F406118

General Info

Members Datasets Scaffolds Average Seq Length
321 224 314 130

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0238849|Ga0495638_0238849_336_728
Length 130
Sequence MTANIDIVRAHYAASAQGNIAEMMASVSPQVRWTEMAGFPCAGTWVGPQAVADNVFAVLGRDWIGYRFELQNLIDGGGDQVIGVGDYHGTSRATGKAMQARVAHVWKLQDGKIVTFEQFTDTLLVHRAMS

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2857564685 Duganella sp. R-74599 Isolate Unclassified
6 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
7 2904424332 Duganella sp. 1411 Isolate Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
213 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0.93
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.64
Nodule 1.25
Rhizoplane 5.61
Rhizosphere 49.53
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000042 3300002704 Bacteria 88585
2 JGI25156J39149_1000053 3300002705 Bacteria 88796
3 JGI25154J39366_1000082 3300002738 Bacteria 88767
4 JGI25157J39369_1000072 3300002741 Bacteria 88796
5 JGI25159J45721_1014261 3300002987 Bacteria 1801
6 JGI25151J46595_10010750 3300003187 Bacteria 4236
7 rootL2_10089550 3300003322 Bacteria 3116
8 rootL2_10197643 3300003322 Bacteria 1267
9 JGI25160J50197_1018268 3300003354 Bacteria 2191
10 Ga0055525_1000001 3300003759 Bacteria 1016948
11 Ga0055526_1006691 3300003771 Bacteria 6182
12 Ga0055526_1025302 3300003771 Bacteria 1908
13 Ga0055526_1038989 3300003771 Bacteria 1216
14 Ga0055537_1000433 3300003773 Bacteria 27034
15 Ga0055537_1000651 3300003773 Bacteria 18325
16 Ga0055524_1000213 3300003775 Bacteria 61225
17 Ga0055536_1060162 3300003781 Bacteria 790
18 Ga0055534_1000008 3300003784 Bacteria 211098
19 Ga0055534_1030709 3300003784 Bacteria 828
20 Ga0055534_1035855 3300003784 Bacteria 747
21 Ga0055528_1003667 3300003790 Bacteria 7619
22 Ga0055528_1003770 3300003790 Bacteria 7478
23 Ga0055530_10001155 3300003791 Bacteria 20474
24 Ga0055540_1000176 3300003792 Bacteria 63046
25 Ga0055540_1001071 3300003792 Bacteria 17413
26 Ga0055531_10015770 3300003794 Bacteria 3305
27 Ga0065165_1018696 3300005262 Bacteria 2499
28 Ga0070658_10028371 3300005327 Bacteria 4493
29 Ga0070658_10067074 3300005327 Bacteria 2932
30 Ga0070676_10041953 3300005328 Bacteria 2655
31 Ga0070676_10320857 3300005328 Bacteria 1056
32 Ga0070690_100380944 3300005330 Bacteria 1031
33 Ga0070677_10012407 3300005333 Bacteria 2959
34 Ga0068868_100089997 3300005338 Bacteria 2471
35 Ga0070660_100028476 3300005339 Bacteria 4180
36 Ga0070668_102016196 3300005347 Bacteria 532
37 Ga0070675_100202730 3300005354 Bacteria 1722
38 Ga0070671_100015373 3300005355 Bacteria 6182
39 Ga0070674_100064331 3300005356 Bacteria 2570
40 Ga0070674_100128747 3300005356 Bacteria 1884
41 Ga0070673_100559168 3300005364 Bacteria 1040
42 Ga0070659_101422347 3300005366 Bacteria 617
43 Ga0070659_101450648 3300005366 Bacteria 611
44 Ga0070663_100003407 3300005455 Bacteria 9182
45 Ga0070678_100000882 3300005456 Bacteria 15382
46 Ga0070678_100048060 3300005456 Bacteria 3070
47 Ga0070662_100118009 3300005457 Bacteria 2030
48 Ga0068867_100039130 3300005459 Bacteria 3456
49 Ga0068867_101237173 3300005459 Bacteria 687
50 Ga0068867_101392502 3300005459 Bacteria 650
51 Ga0068853_100245642 3300005539 Bacteria 1641
52 Ga0068853_100344997 3300005539 Bacteria 1384
53 Ga0070672_100064767 3300005543 Bacteria 2889
54 Ga0070695_101722219 3300005545 Bacteria 525
55 Ga0070665_100432199 3300005548 Bacteria 1326
56 Ga0068855_100976037 3300005563 Bacteria 891
57 Ga0068855_102012933 3300005563 Bacteria 583
58 Ga0070664_100064596 3300005564 Bacteria 3122
59 Ga0068854_100562288 3300005578 Bacteria 969
60 Ga0068854_100822784 3300005578 Bacteria 811
61 Ga0068852_100064640 3300005616 Bacteria 3190
62 Ga0068851_10513295 3300005834 Bacteria 720
63 Ga0068851_10787439 3300005834 Bacteria 590
64 Ga0075365_10008257 3300006038 Bacteria 5894
65 Ga0075363_100155517 3300006048 Bacteria 1292
66 Ga0075362_10016035 3300006177 Bacteria 3061
67 Ga0075362_10084952 3300006177 Bacteria 1463
68 Ga0075362_10433390 3300006177 Bacteria 666
69 Ga0075366_10007061 3300006195 Bacteria 6180
70 Ga0097621_100011025 3300006237 Bacteria 6642
71 Ga0075370_10131883 3300006353 Bacteria 1458
72 Ga0075370_10196925 3300006353 Bacteria 1188
73 Ga0075370_10276337 3300006353 Bacteria 997
74 Ga0068871_100015502 3300006358 Bacteria 5706
75 Ga0068865_101537688 3300006881 Bacteria 597
76 Ga0068865_101897775 3300006881 Bacteria 539
77 Ga0079104_1016962 3300006946 Bacteria 2109
78 Ga0099826_10000084 3300006948 Bacteria 46867
79 Ga0105240_11171934 3300009093 Bacteria 815
80 Ga0105243_10003321 3300009148 Bacteria 13057
81 Ga0105248_10317169 3300009177 Bacteria 1756
82 Ga0105246_10206872 3300011119 Bacteria 1529
83 Ga0105246_10244906 3300011119 Bacteria 1419
84 Ga0105246_10997538 3300011119 Bacteria 758
85 Ga0157374_10748541 3300013296 Bacteria 992
86 Ga0163162_10101840 3300013306 Bacteria 2964
87 Ga0163162_10406557 3300013306 Bacteria 1494
88 Ga0157372_11555461 3300013307 Bacteria 762
89 Ga0157375_11412783 3300013308 Bacteria 820
90 Ga0182008_10690681 3300014497 Bacteria 582
91 Ga0157376_10264534 3300014969 Bacteria 1613
92 Ga0163161_10133972 3300017792 Bacteria 1871
93 Ga0213872_10004025 3300021361 Bacteria 7930
94 Ga0213872_10140246 3300021361 Bacteria 1061
95 Ga0209435_100019 3300025206 Bacteria 260989
96 Ga0209563_100007 3300025230 Bacteria 1579402
97 Ga0207427_100099 3300025231 Bacteria 121767
98 Ga0209437_101737 3300025233 Bacteria 4772
99 Ga0207425_1059007 3300025245 Bacteria 681
100 Ga0209646_1000038 3300025246 Bacteria 353982
101 Ga0209026_1000048 3300025250 Bacteria 257264
102 Ga0209677_104467 3300025253 Bacteria 4020
103 Ga0209759_1000038 3300025256 Bacteria 257264
104 Ga0209129_1004365 3300025258 Bacteria 5562
105 Ga0209233_1000001 3300025261 Bacteria 2992747
106 Ga0209565_1000041 3300025263 Bacteria 251081
107 Ga0209565_1000042 3300025263 Bacteria 239712
108 Ga0209673_1000071 3300025273 Bacteria 239966
109 Ga0209673_1000364 3300025273 Bacteria 81319
110 Ga0209673_1002185 3300025273 Bacteria 14406
111 Ga0209673_1026964 3300025273 Bacteria 1877
112 Ga0209130_1000878 3300025284 Bacteria 24573
113 Ga0209675_1000041 3300025291 Bacteria 239712
114 Ga0209675_1000473 3300025291 Bacteria 30855
115 Ga0209675_1005248 3300025291 Bacteria 5479
116 Ga0209675_1019737 3300025291 Bacteria 1846
117 Ga0209676_1000013 3300025292 Bacteria 816080
118 Ga0209676_1001785 3300025292 Bacteria 18077
119 Ga0209676_1003345 3300025292 Bacteria 10004
120 Ga0209676_1025894 3300025292 Bacteria 1873
121 Ga0209025_1012759 3300025294 Bacteria 5352
122 Ga0209025_1013874 3300025294 Bacteria 5020
123 Ga0209025_1041266 3300025294 Bacteria 1979
124 Ga0209025_1066260 3300025294 Bacteria 1313
125 Ga0209564_1000875 3300025295 Bacteria 40039
126 Ga0209564_1002130 3300025295 Bacteria 16768
127 Ga0209564_1003568 3300025295 Bacteria 10419
128 Ga0209564_1089464 3300025295 Bacteria 569
129 Ga0209758_1052837 3300025297 Bacteria 1401
130 Ga0209050_1000008 3300025298 Bacteria 1144179
131 Ga0209050_1008276 3300025298 Bacteria 5605
132 Ga0209256_1000003 3300025299 Bacteria 1661127
133 Ga0209256_1039392 3300025299 Bacteria 1215
134 Ga0209256_1041050 3300025299 Bacteria 1178
135 Ga0207426_1015868 3300025302 Bacteria 2722
136 Ga0207426_1102914 3300025302 Bacteria 734
137 Ga0209051_1000005 3300025303 Bacteria 1142353
138 Ga0209051_1001716 3300025303 Bacteria 17493
139 Ga0209257_1000048 3300025304 Bacteria 455536
140 Ga0209257_1004739 3300025304 Bacteria 10165
141 Ga0209257_1005967 3300025304 Bacteria 8169
142 Ga0207656_10525492 3300025321 Bacteria 602
143 Ga0207645_10097146 3300025907 Bacteria 1898
144 Ga0207645_10768208 3300025907 Bacteria 655
145 Ga0207705_10015802 3300025909 Bacteria 5420
146 Ga0207657_10024968 3300025919 Bacteria 5522
147 Ga0207649_11099475 3300025920 Bacteria 627
148 Ga0207646_11138831 3300025922 Bacteria 686
149 Ga0207650_11444644 3300025925 Bacteria 585
150 Ga0207644_10825570 3300025931 Bacteria 776
151 Ga0207644_11043819 3300025931 Bacteria 686
152 Ga0207690_10454419 3300025932 Bacteria 1030
153 Ga0207706_10088319 3300025933 Bacteria 2725
154 Ga0207709_10000391 3300025935 Bacteria 43481
155 Ga0207669_10058843 3300025937 Bacteria 2347
156 Ga0207669_10747133 3300025937 Bacteria 807
157 Ga0207704_11162012 3300025938 Bacteria 657
158 Ga0207691_10028325 3300025940 Bacteria 5246
159 Ga0207711_10317135 3300025941 Bacteria 1440
160 Ga0207679_10338899 3300025945 Bacteria 1307
161 Ga0207667_10588413 3300025949 Bacteria 1123
162 Ga0207667_11689398 3300025949 Bacteria 600
163 Ga0207651_10544748 3300025960 Bacteria 1008
164 Ga0207668_11282695 3300025972 Bacteria 659
165 Ga0207640_10165422 3300025981 Bacteria 1642
166 Ga0207640_10784473 3300025981 Bacteria 824
167 Ga0207677_10067013 3300026023 Bacteria 2513
168 Ga0207677_10490855 3300026023 Bacteria 1060
169 Ga0207639_10117466 3300026041 Bacteria 2180
170 Ga0207678_10054214 3300026067 Bacteria 3453
171 Ga0207678_11121962 3300026067 Bacteria 696
172 Ga0207648_10220603 3300026089 Bacteria 1685
173 Ga0207675_101564622 3300026118 Unclassified 680
174 Ga0207683_10009055 3300026121 Bacteria 8485
175 Ga0207683_10404166 3300026121 Bacteria 1257
176 Ga0209281_1018277 3300027111 Bacteria 1405
177 Ga0209282_1000112 3300027666 Bacteria 53120
178 Ga0209998_10013337 3300027717 Bacteria 1710
179 Ga0268266_10814018 3300028379 Bacteria 902
180 Ga0307515_10000090 3300028794 Bacteria 215043
181 Ga0307515_10033867 3300028794 Bacteria 8392
182 Ga0307515_10059985 3300028794 Bacteria 5439
183 Ga0307515_10081922 3300028794 Bacteria 4183
184 Ga0307512_10172857 3300030522 Bacteria 1234
185 Ga0307513_10000072 3300031456 Bacteria 138840
186 Ga0307513_10168742 3300031456 Bacteria 2068
187 Ga0307509_10270121 3300031507 Bacteria 1469
188 Ga0307408_100664053 3300031548 Bacteria 933
189 Ga0307508_10000081 3300031616 Bacteria 112337
190 Ga0307516_10003606 3300031730 Bacteria 19707
191 Ga0307516_10514331 3300031730 Bacteria 851
192 Ga0307412_10269813 3300031911 Bacteria 1331
193 Ga0307412_10286318 3300031911 Bacteria 1296
194 Ga0307412_11969140 3300031911 Bacteria 540
195 Ga0307414_11129568 3300032004 Bacteria 724
196 Ga0307411_10304516 3300032005 Bacteria 1279
197 Ga0307510_10632269 3300033180 Bacteria 526
198 Ga0373951_0004132 3300035091 Bacteria 3471
199 Ga0373939_0000013 3300035114 Bacteria 66615
200 Ga0373960_0002051 3300035121 Bacteria 4530
201 Ga0373931_0000279 3300035691 Bacteria 21420
202 Ga0373925_0379150 3300037068 Bacteria 1151
203 Ga0395899_0092046 3300037312 Bacteria 2196
204 Ga0395900_0044046 3300037418 Bacteria 4599
205 Ga0395898_0747883 3300037466 Bacteria 919
206 Ga0395905_0342714 3300037471 Bacteria 1386
207 Ga0395901_0056394 3300038443 Bacteria 4086
208 Ga0436361_1051926 3300039447 Bacteria 23370
209 Ga0451791_0431003 3300041451 Bacteria 855
210 Ga0451793_1706672 3300041452 Bacteria 1219
211 Ga0451797_1056710 3300041453 Bacteria 659
212 Ga0451804_0756674 3300041463 Bacteria 783
213 Ga0451807_1298168 3300041486 Bacteria 1548
214 Ga0451807_2410811 3300041486 Bacteria 683
215 Ga0451835_0107182 3300041492 Bacteria 920
216 Ga0451837_1026473 3300041494 Bacteria 642
217 Ga0451841_0329054 3300041498 Bacteria 743
218 Ga0451841_0433419 3300041498 Bacteria 1219
219 Ga0451843_0492596 3300041509 Bacteria 767
220 Ga0451855_2027166 3300041511 Bacteria 935
221 Ga0439448_0034042 3300042005 Bacteria 1627
222 Ga0439450_035552 3300042008 Bacteria 1137
223 Ga0439455_0001827 3300042012 Bacteria 3706
224 Ga0466965_0804261 3300044683 Bacteria 544
225 Ga0466961_0097257 3300044693 Bacteria 1856
226 Ga0466963_0806317 3300044694 Bacteria 662
227 Ga0453684_0000341 3300044712 Bacteria 194228
228 Ga0453684_0026564 3300044712 Bacteria 8350
229 Ga0466968_0018441 3300044735 Bacteria 2799
230 Ga0466970_0041412 3300044765 Bacteria 2447
231 Ga0466957_0067902 3300044842 Bacteria 2200
232 Ga0466959_0006722 3300045049 Bacteria 8004
233 Ga0495627_000008 3300046453 Bacteria 572150
234 Ga0495638_0238849 3300046460 Bacteria 1007
235 Ga0495585_0000001 3300046492 Bacteria 609804
236 Ga0495606_0481435 3300046507 Bacteria 630
237 Ga0495610_0013627 3300046512 Bacteria 4823
238 Ga0495630_0599937 3300046517 Bacteria 844
239 Ga0495631_0002878 3300046518 Bacteria 9543
240 Ga0495632_0055959 3300046519 Bacteria 1929
241 Ga0495632_0117140 3300046519 Bacteria 1247
242 Ga0495632_0123959 3300046519 Bacteria 1205
243 Ga0495643_0042080 3300046522 Bacteria 2489
244 Ga0495644_0000691 3300046523 Bacteria 13979
245 Ga0495648_0025665 3300046524 Bacteria 3984
246 Ga0495648_0112065 3300046524 Bacteria 1482
247 Ga0495633_0024603 3300046558 Bacteria 2974
248 Ga0495633_0063342 3300046558 Bacteria 1730
249 Ga0495656_0004657 3300046615 Bacteria 4711
250 Ga0495611_0000166 3300046648 Bacteria 47251
251 Ga0495625_0000052 3300046660 Bacteria 190656
252 Ga0495625_0005955 3300046660 Bacteria 10964
253 Ga0495625_0007906 3300046660 Bacteria 9148
254 Ga0495625_0011172 3300046660 Bacteria 7345
255 Ga0495625_0039256 3300046660 Bacteria 3459
256 Ga0495661_0000098 3300046665 Bacteria 106670
257 Ga0495661_0443461 3300046665 Bacteria 626
258 Ga0495671_0175140 3300046692 Bacteria 1042
259 Ga0495677_0000767 3300047445 Bacteria 12919
260 Ga0495686_0319784 3300047472 Bacteria 851
261 Ga0496100_0100056 3300048903 Bacteria 1996
262 Ga0496101_0009233 3300048904 Bacteria 6476
263 Ga0496102_0001828 3300048905 Bacteria 18368
264 Ga0496102_0029462 3300048905 Bacteria 4911
265 Ga0496102_0418385 3300048905 Unclassified 1259
266 Ga0496104_0020789 3300048907 Bacteria 6019
267 Ga0496105_0005046 3300048908 Bacteria 9997
268 Ga0496108_0445528 3300048911 Bacteria 1131
269 Ga0496110_0073509 3300048913 Bacteria 3034
270 Ga0496110_0885951 3300048913 Bacteria 798
271 Ga0496111_0309966 3300048914 Bacteria 1170
272 Ga0496112_0223894 3300048915 Bacteria 1837
273 Ga0496124_0004167 3300048927 Bacteria 17050
274 Ga0495682_0000108 3300049460 Bacteria 73226
275 Ga0501040_0148357 3300049576 Bacteria 1654
276 Ga0501079_0483753 3300049741 Bacteria 973
277 nmdc:mga03683_175364_c1 3300050489 Bacteria 976
278 nmdc:mga03683_270625_c1 3300050489 Bacteria 792
279 nmdc:mga03683_35214_c1 3300050489 Bacteria 2029
280 nmdc:mga03683_39411_c1 3300050489 Bacteria 1934
281 nmdc:mga03683_460922_c1 3300050489 Bacteria 612
282 nmdc:mga03n38_13728_c1 3300050490 Bacteria 3085
283 nmdc:mga03n38_334973_c1 3300050490 Bacteria 820
284 nmdc:mga03n38_646149_c1 3300050490 Bacteria 606
285 nmdc:mga0yw44_1252089_c1 3300050492 Bacteria 500
286 nmdc:mga0yw44_18710_c1 3300050492 Bacteria 3802
287 nmdc:mga0yw44_44630_c1 3300050492 Bacteria 2652
288 nmdc:mga0yw44_615196_c1 3300050492 Bacteria 738
289 nmdc:mga0k408_301890_c1 3300050493 Bacteria 956
290 nmdc:mga0k408_354756_c1 3300050493 Bacteria 874
291 nmdc:mga0k408_713497_c1 3300050493 Bacteria 587
292 nmdc:mga06z11_165567_c1 3300050494 Bacteria 1266
293 nmdc:mga07m45_214996_c1 3300050496 Bacteria 1118
294 nmdc:mga07m45_216449_c1 3300050496 Bacteria 1114
295 nmdc:mga07m45_400423_c1 3300050496 Bacteria 797
296 Ga0500578_0022596 3300053086 Bacteria 4039
297 Ga0500651_0000423 3300053093 Bacteria 22721
298 Ga0500566_0104722 3300053094 Bacteria 1546
299 Ga0500650_0003554 3300053098 Bacteria 5455
300 Ga0500554_102409 3300053102 Bacteria 959
301 Ga0500562_131817 3300053108 Bacteria 681
302 Ga0500562_169201 3300053108 Bacteria 594
303 Ga0500652_017800 3300053131 Bacteria 2611
304 Ga0500658_0032974 3300053134 Bacteria 2034
305 Ga0500588_0127512 3300053146 Bacteria 903
306 Ga0500634_0000036 3300053161 Bacteria 64860
307 Ga0500634_0096383 3300053161 Bacteria 1490
308 Ga0500645_000597 3300053730 Bacteria 23163
309 Ga0500645_001339 3300053730 Bacteria 12732
310 Ga0500587_000180 3300053739 Bacteria 6373
311 Ga0500661_005465 3300055283 Bacteria 2373
312 Ga0587083_0020154 3300059505 Bacteria 1226
313 Ga0587068_101629 3300059641 Bacteria 604
314 Ga0587079_086731 3300059647 Bacteria 726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0117140 Ga0495632_0117140_16_342 107
2 3300046665 Ga0495661_0443461 Ga0495661_0443461_27_353 107
3 3300050489 nmdc:mga03683_270625_c1 nmdc:mga03683_270625_c1_178_546 122
4 3300050493 nmdc:mga0k408_354756_c1 nmdc:mga0k408_354756_c1_318_686 122
5 iso_pu_bacteria 2585428062 2587756443 125
6 iso_pu_bacteria 2588253510 2588293062 125
7 3300042005 Ga0439448_0034042 Ga0439448_0034042_315_695 126
8 3300042008 Ga0439450_035552 Ga0439450_035552_227_607 126
9 3300042012 Ga0439455_0001827 Ga0439455_0001827_111_491 126
10 iso_pu_bacteria 2643221639 2644220976 126
11 iso_pu_bacteria 2643221646 2644259820 126
12 iso_pu_bacteria 2873314349 2873320381 126
13 3300053093 Ga0500651_0000423 Ga0500651_0000423_21448_21837 127
14 3300053146 Ga0500588_0127512 Ga0500588_0127512_26_415 127
15 iso_pu_bacteria 2857564685 2857565794 127
16 3300002987 JGI25159J45721_1014261 JGI25159J45721_10142613 128
17 3300003354 JGI25160J50197_1018268 JGI25160J50197_10182682 128
18 3300003771 Ga0055526_1006691 Ga0055526_10066912 128
19 3300003771 Ga0055526_1038989 Ga0055526_10389891 128
20 3300003773 Ga0055537_1000651 Ga0055537_100065113 128
21 3300003775 Ga0055524_1000213 Ga0055524_100021335 128
22 3300003781 Ga0055536_1060162 Ga0055536_10601622 128
23 3300003784 Ga0055534_1030709 Ga0055534_10307091 128
24 3300003790 Ga0055528_1003770 Ga0055528_10037708 128
25 3300003791 Ga0055530_10001155 Ga0055530_1000115513 128
26 3300003792 Ga0055540_1000176 Ga0055540_100017653 128
27 3300003794 Ga0055531_10015770 Ga0055531_100157703 128
28 3300005328 Ga0070676_10041953 Ga0070676_100419532 128
29 3300005328 Ga0070676_10320857 Ga0070676_103208572 128
30 3300005330 Ga0070690_100380944 Ga0070690_1003809442 128
31 3300005333 Ga0070677_10012407 Ga0070677_100124074 128
32 3300005338 Ga0068868_100089997 Ga0068868_1000899974 128
33 3300005347 Ga0070668_102016196 Ga0070668_1020161961 128
34 3300005354 Ga0070675_100202730 Ga0070675_1002027302 128
35 3300005355 Ga0070671_100015373 Ga0070671_1000153735 128
36 3300005356 Ga0070674_100064331 Ga0070674_1000643312 128
37 3300005356 Ga0070674_100128747 Ga0070674_1001287473 128
38 3300005364 Ga0070673_100559168 Ga0070673_1005591682 128
39 3300005456 Ga0070678_100000882 Ga0070678_10000088216 128
40 3300005456 Ga0070678_100048060 Ga0070678_1000480605 128
41 3300005459 Ga0068867_100039130 Ga0068867_1000391304 128
42 3300005459 Ga0068867_101237173 Ga0068867_1012371732 128
43 3300005539 Ga0068853_100344997 Ga0068853_1003449972 128
44 3300005543 Ga0070672_100064767 Ga0070672_1000647672 128
45 3300005545 Ga0070695_101722219 Ga0070695_1017222191 128
46 3300005548 Ga0070665_100432199 Ga0070665_1004321993 128
47 3300005578 Ga0068854_100562288 Ga0068854_1005622882 128
48 3300006177 Ga0075362_10433390 Ga0075362_104333901 128
49 3300006237 Ga0097621_100011025 Ga0097621_1000110256 128
50 3300006353 Ga0075370_10196925 Ga0075370_101969252 128
51 3300006353 Ga0075370_10276337 Ga0075370_102763372 128
52 3300006358 Ga0068871_100015502 Ga0068871_1000155024 128
53 3300006881 Ga0068865_101897775 Ga0068865_1018977751 128
54 3300009177 Ga0105248_10317169 Ga0105248_103171694 128
55 3300013306 Ga0163162_10101840 Ga0163162_101018405 128
56 3300013306 Ga0163162_10406557 Ga0163162_104065573 128
57 3300013308 Ga0157375_11412783 Ga0157375_114127832 128
58 3300014969 Ga0157376_10264534 Ga0157376_102645343 128
59 3300017792 Ga0163161_10133972 Ga0163161_101339721 128
60 3300025231 Ga0207427_100099 Ga0207427_1000992 128
61 3300025233 Ga0209437_101737 Ga0209437_1017374 128
62 3300025261 Ga0209233_1000001 Ga0209233_10000012846 128
63 3300025263 Ga0209565_1000041 Ga0209565_100004117 128
64 3300025273 Ga0209673_1000364 Ga0209673_10003648 128
65 3300025284 Ga0209130_1000878 Ga0209130_10008785 128
66 3300025291 Ga0209675_1000473 Ga0209675_100047322 128
67 3300025292 Ga0209676_1000013 Ga0209676_1000013252 128
68 3300025294 Ga0209025_1066260 Ga0209025_10662601 128
69 3300025295 Ga0209564_1000875 Ga0209564_100087521 128
70 3300025295 Ga0209564_1002130 Ga0209564_100213013 128
71 3300025298 Ga0209050_1000008 Ga0209050_1000008252 128
72 3300025299 Ga0209256_1000003 Ga0209256_1000003149 128
73 3300025302 Ga0207426_1015868 Ga0207426_10158683 128
74 3300025303 Ga0209051_1000005 Ga0209051_1000005252 128
75 3300025304 Ga0209257_1000048 Ga0209257_1000048252 128
76 3300025907 Ga0207645_10097146 Ga0207645_100971462 128
77 3300025907 Ga0207645_10768208 Ga0207645_107682082 128
78 3300025922 Ga0207646_11138831 Ga0207646_111388312 128
79 3300025925 Ga0207650_11444644 Ga0207650_114446441 128
80 3300025931 Ga0207644_10825570 Ga0207644_108255701 128
81 3300025931 Ga0207644_11043819 Ga0207644_110438192 128
82 3300025937 Ga0207669_10058843 Ga0207669_100588433 128
83 3300025937 Ga0207669_10747133 Ga0207669_107471332 128
84 3300025940 Ga0207691_10028325 Ga0207691_100283252 128
85 3300025941 Ga0207711_10317135 Ga0207711_103171354 128
86 3300025960 Ga0207651_10544748 Ga0207651_105447482 128
87 3300025972 Ga0207668_11282695 Ga0207668_112826951 128
88 3300025981 Ga0207640_10165422 Ga0207640_101654223 128
89 3300026023 Ga0207677_10490855 Ga0207677_104908552 128
90 3300026067 Ga0207678_11121962 Ga0207678_111219622 128
91 3300026121 Ga0207683_10009055 Ga0207683_100090555 128
92 3300026121 Ga0207683_10404166 Ga0207683_104041663 128
93 3300027717 Ga0209998_10013337 Ga0209998_100133372 128
94 3300028379 Ga0268266_10814018 Ga0268266_108140182 128
95 3300028794 Ga0307515_10000090 Ga0307515_10000090181 128
96 3300028794 Ga0307515_10059985 Ga0307515_100599852 128
97 3300030522 Ga0307512_10172857 Ga0307512_101728572 128
98 3300031456 Ga0307513_10000072 Ga0307513_1000007256 128
99 3300031456 Ga0307513_10168742 Ga0307513_101687423 128
100 3300031507 Ga0307509_10270121 Ga0307509_102701212 128
101 3300031730 Ga0307516_10003606 Ga0307516_1000360612 128
102 3300031730 Ga0307516_10514331 Ga0307516_105143312 128
103 3300033180 Ga0307510_10632269 Ga0307510_106322691 128
104 3300035091 Ga0373951_0004132 Ga0373951_0004132_1478_1870 128
105 3300035114 Ga0373939_0000013 Ga0373939_0000013_11774_12166 128
106 3300035121 Ga0373960_0002051 Ga0373960_0002051_2332_2724 128
107 3300035691 Ga0373931_0000279 Ga0373931_0000279_11382_11774 128
108 3300037068 Ga0373925_0379150 Ga0373925_0379150_108_497 128
109 3300041451 Ga0451791_0431003 Ga0451791_0431003_272_661 128
110 3300041452 Ga0451793_1706672 Ga0451793_1706672_280_669 128
111 3300041453 Ga0451797_1056710 Ga0451797_1056710_195_584 128
112 3300041463 Ga0451804_0756674 Ga0451804_0756674_307_696 128
113 3300041486 Ga0451807_1298168 Ga0451807_1298168_503_892 128
114 3300041486 Ga0451807_2410811 Ga0451807_2410811_272_661 128
115 3300041492 Ga0451835_0107182 Ga0451835_0107182_243_632 128
116 3300041498 Ga0451841_0329054 Ga0451841_0329054_98_505 128
117 3300041498 Ga0451841_0433419 Ga0451841_0433419_246_635 128
118 3300041509 Ga0451843_0492596 Ga0451843_0492596_196_585 128
119 3300041511 Ga0451855_2027166 Ga0451855_2027166_335_724 128
120 3300044683 Ga0466965_0804261 Ga0466965_0804261_20_409 128
121 3300044693 Ga0466961_0097257 Ga0466961_0097257_106_495 128
122 3300044694 Ga0466963_0806317 Ga0466963_0806317_202_591 128
123 3300044735 Ga0466968_0018441 Ga0466968_0018441_1054_1443 128
124 3300044765 Ga0466970_0041412 Ga0466970_0041412_356_745 128
125 3300044842 Ga0466957_0067902 Ga0466957_0067902_1445_1834 128
126 3300045049 Ga0466959_0006722 Ga0466959_0006722_5061_5450 128
127 3300046460 Ga0495638_0238849 Ga0495638_0238849_336_728 128
128 3300046492 Ga0495585_0000001 Ga0495585_0000001_435731_436120 128
129 3300046507 Ga0495606_0481435 Ga0495606_0481435_23_412 128
130 3300046512 Ga0495610_0013627 Ga0495610_0013627_717_1106 128
131 3300046517 Ga0495630_0599937 Ga0495630_0599937_186_575 128
132 3300046518 Ga0495631_0002878 Ga0495631_0002878_5338_5727 128
133 3300046519 Ga0495632_0055959 Ga0495632_0055959_1069_1458 128
134 3300046519 Ga0495632_0123959 Ga0495632_0123959_15_404 128
135 3300046522 Ga0495643_0042080 Ga0495643_0042080_1956_2345 128
136 3300046524 Ga0495648_0025665 Ga0495648_0025665_2620_3009 128
137 3300046524 Ga0495648_0112065 Ga0495648_0112065_611_1000 128
138 3300046558 Ga0495633_0024603 Ga0495633_0024603_1322_1720 128
139 3300046558 Ga0495633_0063342 Ga0495633_0063342_282_674 128
140 3300046660 Ga0495625_0005955 Ga0495625_0005955_1680_2069 128
141 3300046660 Ga0495625_0007906 Ga0495625_0007906_7234_7632 128
142 3300046660 Ga0495625_0011172 Ga0495625_0011172_2781_3170 128
143 3300046660 Ga0495625_0039256 Ga0495625_0039256_1710_2108 128
144 3300046665 Ga0495661_0000098 Ga0495661_0000098_73984_74373 128
145 3300046692 Ga0495671_0175140 Ga0495671_0175140_277_669 128
146 3300047472 Ga0495686_0319784 Ga0495686_0319784_299_688 128
147 3300048903 Ga0496100_0100056 Ga0496100_0100056_1273_1662 128
148 3300048904 Ga0496101_0009233 Ga0496101_0009233_3004_3393 128
149 3300048905 Ga0496102_0001828 Ga0496102_0001828_11052_11441 128
150 3300048907 Ga0496104_0020789 Ga0496104_0020789_2466_2855 128
151 3300048908 Ga0496105_0005046 Ga0496105_0005046_2983_3372 128
152 3300048911 Ga0496108_0445528 Ga0496108_0445528_303_692 128
153 3300048913 Ga0496110_0073509 Ga0496110_0073509_516_905 128
154 3300049460 Ga0495682_0000108 Ga0495682_0000108_67458_67847 128
155 3300050490 nmdc:mga03n38_334973_c1 nmdc:mga03n38_334973_c1_350_739 128
156 3300050493 nmdc:mga0k408_301890_c1 nmdc:mga0k408_301890_c1_28_417 128
157 3300050493 nmdc:mga0k408_713497_c1 nmdc:mga0k408_713497_c1_161_550 128
158 3300050496 nmdc:mga07m45_214996_c1 nmdc:mga07m45_214996_c1_471_860 128
159 3300050496 nmdc:mga07m45_216449_c1 nmdc:mga07m45_216449_c1_654_1043 128
160 3300050496 nmdc:mga07m45_400423_c1 nmdc:mga07m45_400423_c1_202_591 128
161 3300053086 Ga0500578_0022596 Ga0500578_0022596_1092_1481 128
162 3300053102 Ga0500554_102409 Ga0500554_102409_296_685 128
163 3300053108 Ga0500562_131817 Ga0500562_131817_257_655 128
164 3300053108 Ga0500562_169201 Ga0500562_169201_190_579 128
165 3300053131 Ga0500652_017800 Ga0500652_017800_1196_1582 128
166 3300053134 Ga0500658_0032974 Ga0500658_0032974_1252_1641 128
167 3300053161 Ga0500634_0000036 Ga0500634_0000036_51800_52192 128
168 3300053161 Ga0500634_0096383 Ga0500634_0096383_514_906 128
169 3300053730 Ga0500645_000597 Ga0500645_000597_19403_19792 128
170 3300053730 Ga0500645_001339 Ga0500645_001339_4353_4760 128
171 3300053739 Ga0500587_000180 Ga0500587_000180_3669_4058 128
172 iso_pu_bacteria 2904424332 2904427375 128
173 3300003322 rootL2_10197643 rootL2_101976431 129
174 3300003759 Ga0055525_1000001 Ga0055525_1000001895 129
175 3300003792 Ga0055540_1001071 Ga0055540_10010716 129
176 3300005327 Ga0070658_10028371 Ga0070658_100283717 129
177 3300005327 Ga0070658_10067074 Ga0070658_100670743 129
178 3300005339 Ga0070660_100028476 Ga0070660_1000284762 129
179 3300005366 Ga0070659_101422347 Ga0070659_1014223471 129
180 3300005366 Ga0070659_101450648 Ga0070659_1014506482 129
181 3300005457 Ga0070662_100118009 Ga0070662_1001180092 129
182 3300005563 Ga0068855_100976037 Ga0068855_1009760372 129
183 3300005564 Ga0070664_100064596 Ga0070664_1000645964 129
184 3300005578 Ga0068854_100822784 Ga0068854_1008227842 129
185 3300005834 Ga0068851_10513295 Ga0068851_105132951 129
186 3300006038 Ga0075365_10008257 Ga0075365_100082577 129
187 3300006177 Ga0075362_10016035 Ga0075362_100160354 129
188 3300006177 Ga0075362_10084952 Ga0075362_100849523 129
189 3300006195 Ga0075366_10007061 Ga0075366_100070616 129
190 3300009093 Ga0105240_11171934 Ga0105240_111719341 129
191 3300009148 Ga0105243_10003321 Ga0105243_100033216 129
192 3300011119 Ga0105246_10206872 Ga0105246_102068722 129
193 3300011119 Ga0105246_10997538 Ga0105246_109975381 129
194 3300013296 Ga0157374_10748541 Ga0157374_107485412 129
195 3300013307 Ga0157372_11555461 Ga0157372_115554612 129
196 3300021361 Ga0213872_10140246 Ga0213872_101402462 129
197 3300025230 Ga0209563_100007 Ga0209563_100007204 129
198 3300025253 Ga0209677_104467 Ga0209677_1044675 129
199 3300025292 Ga0209676_1001785 Ga0209676_10017856 129
200 3300025303 Ga0209051_1001716 Ga0209051_100171612 129
201 3300025304 Ga0209257_1004739 Ga0209257_10047398 129
202 3300025909 Ga0207705_10015802 Ga0207705_100158022 129
203 3300025919 Ga0207657_10024968 Ga0207657_100249686 129
204 3300025920 Ga0207649_11099475 Ga0207649_110994751 129
205 3300025932 Ga0207690_10454419 Ga0207690_104544192 129
206 3300025933 Ga0207706_10088319 Ga0207706_100883191 129
207 3300025935 Ga0207709_10000391 Ga0207709_100003918 129
208 3300025945 Ga0207679_10338899 Ga0207679_103388992 129
209 3300025949 Ga0207667_10588413 Ga0207667_105884132 129
210 3300025981 Ga0207640_10784473 Ga0207640_107844732 129
211 3300028794 Ga0307515_10081922 Ga0307515_100819222 129
212 3300031616 Ga0307508_10000081 Ga0307508_1000008153 129
213 3300031911 Ga0307412_10286318 Ga0307412_102863183 129
214 3300037312 Ga0395899_0092046 Ga0395899_0092046_239_631 129
215 3300037418 Ga0395900_0044046 Ga0395900_0044046_3109_3501 129
216 3300037466 Ga0395898_0747883 Ga0395898_0747883_193_585 129
217 3300037471 Ga0395905_0342714 Ga0395905_0342714_358_750 129
218 3300038443 Ga0395901_0056394 Ga0395901_0056394_2040_2432 129
219 3300044712 Ga0453684_0000341 Ga0453684_0000341_54996_55388 129
220 3300044712 Ga0453684_0026564 Ga0453684_0026564_5968_6363 129
221 3300048905 Ga0496102_0029462 Ga0496102_0029462_3065_3457 129
222 3300048905 Ga0496102_0418385 Ga0496102_0418385_599_991 129
223 3300048913 Ga0496110_0885951 Ga0496110_0885951_298_690 129
224 3300048914 Ga0496111_0309966 Ga0496111_0309966_717_1109 129
225 3300048915 Ga0496112_0223894 Ga0496112_0223894_1039_1431 129
226 3300048927 Ga0496124_0004167 Ga0496124_0004167_10874_11266 129
227 3300049576 Ga0501040_0148357 Ga0501040_0148357_1198_1587 129
228 3300049741 Ga0501079_0483753 Ga0501079_0483753_80_469 129
229 3300050489 nmdc:mga03683_175364_c1 nmdc:mga03683_175364_c1_128_520 129
230 3300050489 nmdc:mga03683_35214_c1 nmdc:mga03683_35214_c1_816_1208 129
231 3300050490 nmdc:mga03n38_646149_c1 nmdc:mga03n38_646149_c1_72_464 129
232 3300050492 nmdc:mga0yw44_1252089_c1 nmdc:mga0yw44_1252089_c1_85_477 129
233 3300050492 nmdc:mga0yw44_18710_c1 nmdc:mga0yw44_18710_c1_2303_2731 129
234 3300050492 nmdc:mga0yw44_44630_c1 nmdc:mga0yw44_44630_c1_239_631 129
235 3300050492 nmdc:mga0yw44_615196_c1 nmdc:mga0yw44_615196_c1_260_652 129
236 3300050494 nmdc:mga06z11_165567_c1 nmdc:mga06z11_165567_c1_860_1252 129
237 3300059505 Ga0587083_0020154 Ga0587083_0020154_678_1070 129
238 3300059641 Ga0587068_101629 Ga0587068_101629_133_525 129
239 3300059647 Ga0587079_086731 Ga0587079_086731_151_543 129
240 3300002704 JGI25155J39150_1000042 JGI25155J39150_100004274 130
241 3300002705 JGI25156J39149_1000053 JGI25156J39149_10000537 130
242 3300002738 JGI25154J39366_1000082 JGI25154J39366_10000827 130
243 3300002741 JGI25157J39369_1000072 JGI25157J39369_100007274 130
244 3300003187 JGI25151J46595_10010750 JGI25151J46595_100107503 130
245 3300003322 rootL2_10089550 rootL2_100895503 130
246 3300003771 Ga0055526_1025302 Ga0055526_10253022 130
247 3300003773 Ga0055537_1000433 Ga0055537_100043322 130
248 3300003784 Ga0055534_1000008 Ga0055534_100000870 130
249 3300003784 Ga0055534_1035855 Ga0055534_10358551 130
250 3300003790 Ga0055528_1003667 Ga0055528_10036677 130
251 3300005262 Ga0065165_1018696 Ga0065165_10186962 130
252 3300005455 Ga0070663_100003407 Ga0070663_1000034073 130
253 3300005459 Ga0068867_101392502 Ga0068867_1013925021 130
254 3300005539 Ga0068853_100245642 Ga0068853_1002456422 130
255 3300005563 Ga0068855_102012933 Ga0068855_1020129332 130
256 3300005616 Ga0068852_100064640 Ga0068852_1000646401 130
257 3300005834 Ga0068851_10787439 Ga0068851_107874391 130
258 3300006048 Ga0075363_100155517 Ga0075363_1001555172 130
259 3300006353 Ga0075370_10131883 Ga0075370_101318832 130
260 3300006881 Ga0068865_101537688 Ga0068865_1015376881 130
261 3300006946 Ga0079104_1016962 Ga0079104_10169623 130
262 3300006948 Ga0099826_10000084 Ga0099826_1000008420 130
263 3300011119 Ga0105246_10244906 Ga0105246_102449063 130
264 3300014497 Ga0182008_10690681 Ga0182008_106906811 130
265 3300021361 Ga0213872_10004025 Ga0213872_100040256 130
266 3300025206 Ga0209435_100019 Ga0209435_100019139 130
267 3300025245 Ga0207425_1059007 Ga0207425_10590072 130
268 3300025246 Ga0209646_1000038 Ga0209646_1000038140 130
269 3300025250 Ga0209026_1000048 Ga0209026_1000048139 130
270 3300025256 Ga0209759_1000038 Ga0209759_1000038105 130
271 3300025258 Ga0209129_1004365 Ga0209129_10043655 130
272 3300025263 Ga0209565_1000042 Ga0209565_100004270 130
273 3300025273 Ga0209673_1000071 Ga0209673_1000071158 130
274 3300025273 Ga0209673_1002185 Ga0209673_10021857 130
275 3300025273 Ga0209673_1026964 Ga0209673_10269643 130
276 3300025291 Ga0209675_1000041 Ga0209675_1000041157 130
277 3300025291 Ga0209675_1005248 Ga0209675_10052486 130
278 3300025291 Ga0209675_1019737 Ga0209675_10197372 130
279 3300025292 Ga0209676_1003345 Ga0209676_10033456 130
280 3300025292 Ga0209676_1025894 Ga0209676_10258943 130
281 3300025294 Ga0209025_1012759 Ga0209025_10127596 130
282 3300025294 Ga0209025_1013874 Ga0209025_10138744 130
283 3300025294 Ga0209025_1041266 Ga0209025_10412662 130
284 3300025295 Ga0209564_1003568 Ga0209564_10035686 130
285 3300025295 Ga0209564_1089464 Ga0209564_10894642 130
286 3300025297 Ga0209758_1052837 Ga0209758_10528372 130
287 3300025298 Ga0209050_1008276 Ga0209050_10082764 130
288 3300025299 Ga0209256_1039392 Ga0209256_10393922 130
289 3300025299 Ga0209256_1041050 Ga0209256_10410502 130
290 3300025302 Ga0207426_1102914 Ga0207426_11029141 130
291 3300025304 Ga0209257_1005967 Ga0209257_10059676 130
292 3300025321 Ga0207656_10525492 Ga0207656_105254922 130
293 3300025938 Ga0207704_11162012 Ga0207704_111620121 130
294 3300025949 Ga0207667_11689398 Ga0207667_116893981 130
295 3300026023 Ga0207677_10067013 Ga0207677_100670133 130
296 3300026041 Ga0207639_10117466 Ga0207639_101174662 130
297 3300026067 Ga0207678_10054214 Ga0207678_100542144 130
298 3300026089 Ga0207648_10220603 Ga0207648_102206033 130
299 3300026118 Ga0207675_101564622 Ga0207675_1015646221 130
300 3300027111 Ga0209281_1018277 Ga0209281_10182773 130
301 3300027666 Ga0209282_1000112 Ga0209282_100011220 130
302 3300028794 Ga0307515_10033867 Ga0307515_100338679 130
303 3300031548 Ga0307408_100664053 Ga0307408_1006640532 130
304 3300031911 Ga0307412_10269813 Ga0307412_102698132 130
305 3300031911 Ga0307412_11969140 Ga0307412_119691401 130
306 3300032004 Ga0307414_11129568 Ga0307414_111295682 130
307 3300032005 Ga0307411_10304516 Ga0307411_103045162 130
308 3300039447 Ga0436361_1051926 Ga0436361_1051926_6251_6664 130
309 3300041494 Ga0451837_1026473 Ga0451837_1026473_11_436 130
310 3300046453 Ga0495627_000008 Ga0495627_000008_90801_91202 130
311 3300046523 Ga0495644_0000691 Ga0495644_0000691_4470_4880 130
312 3300046615 Ga0495656_0004657 Ga0495656_0004657_1031_1441 130
313 3300046648 Ga0495611_0000166 Ga0495611_0000166_43376_43786 130
314 3300046660 Ga0495625_0000052 Ga0495625_0000052_166166_166570 130
315 3300047445 Ga0495677_0000767 Ga0495677_0000767_7287_7697 130
316 3300050489 nmdc:mga03683_39411_c1 nmdc:mga03683_39411_c1_388_792 130
317 3300050489 nmdc:mga03683_460922_c1 nmdc:mga03683_460922_c1_42_446 130
318 3300050490 nmdc:mga03n38_13728_c1 nmdc:mga03n38_13728_c1_298_702 130
319 3300053094 Ga0500566_0104722 Ga0500566_0104722_981_1379 130
320 3300053098 Ga0500650_0003554 Ga0500650_0003554_351_758 130
321 3300055283 Ga0500661_005465 Ga0500661_005465_1495_1893 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

8

116

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.9931 1 125
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.9625 1 125
8dp5-assembly1.cif.gz_C structure of the peak3/14-3-3 complex 0.9611 1 24
3grd-assembly1.cif.gz_B crystal structure of ntf2-superfamily protein with unknown function (np_977240.1) from bacillus cereus atcc 10987 at 1.25 a resolution 0.94 1 125
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.9163 1 124
ID Description Score Start End Superfamily
3ec9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9764 1 124 3.10.450.50
3ec9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9533 1 124 3.10.450.50
af_A4IBU6_1_121_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9444 1 24 1.25.40.10
af_I1KNK8_246_352_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9118 1 24 1.25.40.10
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8973 3 127 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4Q3F4T4-F1-model_v4 deleted 1.001 29 118
AF-A0A6P0B1E2-F1-model_v4 DUF4440 domain-containing protein 0.9946 1 125
AF-A0A7W1QXY0-F1-model_v4 Nuclear transport factor 2 family protein 0.9928 1 124
AF-A0A1E4IJX8-F1-model_v4 DUF4440 domain-containing protein 0.9918 1 125
AF-A0A7X0IUN0-F1-model_v4 SnoaL-like domain-containing protein 0.9916 1 125

Feature Viewer

pLDDT pTM Quality
97.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map