F406100

General Info

Members Datasets Scaffolds Average Seq Length
321 214 320 116

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0751096|Ga0466965_0751096_117_524
Length 135
Sequence VPFDYPSDIPTIEENEMKRFMAVFTGSPGAFESYMKRFPNEEARKANDRKGIEAWHQWVEQHQGSIVDGGGPLGRTKRVTKDGIADVRNNLAGYTVIQAESQEAAAKLFLNHPHFAIFPGDGVEIMEVMPIPERP

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
190 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 1.25
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10044414 3300003316 Bacteria 8412
2 Ga0065712_10183681 3300005290 Unclassified 1180
3 Ga0070658_10019880 3300005327 Bacteria 5380
4 Ga0070658_10198342 3300005327 Bacteria 1693
5 Ga0070676_10268775 3300005328 Unclassified 1144
6 Ga0070690_101049779 3300005330 Bacteria 644
7 Ga0070670_100343325 3300005331 Bacteria 1311
8 Ga0068869_100624483 3300005334 Unclassified 912
9 Ga0068869_100843275 3300005334 Bacteria 790
10 Ga0070680_100157611 3300005336 Bacteria 1907
11 Ga0070680_100313426 3300005336 Bacteria 1331
12 Ga0068868_101643715 3300005338 Unclassified 604
13 Ga0068868_101686414 3300005338 Bacteria 597
14 Ga0068868_102262141 3300005338 Bacteria 518
15 Ga0070660_101083369 3300005339 Bacteria 678
16 Ga0070661_101104377 3300005344 Bacteria 661
17 Ga0070692_11240612 3300005345 Bacteria 532
18 Ga0070668_100021283 3300005347 Bacteria 4902
19 Ga0070671_100672345 3300005355 Unclassified 897
20 Ga0070659_100063745 3300005366 Bacteria 2916
21 Ga0070667_101381946 3300005367 Unclassified 660
22 Ga0070714_100010031 3300005435 Bacteria 7473
23 Ga0070714_100831987 3300005435 Unclassified 895
24 Ga0070711_100045960 3300005439 Unclassified 2972
25 Ga0070681_10024246 3300005458 Bacteria 6107
26 Ga0070681_10933901 3300005458 Unclassified 786
27 Ga0070681_11307064 3300005458 Bacteria 648
28 Ga0068867_100315632 3300005459 Bacteria 1293
29 Ga0068867_101721064 3300005459 Bacteria 588
30 Ga0070698_100648582 3300005471 Bacteria 997
31 Ga0070698_101581051 3300005471 Bacteria 607
32 Ga0070679_100022894 3300005530 Bacteria 6111
33 Ga0070679_100336719 3300005530 Bacteria 1457
34 Ga0070684_100630893 3300005535 Bacteria 997
35 Ga0070684_101899363 3300005535 Bacteria 562
36 Ga0068853_100072156 3300005539 Bacteria 3008
37 Ga0070695_100821596 3300005545 Bacteria 746
38 Ga0070696_100929091 3300005546 Bacteria 723
39 Ga0070696_101309763 3300005546 Bacteria 615
40 Ga0070665_100138070 3300005548 Bacteria 2441
41 Ga0070665_100322585 3300005548 Bacteria 1549
42 Ga0068855_100050641 3300005563 Bacteria 4893
43 Ga0068855_100061351 3300005563 Bacteria 4394
44 Ga0068855_100087734 3300005563 Bacteria 3595
45 Ga0068855_100261838 3300005563 Bacteria 1926
46 Ga0070664_100235617 3300005564 Bacteria 1642
47 Ga0068857_101368506 3300005577 Bacteria 688
48 Ga0068854_100609593 3300005578 Bacteria 933
49 Ga0068856_100023417 3300005614 Bacteria 6004
50 Ga0068856_100204360 3300005614 Bacteria 1990
51 Ga0068852_100006478 3300005616 Bacteria 8461
52 Ga0068852_100055393 3300005616 Bacteria 3423
53 Ga0068859_100256805 3300005617 Bacteria 1838
54 Ga0068864_100290582 3300005618 Bacteria 1528
55 Ga0068864_101980711 3300005618 Unclassified 588
56 Ga0068870_10888225 3300005840 Unclassified 629
57 Ga0068863_100138998 3300005841 Bacteria 2321
58 Ga0068863_100947749 3300005841 Unclassified 862
59 Ga0068858_100055866 3300005842 Unclassified 3649
60 Ga0068858_101870002 3300005842 Bacteria 593
61 Ga0068860_101053923 3300005843 Bacteria 832
62 Ga0068860_101506721 3300005843 Unclassified 694
63 Ga0068860_101919072 3300005843 Unclassified 614
64 Ga0068862_100306716 3300005844 Bacteria 1462
65 Ga0068862_100473122 3300005844 Bacteria 1185
66 Ga0075363_100811884 3300006048 Bacteria 569
67 Ga0097621_100384096 3300006237 Bacteria 1255
68 Ga0097621_100427047 3300006237 Bacteria 1190
69 Ga0075370_10785444 3300006353 Bacteria 580
70 Ga0068871_100374848 3300006358 Bacteria 1263
71 Ga0075428_100057554 3300006844 Bacteria 4255
72 Ga0075428_100159962 3300006844 Bacteria 2445
73 Ga0075428_100255148 3300006844 Bacteria 1889
74 Ga0075428_101981569 3300006844 Bacteria 604
75 Ga0075430_100452142 3300006846 Bacteria 1060
76 Ga0075430_101346412 3300006846 Unclassified 587
77 Ga0075431_100273666 3300006847 Bacteria 1711
78 Ga0075433_11100962 3300006852 Bacteria 691
79 Ga0075429_101146180 3300006880 Bacteria 679
80 Ga0075429_101842077 3300006880 Unclassified 525
81 Ga0068865_101261287 3300006881 Bacteria 656
82 Ga0097620_100256806 3300006931 Bacteria 1838
83 Ga0075435_100491570 3300007076 Bacteria 1061
84 Ga0105240_10037899 3300009093 Bacteria 6190
85 Ga0105240_10081410 3300009093 Bacteria 3979
86 Ga0105240_10192016 3300009093 Bacteria 2400
87 Ga0111539_10004167 3300009094 Bacteria 18959
88 Ga0111539_11227650 3300009094 Bacteria 870
89 Ga0111539_13239428 3300009094 Bacteria 524
90 Ga0105245_10021426 3300009098 Bacteria 5670
91 Ga0105245_10164440 3300009098 Bacteria 2108
92 Ga0105243_10181684 3300009148 Bacteria 1830
93 Ga0105242_10055552 3300009176 Unclassified 3239
94 Ga0105242_10607742 3300009176 Bacteria 1057
95 Ga0105242_12945083 3300009176 Unclassified 526
96 Ga0105248_10318333 3300009177 Unclassified 1752
97 Ga0105248_10559036 3300009177 Bacteria 1291
98 Ga0105237_12017891 3300009545 Unclassified 585
99 Ga0105238_10007264 3300009551 Bacteria 11090
100 Ga0105249_10860380 3300009553 Bacteria 972
101 Ga0099796_10225635 3300010159 Bacteria 769
102 Ga0105239_11168532 3300010375 Unclassified 886
103 Ga0105246_11088558 3300011119 Unclassified 729
104 Ga0105246_12027538 3300011119 Unclassified 556
105 Ga0157373_10513763 3300013100 Bacteria 866
106 Ga0157371_10621538 3300013102 Bacteria 805
107 Ga0157370_10074467 3300013104 Bacteria 3203
108 Ga0157370_10272277 3300013104 Bacteria 1564
109 Ga0157370_10713512 3300013104 Bacteria 915
110 Ga0157369_10126275 3300013105 Bacteria 2712
111 Ga0157369_11188487 3300013105 Unclassified 779
112 Ga0157374_10035060 3300013296 Unclassified 4589
113 Ga0157378_10935791 3300013297 Bacteria 899
114 Ga0163162_10082820 3300013306 Unclassified 3281
115 Ga0163162_10126284 3300013306 Bacteria 2664
116 Ga0163162_11246230 3300013306 Bacteria 844
117 Ga0157372_10284904 3300013307 Bacteria 1921
118 Ga0157372_13322932 3300013307 Bacteria 512
119 Ga0157375_10046677 3300013308 Unclassified 4226
120 Ga0157380_10034685 3300014326 Bacteria 3893
121 Ga0157379_11532802 3300014968 Bacteria 649
122 Ga0157376_10510257 3300014969 Bacteria 1183
123 Ga0213874_10069904 3300021377 Bacteria 1117
124 Ga0207680_10245302 3300025903 Bacteria 1236
125 Ga0207680_11338386 3300025903 Bacteria 509
126 Ga0207645_10252148 3300025907 Unclassified 1168
127 Ga0207705_10029539 3300025909 Bacteria 3907
128 Ga0207705_10043741 3300025909 Bacteria 3217
129 Ga0207707_10056819 3300025912 Bacteria 3405
130 Ga0207707_11239581 3300025912 Unclassified 602
131 Ga0207707_11575417 3300025912 Bacteria 518
132 Ga0207695_10002370 3300025913 Bacteria 27990
133 Ga0207695_10104721 3300025913 Bacteria 2817
134 Ga0207695_10258012 3300025913 Bacteria 1641
135 Ga0207695_10451336 3300025913 Bacteria 1169
136 Ga0207663_10002957 3300025916 Bacteria 8212
137 Ga0207660_10073480 3300025917 Bacteria 2493
138 Ga0207660_10157942 3300025917 Bacteria 1747
139 Ga0207657_11026006 3300025919 Bacteria 632
140 Ga0207652_10329357 3300025921 Bacteria 1379
141 Ga0207694_10019481 3300025924 Bacteria 5129
142 Ga0207694_10035908 3300025924 Bacteria 3802
143 Ga0207694_10517732 3300025924 Bacteria 999
144 Ga0207650_10487093 3300025925 Bacteria 1029
145 Ga0207687_10175818 3300025927 Unclassified 1655
146 Ga0207687_11076428 3300025927 Unclassified 690
147 Ga0207664_10036162 3300025929 Bacteria 3816
148 Ga0207664_10168104 3300025929 Bacteria 1875
149 Ga0207664_11691588 3300025929 Bacteria 555
150 Ga0207690_10018271 3300025932 Bacteria 4299
151 Ga0207686_10076893 3300025934 Unclassified 2166
152 Ga0207686_10309571 3300025934 Bacteria 1176
153 Ga0207669_10555281 3300025937 Bacteria 927
154 Ga0207704_10874179 3300025938 Bacteria 755
155 Ga0207711_10039208 3300025941 Unclassified 4029
156 Ga0207689_10617161 3300025942 Unclassified 913
157 Ga0207689_11827528 3300025942 Unclassified 501
158 Ga0207667_10009210 3300025949 Bacteria 11659
159 Ga0207667_10020781 3300025949 Bacteria 7292
160 Ga0207667_10038497 3300025949 Bacteria 5108
161 Ga0207667_10058699 3300025949 Bacteria 4034
162 Ga0207667_10074414 3300025949 Bacteria 3529
163 Ga0207712_11137537 3300025961 Bacteria 696
164 Ga0207668_11119316 3300025972 Unclassified 706
165 Ga0207640_10702933 3300025981 Bacteria 867
166 Ga0207677_11721961 3300026023 Bacteria 581
167 Ga0207703_10040541 3300026035 Unclassified 3726
168 Ga0207702_10172259 3300026078 Bacteria 1986
169 Ga0207702_10260865 3300026078 Bacteria 1631
170 Ga0207702_10302783 3300026078 Bacteria 1517
171 Ga0207648_10081796 3300026089 Bacteria 2816
172 Ga0207648_10906876 3300026089 Bacteria 823
173 Ga0207676_10149660 3300026095 Unclassified 2009
174 Ga0207676_12580520 3300026095 Unclassified 504
175 Ga0207698_10117904 3300026142 Bacteria 2240
176 Ga0207698_10162684 3300026142 Bacteria 1954
177 Ga0207428_10009871 3300027907 Bacteria 8552
178 Ga0207428_10630593 3300027907 Bacteria 770
179 Ga0268266_10124004 3300028379 Bacteria 2303
180 Ga0268266_10516515 3300028379 Bacteria 1142
181 Ga0268265_10166909 3300028380 Bacteria 1877
182 Ga0268265_10480932 3300028380 Bacteria 1166
183 Ga0265334_10004492 3300028573 Bacteria 6187
184 Ga0307515_10055030 3300028794 Bacteria 5825
185 Ga0307515_10120040 3300028794 Bacteria 2985
186 Ga0265338_10010984 3300028800 Bacteria 10522
187 Ga0265338_10532345 3300028800 Unclassified 824
188 Ga0316182_1081790 3300030745 Bacteria 689
189 Ga0265331_10398264 3300031250 Bacteria 617
190 Ga0265327_10002712 3300031251 Bacteria 18137
191 Ga0265327_10038562 3300031251 Bacteria 2606
192 Ga0265316_10868360 3300031344 Bacteria 631
193 Ga0307408_100372302 3300031548 Bacteria 1218
194 Ga0307408_101198359 3300031548 Bacteria 708
195 Ga0307408_101277256 3300031548 Bacteria 687
196 Ga0265314_10027627 3300031711 Bacteria 4247
197 Ga0265314_10387113 3300031711 Bacteria 759
198 Ga0265342_10146844 3300031712 Bacteria 1312
199 Ga0307405_10755864 3300031731 Bacteria 810
200 Ga0307405_11016556 3300031731 Bacteria 708
201 Ga0307405_11258093 3300031731 Bacteria 642
202 Ga0307413_11686945 3300031824 Unclassified 565
203 Ga0307413_11953360 3300031824 Bacteria 528
204 Ga0307410_10070619 3300031852 Bacteria 2420
205 Ga0307410_10684708 3300031852 Bacteria 863
206 Ga0307407_10514734 3300031903 Bacteria 879
207 Ga0307412_10483875 3300031911 Bacteria 1027
208 Ga0307412_10838044 3300031911 Bacteria 801
209 Ga0307412_10919092 3300031911 Bacteria 768
210 Ga0307416_101036201 3300032002 Bacteria 924
211 Ga0307416_102767221 3300032002 Bacteria 586
212 Ga0307414_10114176 3300032004 Bacteria 2063
213 Ga0307414_10926122 3300032004 Bacteria 800
214 Ga0307411_10084237 3300032005 Bacteria 2198
215 Ga0307411_10202267 3300032005 Bacteria 1526
216 Ga0307415_100447296 3300032126 Bacteria 1116
217 Ga0373950_0156123 3300034818 Bacteria 525
218 Ga0373955_1001361 3300035172 Bacteria 515
219 Ga0373931_0737389 3300035691 Bacteria 653
220 Ga0373937_0403072 3300036401 Bacteria 1298
221 Ga0395899_0065149 3300037312 Bacteria 2678
222 Ga0395900_0131369 3300037418 Bacteria 2566
223 Ga0395900_1410447 3300037418 Unclassified 609
224 Ga0395898_0416863 3300037466 Bacteria 1280
225 Ga0395905_0000468 3300037471 Bacteria 56119
226 Ga0395905_0033600 3300037471 Bacteria 4817
227 Ga0395905_0054907 3300037471 Bacteria 3728
228 Ga0395905_0499618 3300037471 Bacteria 1116
229 Ga0439436_0014761 3300041404 Bacteria 2353
230 Ga0439439_0012488 3300041406 Bacteria 2055
231 Ga0439466_0081933 3300041411 Bacteria 1017
232 Ga0439466_0169009 3300041411 Bacteria 668
233 Ga0439465_0018247 3300041413 Bacteria 2193
234 Ga0439433_0023238 3300041999 Bacteria 1394
235 Ga0439432_002019 3300042006 Bacteria 7683
236 Ga0439432_015825 3300042006 Bacteria 2542
237 Ga0439449_0010832 3300042007 Bacteria 3441
238 Ga0439449_0088667 3300042007 Bacteria 1142
239 Ga0439449_0343683 3300042007 Unclassified 565
240 Ga0453683_0279027 3300044673 Bacteria 1067
241 Ga0466965_0751096 3300044683 Unclassified 562
242 Ga0466961_0667692 3300044693 Bacteria 623
243 Ga0466963_0517356 3300044694 Bacteria 843
244 Ga0466963_0965697 3300044694 Bacteria 600
245 Ga0466957_0025296 3300044842 Bacteria 3518
246 Ga0466967_0198558 3300045976 Bacteria 1899
247 Ga0466967_2390823 3300045976 Bacteria 524
248 Ga0495591_175928 3300046458 Bacteria 510
249 Ga0495629_0844895 3300046459 Bacteria 602
250 Ga0495580_0130271 3300046472 Bacteria 1745
251 Ga0495580_0152508 3300046472 Unclassified 1601
252 Ga0495580_0603656 3300046472 Bacteria 725
253 Ga0495639_0020221 3300046475 Bacteria 2909
254 Ga0495639_0428159 3300046475 Unclassified 671
255 Ga0495664_0562120 3300046477 Bacteria 679
256 Ga0495610_0002333 3300046512 Bacteria 16045
257 Ga0495637_0004167 3300046520 Bacteria 7526
258 Ga0495644_0057244 3300046523 Bacteria 1465
259 Ga0495652_0609443 3300046529 Bacteria 744
260 Ga0495654_0189257 3300046530 Unclassified 887
261 Ga0495586_0643286 3300046535 Unclassified 613
262 Ga0495598_0293983 3300046537 Unclassified 613
263 Ga0495621_0032096 3300046539 Unclassified 1804
264 Ga0495645_0730046 3300046543 Bacteria 599
265 Ga0495633_0025886 3300046558 Bacteria 2885
266 Ga0495634_0870047 3300046642 Bacteria 511
267 Ga0495647_0003159 3300046681 Bacteria 5272
268 Ga0495658_0011144 3300046683 Bacteria 4513
269 Ga0495613_0000872 3300046689 Bacteria 23141
270 Ga0495613_0336616 3300046689 Bacteria 1039
271 Ga0495600_0229294 3300046809 Bacteria 1186
272 Ga0495604_0414532 3300047317 Bacteria 885
273 Ga0495604_0997618 3300047317 Bacteria 518
274 Ga0495683_0251269 3300047323 Unclassified 776
275 Ga0495675_0210110 3300047444 Bacteria 1182
276 Ga0495681_0341231 3300047470 Bacteria 571
277 Ga0495686_0006445 3300047472 Bacteria 8986
278 Ga0495615_0076974 3300048090 Unclassified 909
279 Ga0496102_0000123 3300048905 Bacteria 110781
280 Ga0496103_0007681 3300048906 Bacteria 6411
281 Ga0496109_0551833 3300048912 Bacteria 1087
282 Ga0496115_0103200 3300048918 Bacteria 2339
283 Ga0501034_0001121 3300049571 Bacteria 37474
284 Ga0501036_0127149 3300049572 Bacteria 2152
285 Ga0501042_1144959 3300049578 Unclassified 567
286 Ga0501047_0005144 3300049581 Bacteria 12275
287 Ga0501047_0184353 3300049581 Bacteria 1953
288 Ga0501070_0167997 3300049586 Bacteria 1807
289 Ga0501073_0141606 3300049589 Bacteria 1666
290 Ga0501074_1150424 3300049590 Unclassified 544
291 Ga0501076_1669462 3300049592 Bacteria 523
292 Ga0501202_038106 3300049652 Bacteria 1029
293 Ga0501252_002775 3300049682 Bacteria 1766
294 Ga0501079_0312767 3300049741 Bacteria 1229
295 Ga0501080_0002922 3300049742 Bacteria 15012
296 Ga0501080_0034018 3300049742 Bacteria 4758
297 Ga0501083_0004955 3300049744 Bacteria 9433
298 Ga0501265_095251 3300049762 Bacteria 537
299 Ga0501266_064450 3300049763 Bacteria 593
300 Ga0501035_0786154 3300049822 Bacteria 761
301 Ga0501044_0271099 3300049823 Bacteria 1633
302 nmdc:mga07m45_864715_c1 3300050496 Bacteria 517
303 nmdc:mga05p37_1094197_c1 3300050507 Bacteria 835
304 nmdc:mga09592_1004846_c1 3300050508 Unclassified 697
305 nmdc:mga09592_683442_c1 3300050508 Bacteria 874
306 nmdc:mga0qj67_602351_c1 3300050509 Bacteria 879
307 nmdc:mga06r32_131658_c1 3300050510 Bacteria 2473
308 nmdc:mga08y16_9715_c1 3300050511 Bacteria 10100
309 nmdc:mga0n895_256855_c1 3300050512 Bacteria 1773
310 nmdc:mga0a205_822476_c1 3300050515 Bacteria 776
311 Ga0495612_0599954 3300053078 Unclassified 509
312 Ga0500583_0028808 3300053092 Bacteria 2414
313 Ga0500572_066486 3300053111 Unclassified 1106
314 Ga0500595_009880 3300053119 Bacteria 3825
315 Ga0500568_0115633 3300053139 Bacteria 1001
316 Ga0500636_0350511 3300053177 Bacteria 705
317 Ga0501084_1206576 3300054114 Unclassified 635
318 Ga0501082_0024600 3300060353 Bacteria 5190
319 Ga0501082_0218610 3300060353 Bacteria 1658
320 Ga0466962_0617900 3300061719 Bacteria 553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0870047 Ga0495634_0870047_12_308 98
2 3300046529 Ga0495652_0609443 Ga0495652_0609443_73_396 104
3 3300046689 Ga0495613_0000872 Ga0495613_0000872_5910_6233 104
4 3300049581 Ga0501047_0184353 Ga0501047_0184353_159_473 104
5 iso_pu_bacteria 2582581279 2585147185 105
6 3300005339 Ga0070660_101083369 Ga0070660_1010833691 108
7 3300005548 Ga0070665_100322585 Ga0070665_1003225852 108
8 3300009176 Ga0105242_10607742 Ga0105242_106077422 108
9 3300013104 Ga0157370_10713512 Ga0157370_107135122 108
10 3300013306 Ga0163162_11246230 Ga0163162_112462302 108
11 3300025919 Ga0207657_11026006 Ga0207657_110260061 108
12 3300025934 Ga0207686_10309571 Ga0207686_103095712 108
13 3300026078 Ga0207702_10260865 Ga0207702_102608653 108
14 3300028379 Ga0268266_10124004 Ga0268266_101240041 108
15 3300031251 Ga0265327_10002712 Ga0265327_1000271215 108
16 3300031344 Ga0265316_10868360 Ga0265316_108683601 108
17 3300037312 Ga0395899_0065149 Ga0395899_0065149_1130_1459 108
18 3300037418 Ga0395900_0131369 Ga0395900_0131369_2062_2391 108
19 3300037466 Ga0395898_0416863 Ga0395898_0416863_489_818 108
20 3300037471 Ga0395905_0054907 Ga0395905_0054907_750_1079 108
21 3300048918 Ga0496115_0103200 Ga0496115_0103200_1819_2148 108
22 3300053111 Ga0500572_066486 Ga0500572_066486_383_712 108
23 3300053119 Ga0500595_009880 Ga0500595_009880_1833_2162 108
24 3300053177 Ga0500636_0350511 Ga0500636_0350511_142_471 108
25 3300005535 Ga0070684_101899363 Ga0070684_1018993631 109
26 3300005548 Ga0070665_100138070 Ga0070665_1001380702 109
27 3300013307 Ga0157372_13322932 Ga0157372_133229321 109
28 3300021377 Ga0213874_10069904 Ga0213874_100699042 109
29 3300025903 Ga0207680_11338386 Ga0207680_113383861 109
30 3300028794 Ga0307515_10055030 Ga0307515_100550302 109
31 3300035691 Ga0373931_0737389 Ga0373931_0737389_280_624 109
32 3300046512 Ga0495610_0002333 Ga0495610_0002333_4830_5159 109
33 3300046520 Ga0495637_0004167 Ga0495637_0004167_5587_5916 109
34 3300047472 Ga0495686_0006445 Ga0495686_0006445_2036_2365 109
35 3300028573 Ga0265334_10004492 Ga0265334_100044929 110
36 3300028800 Ga0265338_10010984 Ga0265338_100109844 110
37 3300028800 Ga0265338_10532345 Ga0265338_105323452 110
38 3300031251 Ga0265327_10038562 Ga0265327_100385624 110
39 3300031711 Ga0265314_10387113 Ga0265314_103871131 110
40 3300005336 Ga0070680_100157611 Ga0070680_1001576112 111
41 3300005336 Ga0070680_100313426 Ga0070680_1003134262 111
42 3300005458 Ga0070681_10024246 Ga0070681_100242463 111
43 3300005458 Ga0070681_11307064 Ga0070681_113070642 111
44 3300005563 Ga0068855_100050641 Ga0068855_1000506412 111
45 3300005563 Ga0068855_100087734 Ga0068855_1000877344 111
46 3300005563 Ga0068855_100261838 Ga0068855_1002618382 111
47 3300005616 Ga0068852_100055393 Ga0068852_1000553932 111
48 3300009093 Ga0105240_10037899 Ga0105240_100378995 111
49 3300009093 Ga0105240_10081410 Ga0105240_100814103 111
50 3300013100 Ga0157373_10513763 Ga0157373_105137632 111
51 3300013104 Ga0157370_10074467 Ga0157370_100744672 111
52 3300013104 Ga0157370_10272277 Ga0157370_102722772 111
53 3300013105 Ga0157369_10126275 Ga0157369_101262752 111
54 3300013307 Ga0157372_10284904 Ga0157372_102849043 111
55 3300025912 Ga0207707_10056819 Ga0207707_100568192 111
56 3300025912 Ga0207707_11575417 Ga0207707_115754171 111
57 3300025913 Ga0207695_10002370 Ga0207695_100023703 111
58 3300025913 Ga0207695_10258012 Ga0207695_102580123 111
59 3300025913 Ga0207695_10451336 Ga0207695_104513362 111
60 3300025917 Ga0207660_10073480 Ga0207660_100734802 111
61 3300025917 Ga0207660_10157942 Ga0207660_101579421 111
62 3300025921 Ga0207652_10329357 Ga0207652_103293572 111
63 3300025924 Ga0207694_10517732 Ga0207694_105177321 111
64 3300025949 Ga0207667_10020781 Ga0207667_100207813 111
65 3300025949 Ga0207667_10038497 Ga0207667_100384975 111
66 3300025949 Ga0207667_10074414 Ga0207667_100744142 111
67 3300026142 Ga0207698_10162684 Ga0207698_101626842 111
68 3300031250 Ga0265331_10398264 Ga0265331_103982641 111
69 3300031711 Ga0265314_10027627 Ga0265314_100276271 111
70 3300031712 Ga0265342_10146844 Ga0265342_101468442 111
71 3300044694 Ga0466963_0965697 Ga0466963_0965697_76_411 111
72 3300044693 Ga0466961_0667692 Ga0466961_0667692_40_384 112
73 3300044694 Ga0466963_0517356 Ga0466963_0517356_430_774 112
74 3300044842 Ga0466957_0025296 Ga0466957_0025296_2124_2468 112
75 3300061719 Ga0466962_0617900 Ga0466962_0617900_175_519 112
76 3300005843 Ga0068860_101506721 Ga0068860_1015067211 113
77 3300011119 Ga0105246_12027538 Ga0105246_120275382 113
78 3300030745 Ga0316182_1081790 Ga0316182_10817901 115
79 3300031548 Ga0307408_100372302 Ga0307408_1003723021 115
80 3300031548 Ga0307408_101277256 Ga0307408_1012772562 115
81 3300031731 Ga0307405_10755864 Ga0307405_107558641 115
82 3300031824 Ga0307413_11686945 Ga0307413_116869451 115
83 3300031852 Ga0307410_10070619 Ga0307410_100706192 115
84 3300031903 Ga0307407_10514734 Ga0307407_105147341 115
85 3300031911 Ga0307412_10483875 Ga0307412_104838752 115
86 3300031911 Ga0307412_10919092 Ga0307412_109190922 115
87 3300032002 Ga0307416_102767221 Ga0307416_1027672212 115
88 3300032004 Ga0307414_10114176 Ga0307414_101141763 115
89 3300032005 Ga0307411_10084237 Ga0307411_100842373 115
90 3300032126 Ga0307415_100447296 Ga0307415_1004472961 115
91 3300042006 Ga0439432_015825 Ga0439432_015825_678_1025 115
92 3300042007 Ga0439449_0343683 Ga0439449_0343683_91_438 115
93 3300049652 Ga0501202_038106 Ga0501202_038106_434_781 115
94 3300049682 Ga0501252_002775 Ga0501252_002775_1126_1473 115
95 3300049763 Ga0501266_064450 Ga0501266_064450_195_542 115
96 3300003316 rootH1_10044414 rootH1_100444142 116
97 3300005290 Ga0065712_10183681 Ga0065712_101836812 116
98 3300005327 Ga0070658_10019880 Ga0070658_100198806 116
99 3300005327 Ga0070658_10198342 Ga0070658_101983423 116
100 3300005328 Ga0070676_10268775 Ga0070676_102687752 116
101 3300005330 Ga0070690_101049779 Ga0070690_1010497791 116
102 3300005331 Ga0070670_100343325 Ga0070670_1003433253 116
103 3300005334 Ga0068869_100624483 Ga0068869_1006244832 116
104 3300005334 Ga0068869_100843275 Ga0068869_1008432751 116
105 3300005338 Ga0068868_101643715 Ga0068868_1016437151 116
106 3300005338 Ga0068868_101686414 Ga0068868_1016864141 116
107 3300005338 Ga0068868_102262141 Ga0068868_1022621411 116
108 3300005344 Ga0070661_101104377 Ga0070661_1011043771 116
109 3300005345 Ga0070692_11240612 Ga0070692_112406121 116
110 3300005347 Ga0070668_100021283 Ga0070668_1000212835 116
111 3300005355 Ga0070671_100672345 Ga0070671_1006723451 116
112 3300005366 Ga0070659_100063745 Ga0070659_1000637453 116
113 3300005367 Ga0070667_101381946 Ga0070667_1013819462 116
114 3300005435 Ga0070714_100010031 Ga0070714_1000100313 116
115 3300005435 Ga0070714_100831987 Ga0070714_1008319871 116
116 3300005439 Ga0070711_100045960 Ga0070711_1000459603 116
117 3300005458 Ga0070681_10933901 Ga0070681_109339011 116
118 3300005459 Ga0068867_100315632 Ga0068867_1003156322 116
119 3300005459 Ga0068867_101721064 Ga0068867_1017210641 116
120 3300005471 Ga0070698_100648582 Ga0070698_1006485821 116
121 3300005471 Ga0070698_101581051 Ga0070698_1015810511 116
122 3300005530 Ga0070679_100022894 Ga0070679_1000228948 116
123 3300005530 Ga0070679_100336719 Ga0070679_1003367192 116
124 3300005535 Ga0070684_100630893 Ga0070684_1006308931 116
125 3300005539 Ga0068853_100072156 Ga0068853_1000721565 116
126 3300005545 Ga0070695_100821596 Ga0070695_1008215962 116
127 3300005546 Ga0070696_100929091 Ga0070696_1009290912 116
128 3300005546 Ga0070696_101309763 Ga0070696_1013097632 116
129 3300005563 Ga0068855_100061351 Ga0068855_1000613513 116
130 3300005564 Ga0070664_100235617 Ga0070664_1002356173 116
131 3300005577 Ga0068857_101368506 Ga0068857_1013685062 116
132 3300005578 Ga0068854_100609593 Ga0068854_1006095931 116
133 3300005614 Ga0068856_100023417 Ga0068856_1000234174 116
134 3300005614 Ga0068856_100204360 Ga0068856_1002043603 116
135 3300005616 Ga0068852_100006478 Ga0068852_1000064787 116
136 3300005617 Ga0068859_100256805 Ga0068859_1002568051 116
137 3300005618 Ga0068864_100290582 Ga0068864_1002905823 116
138 3300005618 Ga0068864_101980711 Ga0068864_1019807112 116
139 3300005840 Ga0068870_10888225 Ga0068870_108882251 116
140 3300005841 Ga0068863_100138998 Ga0068863_1001389984 116
141 3300005841 Ga0068863_100947749 Ga0068863_1009477492 116
142 3300005842 Ga0068858_100055866 Ga0068858_1000558662 116
143 3300005842 Ga0068858_101870002 Ga0068858_1018700021 116
144 3300005843 Ga0068860_101053923 Ga0068860_1010539232 116
145 3300005843 Ga0068860_101919072 Ga0068860_1019190721 116
146 3300005844 Ga0068862_100306716 Ga0068862_1003067162 116
147 3300005844 Ga0068862_100473122 Ga0068862_1004731222 116
148 3300006048 Ga0075363_100811884 Ga0075363_1008118842 116
149 3300006237 Ga0097621_100384096 Ga0097621_1003840961 116
150 3300006237 Ga0097621_100427047 Ga0097621_1004270472 116
151 3300006353 Ga0075370_10785444 Ga0075370_107854441 116
152 3300006358 Ga0068871_100374848 Ga0068871_1003748482 116
153 3300006844 Ga0075428_100057554 Ga0075428_1000575544 116
154 3300006844 Ga0075428_100159962 Ga0075428_1001599622 116
155 3300006844 Ga0075428_100255148 Ga0075428_1002551482 116
156 3300006844 Ga0075428_101981569 Ga0075428_1019815692 116
157 3300006846 Ga0075430_100452142 Ga0075430_1004521423 116
158 3300006846 Ga0075430_101346412 Ga0075430_1013464122 116
159 3300006847 Ga0075431_100273666 Ga0075431_1002736662 116
160 3300006852 Ga0075433_11100962 Ga0075433_111009622 116
161 3300006880 Ga0075429_101146180 Ga0075429_1011461802 116
162 3300006880 Ga0075429_101842077 Ga0075429_1018420772 116
163 3300006881 Ga0068865_101261287 Ga0068865_1012612872 116
164 3300006931 Ga0097620_100256806 Ga0097620_1002568061 116
165 3300007076 Ga0075435_100491570 Ga0075435_1004915702 116
166 3300009093 Ga0105240_10192016 Ga0105240_101920161 116
167 3300009094 Ga0111539_10004167 Ga0111539_100041674 116
168 3300009094 Ga0111539_11227650 Ga0111539_112276502 116
169 3300009094 Ga0111539_13239428 Ga0111539_132394282 116
170 3300009098 Ga0105245_10021426 Ga0105245_100214266 116
171 3300009098 Ga0105245_10164440 Ga0105245_101644402 116
172 3300009148 Ga0105243_10181684 Ga0105243_101816843 116
173 3300009176 Ga0105242_10055552 Ga0105242_100555522 116
174 3300009176 Ga0105242_12945083 Ga0105242_129450831 116
175 3300009177 Ga0105248_10318333 Ga0105248_103183332 116
176 3300009177 Ga0105248_10559036 Ga0105248_105590362 116
177 3300009545 Ga0105237_12017891 Ga0105237_120178911 116
178 3300009551 Ga0105238_10007264 Ga0105238_100072646 116
179 3300009553 Ga0105249_10860380 Ga0105249_108603802 116
180 3300010159 Ga0099796_10225635 Ga0099796_102256352 116
181 3300010375 Ga0105239_11168532 Ga0105239_111685322 116
182 3300011119 Ga0105246_11088558 Ga0105246_110885582 116
183 3300013102 Ga0157371_10621538 Ga0157371_106215381 116
184 3300013105 Ga0157369_11188487 Ga0157369_111884871 116
185 3300013296 Ga0157374_10035060 Ga0157374_100350605 116
186 3300013297 Ga0157378_10935791 Ga0157378_109357912 116
187 3300013306 Ga0163162_10082820 Ga0163162_100828203 116
188 3300013306 Ga0163162_10126284 Ga0163162_101262843 116
189 3300013308 Ga0157375_10046677 Ga0157375_100466774 116
190 3300014326 Ga0157380_10034685 Ga0157380_100346853 116
191 3300014968 Ga0157379_11532802 Ga0157379_115328022 116
192 3300014969 Ga0157376_10510257 Ga0157376_105102572 116
193 3300025903 Ga0207680_10245302 Ga0207680_102453022 116
194 3300025907 Ga0207645_10252148 Ga0207645_102521482 116
195 3300025909 Ga0207705_10029539 Ga0207705_100295393 116
196 3300025909 Ga0207705_10043741 Ga0207705_100437414 116
197 3300025912 Ga0207707_11239581 Ga0207707_112395812 116
198 3300025913 Ga0207695_10104721 Ga0207695_101047213 116
199 3300025916 Ga0207663_10002957 Ga0207663_1000295710 116
200 3300025924 Ga0207694_10019481 Ga0207694_100194814 116
201 3300025924 Ga0207694_10035908 Ga0207694_100359083 116
202 3300025925 Ga0207650_10487093 Ga0207650_104870931 116
203 3300025927 Ga0207687_10175818 Ga0207687_101758182 116
204 3300025927 Ga0207687_11076428 Ga0207687_110764282 116
205 3300025929 Ga0207664_10036162 Ga0207664_100361623 116
206 3300025929 Ga0207664_10168104 Ga0207664_101681042 116
207 3300025929 Ga0207664_11691588 Ga0207664_116915881 116
208 3300025932 Ga0207690_10018271 Ga0207690_100182716 116
209 3300025934 Ga0207686_10076893 Ga0207686_100768932 116
210 3300025937 Ga0207669_10555281 Ga0207669_105552811 116
211 3300025938 Ga0207704_10874179 Ga0207704_108741792 116
212 3300025941 Ga0207711_10039208 Ga0207711_100392084 116
213 3300025942 Ga0207689_10617161 Ga0207689_106171612 116
214 3300025942 Ga0207689_11827528 Ga0207689_118275282 116
215 3300025949 Ga0207667_10009210 Ga0207667_100092108 116
216 3300025949 Ga0207667_10058699 Ga0207667_100586994 116
217 3300025961 Ga0207712_11137537 Ga0207712_111375371 116
218 3300025972 Ga0207668_11119316 Ga0207668_111193161 116
219 3300025981 Ga0207640_10702933 Ga0207640_107029332 116
220 3300026023 Ga0207677_11721961 Ga0207677_117219611 116
221 3300026035 Ga0207703_10040541 Ga0207703_100405414 116
222 3300026078 Ga0207702_10172259 Ga0207702_101722592 116
223 3300026078 Ga0207702_10302783 Ga0207702_103027831 116
224 3300026089 Ga0207648_10081796 Ga0207648_100817962 116
225 3300026089 Ga0207648_10906876 Ga0207648_109068762 116
226 3300026095 Ga0207676_10149660 Ga0207676_101496602 116
227 3300026095 Ga0207676_12580520 Ga0207676_125805201 116
228 3300026142 Ga0207698_10117904 Ga0207698_101179043 116
229 3300027907 Ga0207428_10009871 Ga0207428_100098711 116
230 3300027907 Ga0207428_10630593 Ga0207428_106305932 116
231 3300028379 Ga0268266_10516515 Ga0268266_105165152 116
232 3300028380 Ga0268265_10166909 Ga0268265_101669092 116
233 3300028380 Ga0268265_10480932 Ga0268265_104809322 116
234 3300028794 Ga0307515_10120040 Ga0307515_101200402 116
235 3300031548 Ga0307408_101198359 Ga0307408_1011983591 116
236 3300031731 Ga0307405_11016556 Ga0307405_110165561 116
237 3300031731 Ga0307405_11258093 Ga0307405_112580932 116
238 3300031824 Ga0307413_11953360 Ga0307413_119533601 116
239 3300031852 Ga0307410_10684708 Ga0307410_106847082 116
240 3300031911 Ga0307412_10838044 Ga0307412_108380442 116
241 3300032002 Ga0307416_101036201 Ga0307416_1010362012 116
242 3300032004 Ga0307414_10926122 Ga0307414_109261222 116
243 3300032005 Ga0307411_10202267 Ga0307411_102022672 116
244 3300034818 Ga0373950_0156123 Ga0373950_0156123_23_376 116
245 3300035172 Ga0373955_1001361 Ga0373955_1001361_147_500 116
246 3300036401 Ga0373937_0403072 Ga0373937_0403072_376_729 116
247 3300037418 Ga0395900_1410447 Ga0395900_1410447_110_460 116
248 3300037471 Ga0395905_0000468 Ga0395905_0000468_34313_34663 116
249 3300037471 Ga0395905_0033600 Ga0395905_0033600_856_1206 116
250 3300037471 Ga0395905_0499618 Ga0395905_0499618_224_574 116
251 3300041404 Ga0439436_0014761 Ga0439436_0014761_35_385 116
252 3300041406 Ga0439439_0012488 Ga0439439_0012488_159_509 116
253 3300041411 Ga0439466_0081933 Ga0439466_0081933_180_611 116
254 3300041411 Ga0439466_0169009 Ga0439466_0169009_245_595 116
255 3300041413 Ga0439465_0018247 Ga0439465_0018247_1674_2024 116
256 3300041999 Ga0439433_0023238 Ga0439433_0023238_908_1339 116
257 3300042006 Ga0439432_002019 Ga0439432_002019_6545_6895 116
258 3300042007 Ga0439449_0010832 Ga0439449_0010832_753_1103 116
259 3300042007 Ga0439449_0088667 Ga0439449_0088667_670_1101 116
260 3300044673 Ga0453683_0279027 Ga0453683_0279027_352_705 116
261 3300044683 Ga0466965_0751096 Ga0466965_0751096_117_524 116
262 3300045976 Ga0466967_0198558 Ga0466967_0198558_12_362 116
263 3300045976 Ga0466967_2390823 Ga0466967_2390823_45_404 116
264 3300046458 Ga0495591_175928 Ga0495591_175928_149_499 116
265 3300046459 Ga0495629_0844895 Ga0495629_0844895_151_519 116
266 3300046472 Ga0495580_0130271 Ga0495580_0130271_619_972 116
267 3300046472 Ga0495580_0152508 Ga0495580_0152508_1022_1372 116
268 3300046472 Ga0495580_0603656 Ga0495580_0603656_84_434 116
269 3300046475 Ga0495639_0020221 Ga0495639_0020221_59_409 116
270 3300046475 Ga0495639_0428159 Ga0495639_0428159_207_557 116
271 3300046477 Ga0495664_0562120 Ga0495664_0562120_278_628 116
272 3300046523 Ga0495644_0057244 Ga0495644_0057244_548_898 116
273 3300046530 Ga0495654_0189257 Ga0495654_0189257_143_493 116
274 3300046535 Ga0495586_0643286 Ga0495586_0643286_133_483 116
275 3300046537 Ga0495598_0293983 Ga0495598_0293983_218_568 116
276 3300046539 Ga0495621_0032096 Ga0495621_0032096_1166_1516 116
277 3300046543 Ga0495645_0730046 Ga0495645_0730046_115_468 116
278 3300046558 Ga0495633_0025886 Ga0495633_0025886_1652_2002 116
279 3300046681 Ga0495647_0003159 Ga0495647_0003159_3104_3454 116
280 3300046683 Ga0495658_0011144 Ga0495658_0011144_3418_3768 116
281 3300046689 Ga0495613_0336616 Ga0495613_0336616_233_583 116
282 3300046809 Ga0495600_0229294 Ga0495600_0229294_355_705 116
283 3300047317 Ga0495604_0414532 Ga0495604_0414532_35_385 116
284 3300047317 Ga0495604_0997618 Ga0495604_0997618_91_450 116
285 3300047323 Ga0495683_0251269 Ga0495683_0251269_235_585 116
286 3300047444 Ga0495675_0210110 Ga0495675_0210110_459_809 116
287 3300047470 Ga0495681_0341231 Ga0495681_0341231_205_555 116
288 3300048090 Ga0495615_0076974 Ga0495615_0076974_284_634 116
289 3300048905 Ga0496102_0000123 Ga0496102_0000123_8717_9067 116
290 3300048906 Ga0496103_0007681 Ga0496103_0007681_5840_6190 116
291 3300048912 Ga0496109_0551833 Ga0496109_0551833_553_906 116
292 3300049571 Ga0501034_0001121 Ga0501034_0001121_7958_8308 116
293 3300049572 Ga0501036_0127149 Ga0501036_0127149_679_1029 116
294 3300049578 Ga0501042_1144959 Ga0501042_1144959_11_382 116
295 3300049581 Ga0501047_0005144 Ga0501047_0005144_8903_9253 116
296 3300049586 Ga0501070_0167997 Ga0501070_0167997_463_813 116
297 3300049589 Ga0501073_0141606 Ga0501073_0141606_953_1303 116
298 3300049590 Ga0501074_1150424 Ga0501074_1150424_130_480 116
299 3300049592 Ga0501076_1669462 Ga0501076_1669462_46_396 116
300 3300049741 Ga0501079_0312767 Ga0501079_0312767_539_889 116
301 3300049742 Ga0501080_0002922 Ga0501080_0002922_878_1234 116
302 3300049742 Ga0501080_0034018 Ga0501080_0034018_3559_3909 116
303 3300049744 Ga0501083_0004955 Ga0501083_0004955_9052_9408 116
304 3300049762 Ga0501265_095251 Ga0501265_095251_70_420 116
305 3300049822 Ga0501035_0786154 Ga0501035_0786154_379_729 116
306 3300049823 Ga0501044_0271099 Ga0501044_0271099_386_736 116
307 3300050496 nmdc:mga07m45_864715_c1 nmdc:mga07m45_864715_c1_154_507 116
308 3300050507 nmdc:mga05p37_1094197_c1 nmdc:mga05p37_1094197_c1_377_733 116
309 3300050508 nmdc:mga09592_1004846_c1 nmdc:mga09592_1004846_c1_13_372 116
310 3300050508 nmdc:mga09592_683442_c1 nmdc:mga09592_683442_c1_444_821 116
311 3300050509 nmdc:mga0qj67_602351_c1 nmdc:mga0qj67_602351_c1_115_471 116
312 3300050510 nmdc:mga06r32_131658_c1 nmdc:mga06r32_131658_c1_746_1102 116
313 3300050511 nmdc:mga08y16_9715_c1 nmdc:mga08y16_9715_c1_1630_1989 116
314 3300050512 nmdc:mga0n895_256855_c1 nmdc:mga0n895_256855_c1_94_453 116
315 3300050515 nmdc:mga0a205_822476_c1 nmdc:mga0a205_822476_c1_180_539 116
316 3300053078 Ga0495612_0599954 Ga0495612_0599954_33_383 116
317 3300053092 Ga0500583_0028808 Ga0500583_0028808_604_963 116
318 3300053139 Ga0500568_0115633 Ga0500568_0115633_39_398 116
319 3300054114 Ga0501084_1206576 Ga0501084_1206576_247_597 116
320 3300060353 Ga0501082_0024600 Ga0501082_0024600_1004_1360 116
321 3300060353 Ga0501082_0218610 Ga0501082_0218610_704_1054 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gic-assembly1.cif.gz_B crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus 0.7056 14 65
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6695 3 108
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.6461 1 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6403 2 110
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6302 1 113
ID Description Score Start End Superfamily
af_K7KP68_1_116_3.90.1460.10 Alpha Beta;Alpha-Beta Complex;GTF2I-like repeat;GTF2I-like 0.8785 11 47 3.90.1460.10
4gicB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.7056 14 65 3.40.50.1980
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6545 4 112 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6403 2 110 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6365 4 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7Z0DWC1-F1-model_v4 Transcription antitermination factor NusG 0.9943 38 112
AF-A0A150WUB1-F1-model_v4 YCII-related domain-containing protein 0.991 1 113
AF-A0A162FZS6-F1-model_v4 YCII-related domain-containing protein 0.9904 1 113
AF-A0A0B8WWS3-F1-model_v4 YCII-related domain-containing protein 0.9895 1 113
AF-A0A7W6NBB8-F1-model_v4 YCII-related domain-containing protein 0.9824 1 115

Feature Viewer

pLDDT pTM Quality
96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map