F405917

General Info

Members Datasets Scaffolds Average Seq Length
321 191 642 119

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100012175|Ga0075428_10001217516
Length 135
Sequence MLSFRVPTEAPIQLAKQMVTLTDIAAEKVHEFMAGQNAEGEVGLRVGVKGGGCSGFQYALALDERRDDDHVFDASGIAVLVDPASMQYVDGSTVDFTESFMGSGFEVSNPNVVASCGCGSSFRVAEEEPSCGASV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
129 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 3.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 2.49
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100012175 3300006844 Bacteria 9567
2 LJNas_1033666 3300000546 Bacteria 552
3 LJQas_1004932 3300000549 Bacteria 1713
4 JGI24740J21852_10097785 3300001979 Bacteria 750
5 JGI25406J46586_10059337 3300003203 Bacteria 1243
6 JGI25407J50210_10000468 3300003373 Bacteria 7958
7 JGI25407J50210_10011106 3300003373 Bacteria 2299
8 JGI25407J50210_10021563 3300003373 Bacteria 1675
9 Ga0070658_10130890 3300005327 Bacteria 2091
10 Ga0070676_10663836 3300005328 Bacteria 758
11 Ga0070683_100000642 3300005329 Bacteria 25168
12 Ga0070683_100119972 3300005329 Bacteria 2484
13 Ga0070683_100167778 3300005329 Bacteria 2083
14 Ga0070680_100000668 3300005336 Bacteria 23795
15 Ga0070680_100194266 3300005336 Bacteria 1711
16 Ga0070680_100760951 3300005336 Bacteria 834
17 Ga0070682_100072797 3300005337 Bacteria 2203
18 Ga0070660_100292589 3300005339 Bacteria 1334
19 Ga0070660_101827069 3300005339 Bacteria 518
20 Ga0070661_100015940 3300005344 Bacteria 5304
21 Ga0070692_10309852 3300005345 Bacteria 967
22 Ga0070669_100028852 3300005353 Bacteria 3997
23 Ga0070671_101131566 3300005355 Bacteria 688
24 Ga0070659_100001305 3300005366 Bacteria 18074
25 Ga0070659_100866555 3300005366 Bacteria 788
26 Ga0070714_100011204 3300005435 Bacteria 7109
27 Ga0070714_100147721 3300005435 Bacteria 2115
28 Ga0070714_100682123 3300005435 Bacteria 991
29 Ga0070713_102464113 3300005436 Bacteria 503
30 Ga0070711_101020786 3300005439 Bacteria 710
31 Ga0070662_100797372 3300005457 Unclassified 803
32 Ga0070681_10028718 3300005458 Bacteria 5591
33 Ga0070698_100834804 3300005471 Bacteria 866
34 Ga0070699_100511800 3300005518 Bacteria 1091
35 Ga0070679_100001945 3300005530 Bacteria 18568
36 Ga0070679_100090929 3300005530 Bacteria 3040
37 Ga0070684_100008469 3300005535 Bacteria 8043
38 Ga0070684_100031304 3300005535 Bacteria 4528
39 Ga0070684_100962225 3300005535 Bacteria 801
40 Ga0070695_101757790 3300005545 Bacteria 520
41 Ga0068855_100437338 3300005563 Bacteria 1429
42 Ga0070664_100074851 3300005564 Bacteria 2907
43 Ga0070664_101165129 3300005564 Bacteria 727
44 Ga0068856_100036468 3300005614 Bacteria 4821
45 Ga0068856_100940839 3300005614 Bacteria 883
46 Ga0068852_100463289 3300005616 Bacteria 1257
47 Ga0068852_100606896 3300005616 Bacteria 1099
48 Ga0081455_10030258 3300005937 Bacteria 4921
49 Ga0081455_10054982 3300005937 Bacteria 3389
50 Ga0081455_10335971 3300005937 Bacteria 1071
51 Ga0081538_10000069 3300005981 Bacteria 97256
52 Ga0081538_10000086 3300005981 Bacteria 89701
53 Ga0081538_10000287 3300005981 Bacteria 57864
54 Ga0081538_10001744 3300005981 Bacteria 22108
55 Ga0081538_10003753 3300005981 Bacteria 14218
56 Ga0081538_10009676 3300005981 Bacteria 8003
57 Ga0081538_10051196 3300005981 Bacteria 2483
58 Ga0081538_10128042 3300005981 Bacteria 1201
59 Ga0081540_1000550 3300005983 Bacteria 36321
60 Ga0081540_1028701 3300005983 Bacteria 3117
61 Ga0081539_10001376 3300005985 Bacteria 42070
62 Ga0081539_10091592 3300005985 Bacteria 1570
63 Ga0070717_10000017 3300006028 Bacteria 205340
64 Ga0070717_10600062 3300006028 Bacteria 999
65 Ga0070717_11204830 3300006028 Unclassified 689
66 Ga0075365_10628875 3300006038 Bacteria 759
67 Ga0075365_10876956 3300006038 Bacteria 633
68 Ga0070716_101367991 3300006173 Unclassified 574
69 Ga0075370_10772722 3300006353 Bacteria 585
70 Ga0075428_100010970 3300006844 Bacteria 10076
71 Ga0075428_100054873 3300006844 Bacteria 4367
72 Ga0075430_100001287 3300006846 Bacteria 20236
73 Ga0075430_100144769 3300006846 Bacteria 1979
74 Ga0075431_102177974 3300006847 Bacteria 509
75 Ga0075433_11777444 3300006852 Bacteria 530
76 Ga0075429_100124418 3300006880 Bacteria 2255
77 Ga0075429_100779055 3300006880 Bacteria 838
78 Ga0099795_10344199 3300007788 Bacteria 665
79 Ga0105250_10260290 3300009092 Bacteria 743
80 Ga0105240_10010586 3300009093 Bacteria 12957
81 Ga0105240_12224622 3300009093 Bacteria 568
82 Ga0111539_10607954 3300009094 Bacteria 1273
83 Ga0111539_10921158 3300009094 Bacteria 1016
84 Ga0105245_10874747 3300009098 Bacteria 939
85 Ga0105247_10851738 3300009101 Bacteria 700
86 Ga0114129_10197212 3300009147 Bacteria 2729
87 Ga0114129_12476852 3300009147 Bacteria 621
88 Ga0105243_10728609 3300009148 Bacteria 970
89 Ga0105237_10055291 3300009545 Bacteria 3976
90 Ga0105238_10010528 3300009551 Bacteria 9284
91 Ga0105238_11104359 3300009551 Bacteria 816
92 Ga0105249_12315913 3300009553 Bacteria 610
93 Ga0105239_10877527 3300010375 Unclassified 1029
94 Ga0105239_11139671 3300010375 Bacteria 898
95 Ga0105239_11140444 3300010375 Bacteria 898
96 Ga0105246_10317524 3300011119 Bacteria 1264
97 Ga0157338_1037299 3300012515 Bacteria 647
98 Ga0157371_10384333 3300013102 Bacteria 1025
99 Ga0157370_10040818 3300013104 Bacteria 4480
100 Ga0157369_10133166 3300013105 Bacteria 2633
101 Ga0157372_10167911 3300013307 Bacteria 2538
102 Ga0157372_11727577 3300013307 Bacteria 720
103 Ga0157380_11831283 3300014326 Bacteria 666
104 Ga0197907_10087821 3300020069 Bacteria 1538
105 Ga0206356_11249652 3300020070 Unclassified 670
106 Ga0206355_1456721 3300020076 Bacteria 545
107 Ga0206354_11711958 3300020081 Bacteria 1986
108 Ga0206353_10212128 3300020082 Bacteria 4817
109 Ga0206353_11615756 3300020082 Bacteria 1035
110 Ga0206353_12045082 3300020082 Bacteria 1420
111 Ga0154015_1073393 3300020610 Bacteria 1201
112 Ga0224712_10142240 3300022467 Bacteria 1057
113 Ga0224712_10248137 3300022467 Bacteria 822
114 Ga0224712_10386808 3300022467 Bacteria 665
115 Ga0224712_10462259 3300022467 Bacteria 610
116 Ga0207710_10771545 3300025900 Unclassified 505
117 Ga0207645_10833120 3300025907 Bacteria 627
118 Ga0207705_10276813 3300025909 Bacteria 1284
119 Ga0207707_10004411 3300025912 Bacteria 12423
120 Ga0207695_10141894 3300025913 Bacteria 2350
121 Ga0207671_10633478 3300025914 Bacteria 852
122 Ga0207693_10905758 3300025915 Bacteria 676
123 Ga0207660_10004155 3300025917 Bacteria 9422
124 Ga0207660_10671797 3300025917 Bacteria 845
125 Ga0207657_10019209 3300025919 Bacteria 6497
126 Ga0207649_10014401 3300025920 Bacteria 4427
127 Ga0207652_10019389 3300025921 Bacteria 5593
128 Ga0207652_10084773 3300025921 Bacteria 2776
129 Ga0207681_10005147 3300025923 Bacteria 8034
130 Ga0207681_10710688 3300025923 Bacteria 836
131 Ga0207694_10111818 3300025924 Bacteria 2173
132 Ga0207664_10100106 3300025929 Bacteria 2393
133 Ga0207664_11098334 3300025929 Bacteria 711
134 Ga0207644_11209112 3300025931 Bacteria 635
135 Ga0207690_10049607 3300025932 Bacteria 2799
136 Ga0207690_10695605 3300025932 Unclassified 835
137 Ga0207706_10123422 3300025933 Bacteria 2278
138 Ga0207706_11391773 3300025933 Unclassified 576
139 Ga0207706_11547935 3300025933 Bacteria 539
140 Ga0207669_11924644 3300025937 Bacteria 505
141 Ga0207689_11402230 3300025942 Bacteria 585
142 Ga0207661_10002909 3300025944 Bacteria 11833
143 Ga0207661_10099718 3300025944 Bacteria 2436
144 Ga0207661_10261591 3300025944 Bacteria 1541
145 Ga0207661_11840643 3300025944 Bacteria 551
146 Ga0207679_10057606 3300025945 Bacteria 2875
147 Ga0207667_10355047 3300025949 Bacteria 1495
148 Ga0207639_10157183 3300026041 Bacteria 1911
149 Ga0207702_10213378 3300026078 Bacteria 1795
150 Ga0207674_10141033 3300026116 Bacteria 2369
151 Ga0207674_11132707 3300026116 Bacteria 752
152 Ga0207698_10318535 3300026142 Bacteria 1455
153 Ga0207698_10929455 3300026142 Bacteria 878
154 Ga0207698_11279582 3300026142 Bacteria 748
155 Ga0207428_10135092 3300027907 Bacteria 1886
156 Ga0265326_10000010 3300028558 Bacteria 184218
157 Ga0265319_1000296 3300028563 Bacteria 37027
158 Ga0265319_1001081 3300028563 Bacteria 16941
159 Ga0265334_10287753 3300028573 Unclassified 563
160 Ga0265318_10000919 3300028577 Bacteria 19143
161 Ga0265322_10039602 3300028654 Bacteria 1341
162 Ga0265320_10101138 3300031240 Bacteria 1327
163 Ga0265316_10084983 3300031344 Bacteria 2422
164 Ga0265314_10059017 3300031711 Bacteria 2627
165 Ga0307405_10025350 3300031731 Bacteria 3403
166 Ga0307405_10056741 3300031731 Bacteria 2457
167 Ga0307413_10129910 3300031824 Bacteria 1722
168 Ga0307410_10755395 3300031852 Bacteria 824
169 Ga0307410_10942805 3300031852 Bacteria 741
170 Ga0307410_11159515 3300031852 Bacteria 672
171 Ga0307406_11054345 3300031901 Bacteria 700
172 Ga0307407_10859286 3300031903 Bacteria 694
173 Ga0307407_10987337 3300031903 Bacteria 650
174 Ga0307412_10117204 3300031911 Bacteria 1911
175 Ga0307409_100031857 3300031995 Bacteria 3813
176 Ga0307409_100210874 3300031995 Bacteria 1745
177 Ga0307409_100468865 3300031995 Bacteria 1219
178 Ga0307409_101450841 3300031995 Bacteria 713
179 Ga0307416_100003736 3300032002 Bacteria 9035
180 Ga0307416_100703872 3300032002 Bacteria 1099
181 Ga0307411_10175935 3300032005 Bacteria 1619
182 Ga0307415_100148917 3300032126 Bacteria 1798
183 Ga0307415_100804082 3300032126 Bacteria 858
184 Ga0373941_0305788 3300035115 Bacteria 636
185 Ga0395899_0252821 3300037312 Bacteria 1209
186 Ga0395899_0402197 3300037312 Bacteria 906
187 Ga0395900_0645129 3300037418 Bacteria 996
188 Ga0395900_0977470 3300037418 Bacteria 767
189 Ga0395898_0321669 3300037466 Bacteria 1476
190 Ga0395898_0853533 3300037466 Bacteria 850
191 Ga0436364_0097870 3300037853 Bacteria 962
192 Ga0436364_0643235 3300037853 Bacteria 1376
193 Ga0436364_0763145 3300037853 Bacteria 1124
194 Ga0436364_0778570 3300037853 Bacteria 2495
195 Ga0436364_1168941 3300037853 Bacteria 633
196 Ga0395901_0057056 3300038443 Bacteria 4062
197 Ga0395901_0389390 3300038443 Bacteria 1433
198 Ga0395901_1092167 3300038443 Bacteria 769
199 Ga0395901_1106917 3300038443 Bacteria 762
200 Ga0395901_1480728 3300038443 Bacteria 635
201 Ga0436365_1137927 3300039437 Bacteria 791
202 Ga0436365_1162608 3300039437 Bacteria 532
203 Ga0436360_0097336 3300039438 Bacteria 652
204 Ga0436363_0838633 3300039450 Bacteria 654
205 Ga0436363_0880650 3300039450 Bacteria 683
206 Ga0436363_0882735 3300039450 Bacteria 2015
207 Ga0436363_0932650 3300039450 Bacteria 867
208 Ga0436362_0449477 3300039453 Bacteria 879
209 Ga0436362_0757383 3300039453 Unclassified 948
210 Ga0451833_0252317 3300041491 Bacteria 2240
211 Ga0451851_0193807 3300041507 Bacteria 694
212 Ga0451853_3567599 3300041512 Bacteria 1286
213 Ga0439463_009984 3300042016 Bacteria 2333
214 Ga0450888_075688 3300042126 Bacteria 511
215 Ga0439435_0368612 3300042436 Unclassified 501
216 Ga0466969_0003179 3300044656 Bacteria 8754
217 Ga0466969_0004773 3300044656 Bacteria 7216
218 Ga0466969_0475459 3300044656 Bacteria 569
219 Ga0466965_0267258 3300044683 Bacteria 921
220 Ga0466965_0301933 3300044683 Bacteria 869
221 Ga0466965_0682476 3300044683 Bacteria 588
222 Ga0466966_0266298 3300044684 Bacteria 1031
223 Ga0466966_0308038 3300044684 Bacteria 952
224 Ga0466961_0005923 3300044693 Bacteria 7748
225 Ga0466961_0014764 3300044693 Bacteria 5018
226 Ga0466961_0187032 3300044693 Bacteria 1285
227 Ga0466961_0751313 3300044693 Bacteria 583
228 Ga0466963_0006143 3300044694 Bacteria 7087
229 Ga0466964_0059338 3300044706 Bacteria 1589
230 Ga0466968_0028609 3300044735 Bacteria 2299
231 Ga0466968_0039042 3300044735 Bacteria 1997
232 Ga0466968_0470512 3300044735 Bacteria 623
233 Ga0466970_0095361 3300044765 Bacteria 1617
234 Ga0466957_0331499 3300044842 Bacteria 1029
235 Ga0466957_0568213 3300044842 Bacteria 792
236 Ga0466960_0000017 3300044901 Bacteria 55906
237 Ga0466960_0019837 3300044901 Bacteria 2968
238 Ga0466960_0104042 3300044901 Bacteria 1466
239 Ga0466960_0281113 3300044901 Bacteria 933
240 Ga0466959_0000359 3300045049 Bacteria 26972
241 Ga0466959_0030576 3300045049 Bacteria 3988
242 Ga0466959_0200121 3300045049 Bacteria 1391
243 Ga0466959_0228156 3300045049 Bacteria 1290
244 Ga0466959_0375908 3300045049 Bacteria 967
245 Ga0466959_0892275 3300045049 Bacteria 593
246 Ga0466959_1173148 3300045049 Bacteria 510
247 Ga0466958_0000626 3300045836 Bacteria 15147
248 Ga0466958_0113867 3300045836 Bacteria 1689
249 Ga0466958_0155579 3300045836 Bacteria 1443
250 Ga0466958_0168766 3300045836 Bacteria 1385
251 Ga0466967_0002572 3300045976 Bacteria 11393
252 Ga0466967_0125511 3300045976 Bacteria 2377
253 Ga0466967_0293364 3300045976 Bacteria 1563
254 Ga0466967_0484705 3300045976 Bacteria 1212
255 Ga0466967_0981478 3300045976 Bacteria 841
256 Ga0466967_1923528 3300045976 Bacteria 588
257 Ga0495584_0376850 3300046491 Bacteria 721
258 Ga0495596_0094089 3300046500 Bacteria 1163
259 Ga0495607_0142731 3300046501 Bacteria 1234
260 Ga0495630_1221768 3300046517 Bacteria 568
261 Ga0495668_0127203 3300046616 Bacteria 1395
262 Ga0495670_0374643 3300046691 Bacteria 768
263 Ga0495677_0265962 3300047445 Bacteria 672
264 Ga0495602_0823937 3300048088 Bacteria 622
265 Ga0496104_1242182 3300048907 Bacteria 648
266 Ga0496108_0395083 3300048911 Bacteria 1208
267 Ga0496109_0912524 3300048912 Bacteria 816
268 Ga0496109_1701982 3300048912 Unclassified 564
269 Ga0496112_0000209 3300048915 Bacteria 38008
270 Ga0496112_0009107 3300048915 Bacteria 8921
271 Ga0496113_0545078 3300048916 Bacteria 930
272 Ga0496115_0719537 3300048918 Bacteria 783
273 Ga0496121_0170550 3300048924 Bacteria 1581
274 Ga0496124_0306914 3300048927 Bacteria 1143
275 Ga0501299_148695 3300049522 Bacteria 589
276 Ga0501031_0353978 3300049568 Bacteria 950
277 Ga0501036_0889308 3300049572 Bacteria 731
278 Ga0501039_0624318 3300049575 Bacteria 844
279 Ga0501040_0220493 3300049576 Bacteria 1349
280 Ga0501042_0841989 3300049578 Unclassified 668
281 Ga0501042_1260991 3300049578 Unclassified 539
282 Ga0501048_0387253 3300049582 Bacteria 999
283 Ga0501067_0728896 3300049583 Bacteria 558
284 Ga0501068_0065144 3300049584 Bacteria 2218
285 Ga0501068_0146013 3300049584 Bacteria 1485
286 Ga0501068_0318979 3300049584 Bacteria 996
287 Ga0501068_0375103 3300049584 Bacteria 916
288 Ga0501069_0288062 3300049585 Bacteria 962
289 Ga0501071_0063474 3300049587 Bacteria 2678
290 Ga0501071_0774165 3300049587 Bacteria 740
291 Ga0501072_0053362 3300049588 Bacteria 3184
292 Ga0501074_0074232 3300049590 Bacteria 2442
293 Ga0501075_0496166 3300049591 Unclassified 931
294 Ga0501076_0159827 3300049592 Bacteria 1835
295 Ga0501077_0457931 3300049593 Unclassified 817
296 Ga0501077_1055192 3300049593 Bacteria 523
297 Ga0501079_0062436 3300049741 Bacteria 2874
298 Ga0501079_0350476 3300049741 Bacteria 1157
299 Ga0501080_0052927 3300049742 Bacteria 3779
300 Ga0501081_0120110 3300049743 Bacteria 1871
301 nmdc:mga03n38_146990_c1 3300050490 Bacteria 1182
302 nmdc:mga03n38_698483_c1 3300050490 Bacteria 584
303 nmdc:mga0yw44_578974_c1 3300050492 Bacteria 762
304 nmdc:mga0yw44_731166_c1 3300050492 Bacteria 672
305 nmdc:mga05p37_223030_c1 3300050507 Bacteria 2274
306 nmdc:mga06r32_1242809_c1 3300050510 Bacteria 690
307 nmdc:mga06r32_900626_c1 3300050510 Bacteria 841
308 nmdc:mga08y16_1370600_c1 3300050511 Bacteria 671
309 nmdc:mga08y16_252451_c1 3300050511 Bacteria 1822
310 nmdc:mga08y16_981733_c1 3300050511 Bacteria 826
311 Ga0495655_0285812 3300053083 Bacteria 563
312 Ga0500556_0002826 3300053104 Bacteria 5314
313 Ga0500616_0073891 3300053153 Bacteria 1729
314 Ga0500599_002477 3300053736 Bacteria 2215
315 Ga0501084_0271678 3300054114 Bacteria 1431
316 Ga0501082_0453635 3300060353 Bacteria 1120
317 Ga0501082_0462492 3300060353 Bacteria 1109
318 Ga0466962_0157151 3300061719 Bacteria 1105
319 Ga0466962_0218484 3300061719 Bacteria 933
320 Ga0530510_0369192 3300061734 Bacteria 1079
321 Ga0530510_1476616 3300061734 Bacteria 522
322 Ga0075428_100012175
323 LJNas_1033666
324 LJQas_1004932
325 JGI24740J21852_10097785
326 JGI25406J46586_10059337
327 JGI25407J50210_10000468
328 JGI25407J50210_10011106
329 JGI25407J50210_10021563
330 Ga0070658_10130890
331 Ga0070676_10663836
332 Ga0070683_100000642
333 Ga0070683_100119972
334 Ga0070683_100167778
335 Ga0070680_100000668
336 Ga0070680_100194266
337 Ga0070680_100760951
338 Ga0070682_100072797
339 Ga0070660_100292589
340 Ga0070660_101827069
341 Ga0070661_100015940
342 Ga0070692_10309852
343 Ga0070669_100028852
344 Ga0070671_101131566
345 Ga0070659_100001305
346 Ga0070659_100866555
347 Ga0070714_100011204
348 Ga0070714_100147721
349 Ga0070714_100682123
350 Ga0070713_102464113
351 Ga0070711_101020786
352 Ga0070662_100797372
353 Ga0070681_10028718
354 Ga0070698_100834804
355 Ga0070699_100511800
356 Ga0070679_100001945
357 Ga0070679_100090929
358 Ga0070684_100008469
359 Ga0070684_100031304
360 Ga0070684_100962225
361 Ga0070695_101757790
362 Ga0068855_100437338
363 Ga0070664_100074851
364 Ga0070664_101165129
365 Ga0068856_100036468
366 Ga0068856_100940839
367 Ga0068852_100463289
368 Ga0068852_100606896
369 Ga0081455_10030258
370 Ga0081455_10054982
371 Ga0081455_10335971
372 Ga0081538_10000069
373 Ga0081538_10000086
374 Ga0081538_10000287
375 Ga0081538_10001744
376 Ga0081538_10003753
377 Ga0081538_10009676
378 Ga0081538_10051196
379 Ga0081538_10128042
380 Ga0081540_1000550
381 Ga0081540_1028701
382 Ga0081539_10001376
383 Ga0081539_10091592
384 Ga0070717_10000017
385 Ga0070717_10600062
386 Ga0070717_11204830
387 Ga0075365_10628875
388 Ga0075365_10876956
389 Ga0070716_101367991
390 Ga0075370_10772722
391 Ga0075428_100010970
392 Ga0075428_100054873
393 Ga0075430_100001287
394 Ga0075430_100144769
395 Ga0075431_102177974
396 Ga0075433_11777444
397 Ga0075429_100124418
398 Ga0075429_100779055
399 Ga0099795_10344199
400 Ga0105250_10260290
401 Ga0105240_10010586
402 Ga0105240_12224622
403 Ga0111539_10607954
404 Ga0111539_10921158
405 Ga0105245_10874747
406 Ga0105247_10851738
407 Ga0114129_10197212
408 Ga0114129_12476852
409 Ga0105243_10728609
410 Ga0105237_10055291
411 Ga0105238_10010528
412 Ga0105238_11104359
413 Ga0105249_12315913
414 Ga0105239_10877527
415 Ga0105239_11139671
416 Ga0105239_11140444
417 Ga0105246_10317524
418 Ga0157338_1037299
419 Ga0157371_10384333
420 Ga0157370_10040818
421 Ga0157369_10133166
422 Ga0157372_10167911
423 Ga0157372_11727577
424 Ga0157380_11831283
425 Ga0197907_10087821
426 Ga0206356_11249652
427 Ga0206355_1456721
428 Ga0206354_11711958
429 Ga0206353_10212128
430 Ga0206353_11615756
431 Ga0206353_12045082
432 Ga0154015_1073393
433 Ga0224712_10142240
434 Ga0224712_10248137
435 Ga0224712_10386808
436 Ga0224712_10462259
437 Ga0207710_10771545
438 Ga0207645_10833120
439 Ga0207705_10276813
440 Ga0207707_10004411
441 Ga0207695_10141894
442 Ga0207671_10633478
443 Ga0207693_10905758
444 Ga0207660_10004155
445 Ga0207660_10671797
446 Ga0207657_10019209
447 Ga0207649_10014401
448 Ga0207652_10019389
449 Ga0207652_10084773
450 Ga0207681_10005147
451 Ga0207681_10710688
452 Ga0207694_10111818
453 Ga0207664_10100106
454 Ga0207664_11098334
455 Ga0207644_11209112
456 Ga0207690_10049607
457 Ga0207690_10695605
458 Ga0207706_10123422
459 Ga0207706_11391773
460 Ga0207706_11547935
461 Ga0207669_11924644
462 Ga0207689_11402230
463 Ga0207661_10002909
464 Ga0207661_10099718
465 Ga0207661_10261591
466 Ga0207661_11840643
467 Ga0207679_10057606
468 Ga0207667_10355047
469 Ga0207639_10157183
470 Ga0207702_10213378
471 Ga0207674_10141033
472 Ga0207674_11132707
473 Ga0207698_10318535
474 Ga0207698_10929455
475 Ga0207698_11279582
476 Ga0207428_10135092
477 Ga0265326_10000010
478 Ga0265319_1000296
479 Ga0265319_1001081
480 Ga0265334_10287753
481 Ga0265318_10000919
482 Ga0265322_10039602
483 Ga0265320_10101138
484 Ga0265316_10084983
485 Ga0265314_10059017
486 Ga0307405_10025350
487 Ga0307405_10056741
488 Ga0307413_10129910
489 Ga0307410_10755395
490 Ga0307410_10942805
491 Ga0307410_11159515
492 Ga0307406_11054345
493 Ga0307407_10859286
494 Ga0307407_10987337
495 Ga0307412_10117204
496 Ga0307409_100031857
497 Ga0307409_100210874
498 Ga0307409_100468865
499 Ga0307409_101450841
500 Ga0307416_100003736
501 Ga0307416_100703872
502 Ga0307411_10175935
503 Ga0307415_100148917
504 Ga0307415_100804082
505 Ga0373941_0305788
506 Ga0395899_0252821
507 Ga0395899_0402197
508 Ga0395900_0645129
509 Ga0395900_0977470
510 Ga0395898_0321669
511 Ga0395898_0853533
512 Ga0436364_0097870
513 Ga0436364_0643235
514 Ga0436364_0763145
515 Ga0436364_0778570
516 Ga0436364_1168941
517 Ga0395901_0057056
518 Ga0395901_0389390
519 Ga0395901_1092167
520 Ga0395901_1106917
521 Ga0395901_1480728
522 Ga0436365_1137927
523 Ga0436365_1162608
524 Ga0436360_0097336
525 Ga0436363_0838633
526 Ga0436363_0880650
527 Ga0436363_0882735
528 Ga0436363_0932650
529 Ga0436362_0449477
530 Ga0436362_0757383
531 Ga0451833_0252317
532 Ga0451851_0193807
533 Ga0451853_3567599
534 Ga0439463_009984
535 Ga0450888_075688
536 Ga0439435_0368612
537 Ga0466969_0003179
538 Ga0466969_0004773
539 Ga0466969_0475459
540 Ga0466965_0267258
541 Ga0466965_0301933
542 Ga0466965_0682476
543 Ga0466966_0266298
544 Ga0466966_0308038
545 Ga0466961_0005923
546 Ga0466961_0014764
547 Ga0466961_0187032
548 Ga0466961_0751313
549 Ga0466963_0006143
550 Ga0466964_0059338
551 Ga0466968_0028609
552 Ga0466968_0039042
553 Ga0466968_0470512
554 Ga0466970_0095361
555 Ga0466957_0331499
556 Ga0466957_0568213
557 Ga0466960_0000017
558 Ga0466960_0019837
559 Ga0466960_0104042
560 Ga0466960_0281113
561 Ga0466959_0000359
562 Ga0466959_0030576
563 Ga0466959_0200121
564 Ga0466959_0228156
565 Ga0466959_0375908
566 Ga0466959_0892275
567 Ga0466959_1173148
568 Ga0466958_0000626
569 Ga0466958_0113867
570 Ga0466958_0155579
571 Ga0466958_0168766
572 Ga0466967_0002572
573 Ga0466967_0125511
574 Ga0466967_0293364
575 Ga0466967_0484705
576 Ga0466967_0981478
577 Ga0466967_1923528
578 Ga0495584_0376850
579 Ga0495596_0094089
580 Ga0495607_0142731
581 Ga0495630_1221768
582 Ga0495668_0127203
583 Ga0495670_0374643
584 Ga0495677_0265962
585 Ga0495602_0823937
586 Ga0496104_1242182
587 Ga0496108_0395083
588 Ga0496109_0912524
589 Ga0496109_1701982
590 Ga0496112_0000209
591 Ga0496112_0009107
592 Ga0496113_0545078
593 Ga0496115_0719537
594 Ga0496121_0170550
595 Ga0496124_0306914
596 Ga0501299_148695
597 Ga0501031_0353978
598 Ga0501036_0889308
599 Ga0501039_0624318
600 Ga0501040_0220493
601 Ga0501042_0841989
602 Ga0501042_1260991
603 Ga0501048_0387253
604 Ga0501067_0728896
605 Ga0501068_0065144
606 Ga0501068_0146013
607 Ga0501068_0318979
608 Ga0501068_0375103
609 Ga0501069_0288062
610 Ga0501071_0063474
611 Ga0501071_0774165
612 Ga0501072_0053362
613 Ga0501074_0074232
614 Ga0501075_0496166
615 Ga0501076_0159827
616 Ga0501077_0457931
617 Ga0501077_1055192
618 Ga0501079_0062436
619 Ga0501079_0350476
620 Ga0501080_0052927
621 Ga0501081_0120110
622 nmdc:mga03n38_146990_c1
623 nmdc:mga03n38_698483_c1
624 nmdc:mga0yw44_578974_c1
625 nmdc:mga0yw44_731166_c1
626 nmdc:mga05p37_223030_c1
627 nmdc:mga06r32_1242809_c1
628 nmdc:mga06r32_900626_c1
629 nmdc:mga08y16_1370600_c1
630 nmdc:mga08y16_252451_c1
631 nmdc:mga08y16_981733_c1
632 Ga0495655_0285812
633 Ga0500556_0002826
634 Ga0500616_0073891
635 Ga0500599_002477
636 Ga0501084_0271678
637 Ga0501082_0453635
638 Ga0501082_0462492
639 Ga0466962_0157151
640 Ga0466962_0218484
641 Ga0530510_0369192
642 Ga0530510_1476616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

18

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9038 2 97
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8734 1 99
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8691 2 97
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8652 1 99
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.862 2 94
ID Description Score Start End Superfamily
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8778 1 83 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8734 1 99 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8652 1 99 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8631 1 94 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8372 1 94 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A7V9VSV9-F1-model_v4 deleted 0.9604 1 81
AF-A0A537GS23-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9536 2 83 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A382RI87-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9488 2 84 GO:0009570
GO:0016226
GO:0030674
GO:0051536
AF-A0A7V9VSV9-F1-model_v4 deleted 0.938 1 81
AF-A0A534SB90-F1-model_v4 Fe-S cluster assembly protein SufB 0.9213 2 94 GO:0016226
GO:0051537

Map