105823
482 Ga0207702_10061864
483 Ga0207648_10001026
484 Ga0207648_10237097
485 Ga0207676_10067133
486 Ga0207674_10019871
487 Ga0207675_100002828
488 Ga0207675_100024843
489 Ga0207428_10004907
490 Ga0207428_10009045
491 Ga0207428_10028744
492 Ga0268266_10019058
493 Ga0268265_10004562
494 Ga0268265_10150382
495 Ga0268264_10004292
496 Ga0268264_10102562
497 Ga0265339_10000423
498 Ga0307408_100029416
499 Ga0307408_100063524
500 Ga0316579_10002681
501 Ga0265314_10000196
502 Ga0316576_10067456
503 Ga0316578_10004797
504 Ga0307405_10010206
505 Ga0316577_10000272
506 Ga0307410_10127407
507 Ga0307407_10025227
508 Ga0307407_10090698
509 Ga0307412_10010975
510 Ga0307409_100044752
511 Ga0307416_100043927
512 Ga0307416_100222823
513 Ga0307414_10135990
514 Ga0307411_10017790
515 Ga0307415_100091597
516 Ga0316583_10004035
517 Ga0316580_10004660
518 Ga0316574_0030471
519 Ga0373931_0038869
520 Ga0373937_0042671
521 Ga0316582_0004569
522 Ga0316582_0019688
523 Ga0316584_0003052
524 Ga0439441_000287
525 Ga0439443_000233
526 Ga0439460_0000328
527 Ga0453683_0003742
528 Ga0451576_0006834
529 Ga0495608_0004186
530 Ga0495628_0000309
531 Ga0495628_0027865
532 Ga0495628_0110301
533 Ga0495652_0187628
534 Ga0495645_0045640
535 Ga0495667_0014741
536 Ga0495667_0030227
537 Ga0495635_0123881
538 Ga0495599_0094415
539 Ga0495624_0128444
540 Ga0495600_0046631
541 Ga0495674_0000591
542 Ga0495680_0100836
543 Ga0495675_0020494
544 Ga0496104_0001554
545 Ga0496104_0012011
546 Ga0496109_0000234
547 Ga0496109_0040148
548 Ga0496109_0330575
549 Ga0496110_0046739
550 Ga0496112_0002304
551 Ga0496112_0074977
552 Ga0496113_0017882
553 Ga0496113_0172995
554 Ga0501031_0021196
555 Ga0501036_0004348
556 Ga0501036_0033660
557 Ga0501037_0002406
558 Ga0501037_0035821
559 Ga0501038_0052412
560 Ga0501040_0000563
561 Ga0501040_0009908
562 Ga0501041_0003063
563 Ga0501041_0015300
564 Ga0501042_0000996
565 Ga0501042_0004644
566 Ga0501043_0012878
567 Ga0501046_0001437
568 Ga0501046_0005451
569 Ga0501048_0009232
570 Ga0501048_0016042
571 Ga0501068_0001264
572 Ga0501069_0067041
573 Ga0501071_0001524
574 Ga0501072_0002198
575 Ga0501072_0018970
576 Ga0501073_0021827
577 Ga0501074_0001374
578 Ga0501074_0007230
579 Ga0501075_0002074
580 Ga0501076_0022124
581 Ga0501077_0005722
582 Ga0501077_0006227
583 Ga0501225_0008396
584 Ga0501079_0001786
585 Ga0501079_0030960
586 Ga0501080_0000918
587 Ga0501080_0062233
588 Ga0501081_0002255
589 Ga0501081_0005687
590 Ga0501081_0020740
591 Ga0501035_0016208
592 Ga0501035_0041498
593 Ga0501045_0004093
594 Ga0501045_0082646
595 Ga0501045_0128155
596 nmdc:mga05p37_13980_c1
597 nmdc:mga05p37_143670_c1
598 nmdc:mga05p37_271922_c1
599 nmdc:mga05p37_4745_c1
600 nmdc:mga05p37_99037_c1
601 nmdc:mga09592_21845_c1
602 nmdc:mga09592_4324_c1
603 nmdc:mga09592_52690_c1
604 nmdc:mga09592_6634_c1
605 nmdc:mga0qj67_7537_c1
606 nmdc:mga0qj67_97624_c1
607 nmdc:mga06r32_115559_c1
608 nmdc:mga06r32_118185_c1
609 nmdc:mga06r32_140457_c1
610 nmdc:mga06r32_20573_c1
611 nmdc:mga06r32_28537_c1
612 nmdc:mga06r32_4221_c1
613 nmdc:mga06r32_49213_c1
614 nmdc:mga08y16_10539_c1
615 nmdc:mga08y16_129782_c1
616 nmdc:mga08y16_1639_c1
617 nmdc:mga08y16_5102_c1
618 nmdc:mga08y16_52945_c1
619 nmdc:mga08y16_93533_c1
620 nmdc:mga0n895_1710_c2
621 nmdc:mga0n895_189233_c1
622 nmdc:mga0n895_259246_c1
623 nmdc:mga0n895_4336_c1
624 nmdc:mga0rr50_4321_c1
625 nmdc:mga08x19_125676_c1
626 nmdc:mga08x19_37872_c1
627 nmdc:mga08x19_4639_c1
628 nmdc:mga08x19_565_c1
629 nmdc:mga08x19_7509_c1
630 nmdc:mga0a205_44441_c1
631 nmdc:mga0a205_67611_c1
632 Ga0500555_024531
633 Ga0500616_0000449
634 Ga0500645_000248
635 Ga0501084_0006037
636 Ga0501084_0019299
637 Ga0501084_0045891
638 Ga0501082_0002315
639 Ga0501082_0011143
640 Ga0530510_0011689
641 Ga0530510_0020877
642 Ga0530510_0082119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00120

Gln-synt_C

Glutamine synthetase, catalytic domain

115

451

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dm3-assembly10.cif.gz_F-2 crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9513 10 456
5dm3-assembly11.cif.gz_D crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9464 10 459
5dm3-assembly5.cif.gz_E crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9441 10 459
5dm3-assembly10.cif.gz_F-2 crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9439 10 456
5dm3-assembly11.cif.gz_D crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9416 10 459
ID Description Score Start End Superfamily
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9443 124 459 3.30.590.10
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9388 124 459 3.30.590.10
af_P0C7B6_183_520_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9288 126 459 3.30.590.10
af_I6X5K1_11_120_3.10.20.70 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9259 13 122 3.10.20.70
af_P0C7B6_183_520_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9155 126 459 3.30.590.10
ID Description Score Start End GO Terms
AF-A0A3S1QZL1-F1-model_v4 deleted 0.9737 116 278
AF-X1P3X9-F1-model_v4 GS catalytic domain-containing protein 0.9734 124 245 GO:0004356
AF-A0A0K2R8X6-F1-model_v4 deleted 0.9668 101 363
AF-A0A2D5K315-F1-model_v4 Glutamine synthetase 0.9621 9 382 GO:0004356
GO:0006542
AF-A0A2M7WPB7-F1-model_v4 Glutamine synthetase 0.9618 118 349 GO:0004356

Map